2D8KA

Solution structure of the first c2 domain of synaptotagmin vii
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
141
structure length
141
Chain Sequence
GSSGSSGSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first C2 domain of synaptotagmin VII
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords synaptotagmin VII
total genus 14
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2d8kA00
4ANXA 1QATA 4KITB 2NSQA 2Q0ZX 2CHDA 2ENJA 2Z0UA 3L13A 4EZLA 2CHZA 3HIZA 1DQVA 2K45A 4LDCA 4PS8A 1BCIA 2WXLA 4ICXA 4WWPA 5JHAA 4WEEA 3RPBA 2K4AA 4TS6A 4L23A 1WFJA 4DNLA 1RSYA 2FK9A 4L1BA 1UOVA 1E8XA 3NSJA 4HVBA 2EP6A 4AJWA 3OHMB 3L9BA 2CM5A 3DPDA 4GNKB 1UGKA 4ANWA 2DMGA 3T8MA 3PRZA 2WXMA 2A5UA 5H4ZA 3TJPA 3TL5A 3MJWA 4KZCA 2ENQA 4LT7A 3HHMA 2JQZA 4L1LA 3L16A 3FBKA 5JHBA 1CJYA 3NZUA 3PYCA 3ZVVA 3ZW3A 4F1SA 1E8YA 3FDWA 2WXPA 3IBEA 1QASA 1V27A 1TJMA 5CCHE 1E7VA 4EZKA 3F05A 3GPEA 2CM6A 3ENEA 3L17A 3OAWA 4FULA 3F04A 2ENPA 1GMIA 3QAQA 4NPJA 4TV3A 4F91B 5CCJA 2NQ3A 2K3HA 4Y1SA 3TWYA 4WWNA 3ZIMA 1RH8A 2LHAA 1WFMA 4WAFA 2V4LA 2BWQA 2QZQA 5H4YA 4ANUA 4V11A 2QZ5A 2WXJA 3R7QA 1W15A 2N1TE 3L54A 4FHKA 4QJ3B 4PS7A 2YOAA 2WXKA 3APFA 1DJWA 3P2BA 1DSYA 3PS6A 3IM1A 4FADA 2X38A 2CHXA 2CHWA 3W57A 3APDA 1DJHA 4NP9A 1DJGA 1DJXA 2K8MA 2KI6A 2B3RA 4FJZA 4FLHA 4IQHA 3QR1A 1A25A 4Y1TA 1UOWA 4WWOA 1E8ZA 2ISDA 4FJYA 3QJZA 2WXIA 3CSTA 5G2NA 2YRBA 2RD0A 5T8IA 4URKA 3M7FB 4BFRA 3QK0A 4DK5A 4QJ4B 4XZ4A 1YRKA 3PREA 2WXRA 4KZ0A 2D8KA 4AOFA 4QJ5B 3W56A 4XE0A 2WXFA 4JPSA 2CJTA 3PFQA 3CSFA 2NCEA 1BDYA 2R83A 3RDJA 4F92B 3APCA 3QR0A 4G11A 3LJ3A 4LCVA 5KJ7E 2UZPA 1HE8A 1TJXA 4A55A 3HN8A 1DJIA 1K5WA 3R7RA 3QARA 3L08A 3B7YA 4ANVA 4F93B 1E7UA 2Y3AA 4BGDA 4ICWA 4XX5A 1DJYA 2DMHA 3F01A 2CJSA 1BYNA 2WXOA 4FA6A 3ML9A 3F00A 4OVUA 3KWTA 4NS0A 2WXQA 5CCGE 4L2YA 3N5AA 3SD5A 1E90A 4IHBA 4MJJA 3DBSA 3ML8A 2FJUB 2WXHA 4FHJA 4NPKA 5G55A 4TUUA 2WXNA 4HLEA 3JZYA 3S2AA 1W16A 4QAMB 4PS3A 4GB9A 4J6IA 2A4ZA 1DJZA 2ZKMX 4OVVA 4EZJA 2WXGA 2Q3XA 5EDSA 1E8WA 3NZSA 3L4CA 3KWUA 1RLWA
chains in the Genus database with same CATH superfamily
1OK8A 1VHPA 2JNZA 1D5BB 5AUMA 2JF1A 3ZHNA 2YN3A 3QUGA 2Y2WA 3FO1B 4TLSA 3GDCA 1JGIA 3FUIA 3QHZH 5CFAA 1NIAA 3V4UL 5JHAA 2NNFA 5IV2A 4ESKA 4FKEA 5A43C 2F54D 4JUSA 4JE0A 4FYRA 1HJCA 4AV4A 4OFYD 4AJYV 3G6JE 4LSVL 1E2ZA 1NKOA 4Q74A 1N0XL 2FBRA 1XIWC 4HFWA 3MBXL 4XC3H 3X1BA 3GSQB 1S7WA 4RGOL 2IDCA 2W9DH 4ZXBD 2ZSWB 3V2AR 3FUJA 3ULVL 1CTOA 1U93B 2VQUA 3GMMA 2X6UA 3VH8G 4QRTA 4DQOL 4PMEA 2VLKA 3TC9A 3IDXL 3EJQA 1A2YB 3TCLA 3U0TA 1PFOA 3VXOA 3BP6A 4A2HA 4Z0BL 3PIQA 4YAQB 1AQMA 3WHXB 5E4AA 3LZOA 2Z31C 3U2JA 5FYJL 3SKJL 5E8NB 2WTRA 2DLHA 2F7OA 1WZLA 4OCYL 3LZNA 2WBJD 4R6UA 2I69A 3NZ8B 5I1JH 2J57A 1MCEA 3GINA 4MAYA 1F56A 3SBWA 2FHCA 1GGBH 4PRNB 4ELMA 3HFMH 3ZQ9A 4F2MA 1R3JB 2CKBB 4HX1A 1YY9D 2OS7A 2D0GA 3CFBB 4J27A 5D7JB 5EC2B 3QE5A 4EXPX 5DMYA 5I18L 2VMCA 1M42A 1LJMA 3FSOA 1XGUB 5CD5C 3ZDXE 2CJTA 4GMSL 2DWXA 4RMTA 2X41A 2MHAB 4ODXB 2HMID 1F8TH 3B6SA 4NQCA 1FRGH 4XHJD 1X5XA 3RBSA 1XBDA 3MV8E 4W9IC 3N43B 2LU5A 5IBUG 2EYTB 3L08A 2GJZB 4HXAH 4D0BB 4CGUB 4HS8L 4LCWE 1CE6A 2D7OA 3CQPA 3CVBA 3GO1L 3O6FA 2ADJB 3QWOB 1UUSA 3F01A 3KGTA 4OIAA 3K71B 3VSTA 2R0ZL 4NO3A 5GGVL 5TH2A 2XKNA 3MODH 4KMLB 1DDHA 2P24B 4ZAKC 1UFUA 4P2YA 5JQ6L 5IB3A 1ZGLB 2I9LB 3SPVB 2AJUL 1VFUA 2ZCKH 2XQYA 4YXHL 4QF1B 2BVQB 3EGXA 2ZWSA 5E8EA 1E3FA 2PWDA 3JUYA 4PHXA 5DMGD 4LCCB 4LEOB 5EU6B 1Y18A 2JWYA 4MYWB 3WL9B 4G6AC 2MSPA 2GAZA 3DWTA 2DEXX 4Q52A 1LHZA 1BFOB 4ZS6D 4DIXA 2V2XB 1ONQB 3QUXD 2VLJA 4G1MB 5IFJA 4HWBH 5GRZA 2G5BA 2MTPA 3IMWA 3QORD 5E00B 1X5LA 3BE1L 2Z35A 3IFLH 4WI0B 1HSBA 2Y72A 1KFGA 1V8HA 2A73A 2EAEA 3QQ3A 4AJWA 3KJ6H 3GSWB 3BIAX 1OCRB 2DQDH 1AHWC 1WTLA 3D18A 3G9AB 2DTMH 1X5MA 2H32B 3WEBA 3TYFB 1JZ7A 2EE2A 4M62L 4XRCA 3UFIA 4ETQA 3T2NH 4YHZL 2ENPA 2Y36H 4N2FA 2NY1D 5I9QC 1DBJL 3QI9B 2X2HA 2PYEE 1YEIH 4XN9A 2V4LA 4PD4K 3EJZC 1BYPA 3Q2LA 3R1GH 3REVA 5KW9L 3UG4A 4IKNA 4R83A 4JZJC 3LQAH 5IFHL 5IHLB 5FO9A 2QSTA 2DJUA 3EJCA 1CDGA 2YD7A 2WXIA 4UDTB 1N59B 3E2HB 4JQVC 1WCQA 5D1QA 4UT6H 4OAWB 3TJEH 3PL6D 4YDJB 4ZUTA 1YMMA 3CHOA 2P43B 3TBWB 4ZAKA 3ARBD 3F7VB 3Q7JA 2F58H 4M93C 5CSGA 3EO0B 5DJZB 2EEBA 3GEWB 4I18A 1BQRA 5DJ2A 3QQ4B 2YK1L 3EOBA 1G9NC 2CJUL 3K91A 5LJYH 1FGNL 2BY1A 2I07B 4XVOA 5CIPH 4JY4A 3WMQA 4LCWA 2W60A 1KJVA 1E9PB 3JVFC 1J5CA 4NNXB 2QHLA 5A2AA 2P8PB 1BQHB 4Z7UE 2NX5B 3SE9L 4L5FH 4X9FA 3BEWA 2WN2A 3D30A 1EO5A 2ZOUA 1TQCB 1S7TA 2VL5A 3NYKA 4U1KB 5KYYA 2ED8A 5HYSA 5IMLB 2NNCA 1I8KA 1QMUA 2I9TB 1G1YA 3K71A 5GGTA 2CBPA 4QHKJ 4WW2C 1I7ZA 4O2CA 2P5ED 3ZDXB 4GT0A 5FOBA 3PV7A 3TPKA 3SBWC 3VFNB 4NZDA 1CFTB 3DX6A 2XPGB 1NAMB 3Q5OA 5FLUA 1U92A 4Z9KB 1AHKA 2Z4QB 4E9TA 3AAZA 5C0GA 1OP4A 3FRUB 5KSVB 1I3GL 3IN2A 5MEPA 4JG0H 2Z64C 3OBAA 2ESVB 4M1DL 3TN0A 2A9CA 2H41A 3GF8A 3BGMB 1N18A 3IEAA 1T4KB 4F37F 1MLBA 5MEQB 3DJTA 4H13C 3TIDB 4JM4L 1JUFB 1Z9LA 1QLFB 3D08A 3FU6A 4A6YH 3BAYA 3NABL 4OGXH 2GKIA 3HVNA 3IS1X 2YPLA 4PGBB 4G6ML 4JPKH 3ZTNH 3HN5A 4ANKA 1YDPB 3HG5A 3HG2A 4BE5A 2HYMA 4BK5C 4YH6A 1AOHA 4MYPA 3QNYB 4F37K 3OB0K 4G80A 1M6UA 2CD0A 4G1EA 4DN4L 5F6IB 2ZUVA 3JTSA 1SOSA 3HB3D 3L7EA 1ML0A 3T3MB 4B97A 1Q9LB 3SGEI 4Y19E 4LPVA 3W5MA 3NP4A 3DUSA 4MB5A 5F89A 1PEWA 5BOZG 1OAUL 4K3HA 1YN6A 4UTBH 1BQSA 5D55A 5JPNA 1QAWA 4L5FE 4KUZL 3STLB 2C9RA 1UOWA 4DP4X 1OHQA 2ICEB 1VESA 1GS6X 4JFEE 4LPYA 4PWEA 4YL4A 3VD3A 1HQRB 4Y2LA 5D2LF 2J1KA 4Q2ZA 4NN6B 1BBJA 4TPRL 4X7FC 2Z92A 5F6HJ 5IJVB 1TXKA 1T1YA 1PD1A 5EPMB 2Z91B 3VXQA 3DXAB 2O5NA 4HPOL 1VGKB 3KPRE 2XJKA 3GBDA 1YEFH 2ZUQB 1KGCD 2TRYA 3CDGB 4GKNA 4ELMB 4YHNB 1YEHH 5DDHB 3E8UL 4HHAA 1UKTA 4RFEB 3WSQL 4I0CC 3F3HA 3T65A 3IVKB 2A9DA 1TVHB 1M7DB 3RUGB 1J8HA 1GZQA 1HEZA 4K3DH 4OM1H 3CQQA 2HT3C 2G75A 4PJ8B 3NN8A 4J28A 4JFWA 3BZ4A 5D7LB 3T77B 4FL4C 3KS0J 2IPUG 1XR9A 3QDJE 4NKMB 1WWBX 2X40A 4NXKA 5J57B 2PO6C 3D39A 3GTTA 3OSKA 1GYWA 4MNGB 1J9RA 2KDGA 4D0BA 2LU7A 1A14L 3V52H 1T20B 4CVXB 2DTML 3P3YA 4Y9EA 3SD2A 2EVIA 2KUTA 4Z3EA 1T0PB 2BOBB 3G5XA 5BQ7A 2MEJB 3L95B 3TVMC 4GRWF 5D7HA 2A77H 1KFAL 1V10A 2RMNA 5C09E 3BVTA 2J8OA 3GMNA 5GJSH 5JMRA 3LNEA 1NEPA 2HT2C 2ZOLB 3FCTB 1AGCA 4KUCF 1QW8A 2BVQA 4Z78A 4CU8A 3EYQD 5HYJE 4BRJA 1SEQH 1N8ZB 3X13B 4IBWA 4GW4A 1AO7A 1TQTA 4KPHH 2DICA 1TTCA 3KNBB 4ANWA 3ZKNC 4C56E 5C6PB 4P57A 4KC3B 1NGPL 4G8AC 1T1WA 3FOMB 1OGAE 1U6AL 4EN2A 3X12A 3BSHA 4ECNA 4N1CA 2CLRA 2W07B 3NRPA 4QRPA 3FL7A 3SCMA 1JZJA 2CRZA 1BG1A 3DMMB 3D2UB 1Q72H 1FFQA 4F15B 2CDEB 3OLGA 3R1GL 4HWEH 4HJIA 5C0AA 1B0GA 1L9NA 1AZRA 1J05B 3QC6X 5LHDA 2CO2A 2XRAL 2XV0A 4ZMPA 4MA3B 4Y9FA 5I8EB 4R7LA 2FATL 3ZQXA 1LWRA 2G5UA 3WEMA 4DGIL 5GS0L 5CLYA 2I25N 4DTGL 1GZPA 5EN2A 3HR6A 3BIBX 2GIMA 4EN3B 1N6QL 4LIQE 5I15L 1IC0A 2OMWA 5ACZA 1MCFA 5B7EA 5L2KB 1ZS2A 3RP1A 2X53A 5D6CB 3HG1D 3EBGA 4KDWA 3BE1H 2E4FA 4FC3E 4H8QA 1P7HL 3ALXA 1BLNB 1LO0H 3ZTJH 3U0PA 4PG2A 2QADD 3UPAA 3QFGA 4AK2A 3FOLA 1SN5A 4DKFH 2IBZX 5E2UL 2ZTBA 2R0LL 2WQAA 4K07A 4PGDA 1INDL 2VDOB 4GXFA 3QARA 4K8RC 4UDUA 4YHLH 1E28B 2A6IA 4E2OA 3M1CA 2Y6SC 4YSPA 1AGBA 4LNRA 2SEBA 3VFWA 2AK4B 3LNHA 5E99L 4R7XA 3ROLA 3H1ZA 2DH3A 1QWNA 4KK5D 1S78D 3C5ZD 3FU0A 1DVQA 1YEIL 2B08A 1KPRA 2JKNA 2OPCA 4MX7A 3CGTA 5C0RL 2NZ1A 5HI5D 4DGVL 4HFUH 1RK1B 3DX2A 4PIBA 4QAMB 4W6YB 4WV1C 1TNNA 4WWKC 3SBQA 2ZUUA 3REWA 5C0NC 1JHLH 5JYLA 3QB7C 5A40E 4L8SC 1UQSB 1I8MA 1JNNL 4ANXA 1E67A 1CL7L 2DQIL 4AT6B 1MCWW 4P4RB 4DP7X 1WHOA 1BZ8A 1JZFA 1KGJA 2UY6B 1IBBA 1WZKA 5GRVL 2ZKHH 4KI5C 3PGDB 5AKRA 4NQTA 2GJ6B 2LW3A 4PPTA 3WFCH 1NGZA 4W9FC 3RWEB 3QXDB 1HSBB 5TDNB 1XXFC 5T1LA 4PJIA 3QFJD 4G7VL 1NEZA 3QPQC 2H2PC 5ICUA 3CH1B 2ZAGA 4JFYA 5D71H 3RKPA 5K1NA 3BW9B 4QXUH 3QAZB 4X5QA 4F7PA 4F7CA 1E5ZA 2DIEA 2VJ8A 1GTNA 2DW5A 2CO7A 2Y07L 3OKLA 3IJEA 3TN0B 2XWZA 4ERSL 3L5JA 4WWNA 2GIYA 1AZNA 3BXNB 5F72S 3WN5B 1JGUH 3EGDA 3GBNL 5F96L 2DQJL 1UUNA 1T4KA 4NO5A 3T0VA 5H4YA 1OCWH 3QNZB 1KXTB 3F7KA 2ZPKH 5FDWA 2FQEA 3WHE0 5L2JB 1L6XA 1LXMA 3I3DA 3O6FC 4HCRH 2FSDA 5AOLA 4NT6A 5E6IA 3T6QC 2R2HB 4NC1E 4OCLC 4YXKH 1HHHA 5KS9B 3D33A 2ZKYA 1CGUA 1N59A 1ASOA 1E4XL 2ZCZA 5DJCA 2DLGA 3MLUL 4XR8C 3ATDA 2R8SL 4TTDD 3ZL2A 1I1AA 3S88L 4JFZH 2CR3A 4U7KA 4X7SH 4FTVD 3VH8A 4CAGA 4KK6C 3CFJB 3D2TA 1NCNA 4I88A 4N2CA 4D9RD 1RMFL 3UG5A 4ZG1A 4PGCA 1C12A 4FTVA 3T0EB 4D0CA 4O2EA 1QLRA 4KJPD 1AKJB 2DOCA 2UUDH 4TUJA 4ZYKA 2AEOA 4WNSA 4HK3N 4NYLB 4OGXL 1UXWB 2WWMD 4GBXB 2HKFL 2VR8A 3NPZB 4GIPD 1WJ3A 1KJ2A 1AP2B 4N0UA 3QZWA 2BRQA 4NS0A 4GT7A 3E3QE 1U91A 4AC4A 2BP8A 4PGEB 1FPTH 4C58B 5KYYB 4OLYH 4MB1A 4BKLB 2AQ2A 1P6FA 3L2MA 3RDTA 4R4FH 1I7ZB 5AOIA 4P9MH 4O58L 4XPFH 3GSOB 3OJ2C 4JO1H 4JZJB 4HCRL 1PAMA 3U9PL 1RL1A 2DQFA 5GZNA 1FORH 4OQTH 1OGAD 3GMPA 2X4RA 1IGJA 1OTSC 1WCBA 3CK0L 3SE8L 2KPNA 1C1EL 3KPMA 3NJJA 1G1CA 4NQEB 2AFNA 4ZTOH 2VN4A 4C56D 4ZS6C 1Z66A 1T20A 3GHBL 5BRQA 1ZS8A 3BPNC 5CJQL 5IREA 5EORL 4GOSA 3O4LD 5GS2H 4LCWB 3ARRA 4TUOB 3T6XA 4JRFA 4YSEA 5BUAA 1BAFH 2MPAH 2YQGA 5D4QA 1RHFA 1RK0B 2GJ6A 1T7WA 1M53A 2Y4SA 4HAFA 3SE4A 1X5AA 4N0RA 3RB5A 5CCHE 8PAZA 2DBLH 1BZQK 3GM8A 3KBHE 3NK4A 1E3XA 1GGCL 2IOOA 2NY6B 1A3RL 1JK9A 3BPLB 2OMBA 4JRWA 2VYRE 4YBHA 3FQNB 1MJ8L 2CLZB 1Q0EA 5DQJA 5KN5A 4U1SB 5F7BA 5AYTA 4OCWL 1P7KB 5ANMA 5HI4C 4BFIB 4J39A 3NG5A 3ZKMC 1UD4A 3SKNA 4K9JA 4FXKC 3ALPA 3PQYE 3C5ZA 2F7IA 5E1AB 2Q10A 5BZWA 1I9IH 2A38A 4Z0XB 1T2XA 3GXDA 9PCYA 2GVYA 2ICWB 2CUAA 1FYTA 1MVUB 4WU5B 2D7QA 4KVCL 2XETA 3LCYA 5EOQH 3TNMB 3VXUD 5MI0B 2XWCA 2X1OA 5LG1A 5D1QE 1Z9NA 1B4RA 3ZL4L 5FHAH 2YOCA 4N9GB 4JPSA 1R5VA 4K2UH 5DR5H 2OZ4H 1FJ1B 4MXWH 4I9WE 1NL0H 2IQ9L 3ZSTA 1YPZB 1DBBH 2X7LA 4Q6IA 5HP5A 4IBLT 3NDZE 4L1HA 3B5HA 4XTRC 3ILDA 1UASA 4XVJL 3DOIA 1ETA1 2YRZA 5IBTH 3ZE2E 4X8CA 1IGFH 1MI5E 3CFJA 4TNFA 4TQHA 3VFRB 2E8YA 2FGWL 2VXVL 3T4AA 1LEGB 3C8KB 4WSJA 4RWYH 5CP7B 3WO4C 3RNKB 3UO1H 5JXED 2QVKA 3PABA 5DVKA 3ILPB 1KTRL 3DYMA 1DQJB 1MCWM 5IK3B 4KHTH 3I6LE 1T1XB 2WBXA 2V9RA 1FCGA 4C83B 3AY4C 2WMPA 3D4GA 4YO0A 2CUMA 4YIQB 3M1BA 3RI5F 2ARJA 3ZDZE 2QDVA 3IPBA 4J3OH 2O5XL 3S5LB 4KK9D 4F33A 2QQNL 3BQVA 5T1KB 4OF0A 5AAWA 2NT0A 1FGVH 3LQAC 1OWRM 3WIFA 1ORQA 4M6NH 4PH8A 3S8GB 2V2TA 1IKFH 4QNPF 3W81A 2Y5TA 3KGRA 1IC5L 1FGVL 4PB0L 4ZFZB 1MFAH 1YLBB 3WHXA 3EXLA 5L4FA 2R1WA 5E08L 3DPDA 4GW4B 4PHZA 5F1NA 3GMPB 4N2GA 1KY7A 3EYSH 1NCBH 4HUKB 4XN8A 3ROOA 4X0NA 1JGVL 1FBIL 4XMWA 2DQUH 2Q6WA 4M03A 3TT3L 5HHOB 4P23C 3ISWA 4HUMB 4C55A 1OTUD 3CXFA 4DETA 4HGWA 5BMFH 1E30A 1GOGA 3T0EC 1FNEA 3IGUA 2VXTL 4LLWB 4NP4H 2FGWH 2QR0B 4JDZA 3LN4B 4M3HA 1ZV2A 1TQCC 2QQKH 3TEWA 2CAKA 2VN6A 4OR1A 3IS0X 3PGCB 4EDXB 2AQQA 4WU7A 4XPGH 4Y19A 3GXTA 2WGNB 4YHIA 4CJ1A 4FL4B 3ZTCC 5EEXA 4TF4A 3D39D 4TSAH 3QDJB 5I5JA 1QG3A 1HH9B 3CDYA 4NLAA 8FABB 5KSBF 2B3RA 3UC2A 2R4SH 3JYCA 3QJSB 5SWSE 3FHAA 1FYTE 2AK1H 2F5AH 1KC5H 1NAML 3QIWB 4XT1C 3UTTE 5EN2B 3V0WH 4Z7WE 3MR9B 3AT9A 4KDTA 2DV6A 3DJSA 5I0ZA 2R4RH 4NNPH 3THMH 1DVFB 1FLRH 2DYRB 2IDFA 2EINB 3M46A 1THCA 1ECYA 1K85A 3ISYA 4WW1B 4OLYL 1WZAA 3TTSA 3VRLF 2P5WE 4ALAH 4Z7OF 4WVRA 4ZMLA 1AJ7L 3DHPA 4A55A 4BQ8A 4UOW0 1BD2B 5FM8A 5T1DH 2OL3H 5EOCJ 5T5FA 2R0WL 1NSNH 2A9NL 1T7YA 4OGYL 2BW4A 3N1FC 3TBSB 4CVZA 3A24A 5LG6A 1YPZA 2P47B 4DP8X 3IJ7A 4XI5C 3G5VB 2OTWB 2JKRM 1U95B 2C1PB 3SY6A 1MNNA 1NMBL 2EJ1A 5ABAA 1FO0H 3HZMB 4I0PA 1N0XH 4I4WB 3FAXA 3FQ4A 1F8TL 3TO4C 5GQBA 5I1IL 3ZE1B 2IMNA 3WJLA 1NUDA 2XPZA 1VERA 1GHFH 2YWYA 5BCAA 1MAML 3S5LG 4HFWB 4KITB 2AEQH 3KHQA 3EAKA 3U7WL 4HXBH 3RQ3A 2IQAB 5I17A 1S2EA 2CK0H 4A2MA 3KDMB 1J5HA 5ADOL 2NRDA 4LNVA 5DTFB 5KWYC 4EN3C 1PDKB 4Y4KC 3O9WB 3GHEL 1UB5A 4JPVL 2Q8AL 3UBXI 3H9SD 1KB3A 3N40P 3SKJH 1FG2A 3GRWL 4PJ9D 1TEFA 5ILTL 4MASA 2A5UA 1Y07A 3TL5A 1G1OA 5D7EA 3DGCR 3CSPA 3Q44A 4NI6A 2HLAB 4AVIA 3ZKND 4BQCA 2OK0L 2FH6A 2J88H 2YD8A 4WJ5A 1W72A 3QZPA 3KVQA 1XVSA 1ZS8B 2IV8A 1OOWA 3BN3B 4E41B 4CA4A 5JUEH 2IBGA 3QQXA 1TTUA 3B2UC 7CGTA 4G9FB 2AJVL 4RQQA 4JFHE 3VXRD 5F9DC 1PZAA 1NMAL 1PLBA 2W60B 2NYYC 2JCCB 4FQXA 1KIQB 3FB7B 3T5WA 5F71A 2PTUA 2MCPL 4DKEH 1NLBH 3QUYC 2MOQA 3KLHD 3SQOH 4GUPA 1RZFH 1CLYH 2V7HA 5CSZB 2KERA 1E4XI 1JVLA 1C1EH 2X3BA 1E27A 4EN3D 3TM6A 3H7BB 3VQMA 2GTWB 3K2IA 3K72B 3NIFB 1DSFL 3QXAA 2ZX5A 4OZIE 2VAJA 2E6QA 3GLAA 4YBLC 4NIKB 3FQXA 1KYAA 1T0NA 2CPCA 1FVDA 3SBRA 5HDOA 5ESVB 4HIEB 4MLSA 4WHYG 4WUKH 2XZCL 2Y7NA 4AY0A 2FCBA 3QZBA 5DK2B 3SDAD 3V6ZB 3OKLB 4P3WA 3CD4A 3QULA 2PTTB 1PG7L 1XF3A 1O7DC 3MLSL 4GG6A 3CDZA 2X4NB 2DM3A 5IEKB 1WO2A 3IF1A 3S2CA 3WEAA 3AU1A 5ICYB 4XMTA 4ELKA 2O5ZH 3MC0A 3ARDB 2BY0A 4NNPL 3EH5B 1CD0A 3VXRA 2OR9H 3OB8A 2WLZA 4MJID 1L9RA 4QCIA 1TMCB 4YDKL 3BLBA 4X6DF 1C08A 1PD6A 1JNHB 2R1YA 4P3DB 4F3FB 1OW0C 2EDLA 5FC9A 1PZCA 4AQAB 5I1AB 5ISZB 1CFMA 3BPOB 4M61B 4BFNA 1Q0YH 2J8UE 4HDIB 1UTDA 3IDJB 2HLEB 4ZPTA 1MFBL 2V9QA 4ZX4A 2RCSL 3G9VA 5J06A 1URLA 1CXEA 3KPMB 3EOTH 5ECJE 4N2IA 3MO1A 5IROA 2VDNH 1KXQE 3SGDH 1JL8A 4J3OC 4GUQA 4Y5XA 2BINA 2IQAA 3Q1SH 3JTBA 1UG9A 1QLRB 3GSVB 3INUL 2BSED 4NX0A 5T3XL 3K6OA 2LGNA 3CMGA 1IAOA 1ZRUA 3MRIA 1AQDB 1XSIA 3U83A 1H9DA 1BXVA 1OPGL 4PR5A 4WFHE 3ZKXB 5BXFA 1WITA 2TSBA 5EEWA 1KENH 5C1MB 4Q58C 4AMKL 4B9CA 4BEIA 4WV1B 2WWOA 4K8RH 3ARTA 4WNQA 1A2YA 1ZKAA 5IBLC 1DTUA 1CTNA 1BM7A 1BJ1H 3KCPB 4P59H 4OJYA 3VXOB 1OAZL 2EDTA 2FX7H 4FJZA 1SJMA 3TVMD 1E2VA 1ZV5A 3WENA 4TMPA 3ATBA 3UZEA 3RUGA 2XZQL 3TJHD 4J8RB 3MRFA 3D69A 2XWXA 3O6FD 1L9MA 4WU5A 3OZ9L 4IEFB 5BOJA 2AK4D 3PAVA 1NCDH 4GQ9H 4NQSB 5FUZH 3EYQC 3FUMA 3L3JB 3UH8A 5HPMA 1QBAA 5EBMB 1J86A 3K2KA 4J2QA 1FV1B 3KE0A 3WFHB 2VSCA 1LO3H 2BY2A 2P80D 2BVYA 1UD8A 4X5WA 3B34A 3CZSA 4RDBA 5I73B 2YQ2A 2FLRT 3VYOA 3VSQA 2J3SA 5I71C 1G84A 1S7XB 2DD8L 1UHVA 2X2JA 4P3CH 1BXAA 1G6RL 4F93B 1TU2B 2AEPL 1X9UA 2UZXA 4M1CC 1MELA 1TENA 2HTLC 4QTIL 1I1CA 5GRJH 3X14A 4AYSA 3VACA 3WY3A 2DQGH 3U9UB 3ZDYE 5I1LB 3ARWA 5IQOA 4PTTA 1DANU 3W2DH 2X10A 3LZFH 1I3UA 2YA2A 4Z78B 4LSTH 3CBJB 1RPUA 2IXQA 3PABB 3QWOA 3TP4A 2VC2B 2NY6D 4XN4A 5DD0L 3QHFL 3WMPA 1W16A 1DQJA 5IVXE 5A2FA 2DYPB 2EKJA 4NKOB 2J21A 2OXHB 5AW5B 4G43B 2NW3A 4DVRL 2A74B 3H0TA 1ZANH 4X42A 1D5RA 5DUBB 1QATA 3RDTD 1B90A 1FQ9C 2F1EA 3DRQB 4U1JB 4S1SH 4OKVB 1TR7A 2XV6B 2MQGA 4NI3A 4CMHB 1Y18B 1AGFB 1M2OA 4XC1L 2DB8A 2XVBA 3DVNA 3OLDA 3WIFB 3O3AB 5EA0H 4HZLB 2Y5TB 1NBVH 1F00I 4MA3A 1BZDA 1DANT 3BWSA 1OGAB 4MKMA 3S3CB 3UMNA 4YHYB 4FEMA 1S9VB 1JE6A 1PCXA 3L7EB 1NLDL 4LCUB 3HS0B 4N22A 1BVNP 4PJDF 3VI3B 3DX8B 1K6QH 5FYKU 2NXYC 2DDQH 4Y4FA 5HGDA 1SFDA 2E7LA 5CGBA 1TJMA 2ORBH 1RZGB 1PDKA 4QHNA 4N26A 3QI9C 4PJGB 2Z93B 3SGKC 4XXCA 4NDMA 5JUEL 4KK5C 2VDKH 4AYFB 2EIJB 4EUPH 4HH8A 4OGZA 3V6FB 2WQSA 3B5GA 4B96A 3IFOA 4TQEL 5IJVA 1T1XA 2JB5H 1BF2A 3KPSA 4MNQE 3VTMA 1MFEH 1NUGA 3AB0B 2O6CA 3A4AA 4GFXA 3IMBA 5B39A 2PCFA 5HI4D 4ISVA 4NN7C 5EOTA 2DWSA 4FLQA 4GAYB 4P5KA 3KCPA 2XWEA 3RWHA 3NABH 1IT9L 4LO9A 2OSLA 2DLEA 2WXRA 4LASL 3IRCA 1JPTL 2M2DA 1T5XB 3QXWA 2IBZY 3ASWA 1ZHNB 1NCCL 3KWVA 3NFPA 4K15A 1XB8A 1FNHA 3CUPB 1YMMB 5CGYD 3O0RL 3RKDD 4ZMAT 2R83A 2JTDA 3P9LB 1U8NA 4AQEA 4BH7B 4IRZH 5T33L 1CI5A 4H1LG 1IKOP 4KBPA 4N6QA 4LPWA 5IKCB 5IM7A 3JT0A 5IESH 4BRVA 4MQ7A 4WO0A 4NO5B 2VOTA 1OAUH 2EO9A 1KCBA 1QBLH 3CLEH 3CN4A 3UBXG 4CN1A 4U1NB 4B27A 5KSBB 1MQ8A 4UAOB 3PNWA 1J5IA 1JZDC 5LCVA 4AMXA 3VDBA 2PWGA 2H32H 1EBAA 1NFIB 3DARA 5F7UA 1E9PA 4R84A 2NSMA 3TA3B 2TSAA 3VA2C 1QLFA 4I2XE 1WEJH 3ARGB 4E9RA 5KEZA 1RHHA 3RZCD 1IBGL 1EO8L 3UJIL 3S96B 2H7WA 3APMA 3HZ3A 1UWYA 3ETBJ 3ZMRA 5T5FH 4LEBA 4P07A 3TGXA 3MOAL 5HD8C 3QXVA 2Q3XA 4WDIA 1X9LA 4H1LA 2DDQL 3CHPA 5HGGS 5DFVC 4JX0A 1BW8A 3QDGB 5MI0C 1UCBH 3LY6A 4E68A 1WC7B 4MS8C 2FQGA 3VCLB 4NO3B 3FTZA 2ZOTA 3C12A 3K7UA 1CFTA 3DX6B 5DHVB 5IG7B 3O8XC 1CF1A 3TNNB 1NAMA 2ZJSH 3PXJA 4M4RA 2NXZC 4PUBL 1XDTT 1O7VA 5FM5O 3D0VB 2X2IA 3TBTA 3LQMA 5FEBA 2PXYC 1NGWB 4YZWA 5MEOB 1BGXL 2H5UA 3FJTA 1PCSA 4NBZB 4OJAA 2GAZB 4URTB 4XWOC 3VW3H 2NY0C 1ZANL 4QR7A 4MQXC 5EFIB 4UT6L 4KVNH 5ESAB 5AWNL 4BZ1H 1JK8A 5JORA 3H9YA 3HC2A 3MO1B 4WJ5B 1XR8B 4C4KT 4H4NA 1E5UI 3HZVA 3FT4B 4N3TA 2GK0A 1FLRL 4M6NL 1WFMA 4I4WA 1A6AA 5DQDH 3HRZC 4NKDB 4V11A 3RX8A 3VFTB 3PXLA 5A3ID 1DBAL 3HPJA 4PS7A 3EF7A 1O6TA 1T80A 5E7BA 4TVPH 1I85A 4PREA 5I8KL 1BLNA 1P4IL 3OX8A 3CC5B 4G6FB 1LP9B 1Y0LB 1A8JH 4NPYA 2F7RA 3I02A 1K9TA 2IH3A 3LQZB 4IU2B 2DQUL 4P2OD 5T1DL 3TFKC 3E38A 3TCTA 4GKSA 4GYBA 4BZYA 1UXWA 1ACYH 5EZOH 4LGPB 5KSAA 3KJ4C 2ITCA 5PCYA 3KWWB 1RZQA 2YSSB 3HHSB 3QWQB 3LEYL 4MMYA 2AQ3A 3TBVA 3IDMB 3ROLB 4GSQA 4LLYA 3V8CA 3LKQB 1VFAA 3ESMA 2HJFB 2WSKA 3D52A 4Y4FD 2CG9X 3FQNA 1FDLH 2WWNA 1VAHA 1NUFA 2H1PL 4N20A 2O30A 1HHIB 2DM7A 2WIIB 1CVRA 2AXJA 2ERJC 2Y5EA 2OCCB 3BT2H 3RL2A 3V0VB 1I8MB 4N0CD 4WWKD 3UO8B 4PRDA 1Q1PA 1U8NB 2H26B 3GJEB 2AGJH 4PMFA 1INQA 4F7MB 4Q7DA 4ZODA 3ZTEA 4K3GA 4AQ8A 3RTQC 3DO4A 4PRIE 1SN0A 5DJ2B 1NC4D 3GMLB 5FFLA 3ZDYB 4EJ1C 3WOVA 2H6PA 2XTJB 1FL6A 2BZDA 4JN2B 3BAEH 1F5WA 4FG6C 4Q9CA 1EAPA 2LLNA 3MOQA 5GS0H 4JR9H 2ZXEB 5GRWA 4IIQB 2FQFA 4FNPA 4JM2C 4AX3A 1MCRA 4E9XA 3SE6A 3N9GL 2F54B 4PJEB 3QSKB 3QCTH 5I0DA 2XZQH 4R0LB 1ADQH 5E94A 4OZFA 3P4OB 4NQXA 4PJ7B 5E9AA 4MJIE 4JFQB 1PZDA 1G9MC 5D8JL 5ESQA 1QLEL 3MRQB 3PNRB 3A6BL 4G7QB 2A74A 1YNTF 1MIEH 2CUHA 2XG4B 3K8LA 5K9QI 1EHXA 1BD2E 2EVHA 5I6XB 3HAEH 3MLPA 5T1LD 4KI1A 2EH8L 4S0TD 2GUOB 4XVJH 5DO8A 1F6FB 3NJHA 1YNLH 2R7EA 3FBKA 3T09A 4DO6A 5I66B 3ZXAC 1YCSA 5IOPA 1A7OH 4XMVA 4HWEL 3NJNA 3F05A 3SOBH 4EUPA 1CDUA 5JYMA 3RFRA 1A4CA 1KZYA 2BHFA 4E5XB 1HCFX 1TO5A 2ZXCA 5GGVH 4YSSA 4UZSA 4W9LC 4NQQA 1ZJBA 2ZJSL 2FUTA 2EXWD 5JOFA 1XGPA 2YRLA 1DBKH 3RU8L 4Z5RB 1PY4A 4K7PH 1ZLVK 2F8XC 5C3IA 3SJVB 1YNKL 1ZVYA 4HUXB 4XMPL 3UYPA 1UGNA 3GUTA 1U8QB 2FO4B 2OMUB 2EDQA 3TVMA 2D73A 3B5TA 5D1ZI 3HB3B 3BGAA 4AZUA 1R3JA 5EF3A 4MNQB 5CHNB 5IW6A 4HJ0C 2KH2B 5CJOL 4HOXA 2I85A 5J1AA 3P02A 4O4YL 3AW5A 1JAEA 1OGTB 2ZXWB 1DEEB 4Y8DC 3IMTA 1AQHA 3S3BB 3TBWA 4APQC 1B4JH 4NIYE 3GXMA 1O0VA 1RJZA 5JO5A 4P46C 3PAZA 4POZD 2FLBT 2VMFA 3PWPE 3T0XA 2YD0A 4DKDC 2YPLD 4OGAC 1JGDA 2WVVB 4KQ4L 1W91A 4F92B 4M93B 2RFXB 4PJAE 3V95A 4L1DA 5DEJA 2AITA 3SO5A 3D34A 2ADIA 4U0QB 1DJIA 3DYOA 2ADJA 1RLBA 3IDMA 2L7QA 3K3QA 2WP3O 2PXYB 4FF9A 4TVPD 5J3HC 2AI0L 1HZLA 3X1NA 5MP6L 1CPUA 4V1DD 3FHQA 1DQMH 2HN7A 2NYZA 3O6ML 3WXVL 1NDGA 3CMOL 3VFUA 4PRPE 1SLWA 2CO4A 2FEDC 4KTGA 1DUZB 1E4XH 1AGBB 5I1HH 4G9FD 1I1FA 2WXNA 2F6AA 3ZDZB 4ENZA 3MLVH 1JWUA 3QRGL 4MTMA 4U1NA 1JGLL 4XI5D 3RWJB 4RGOH 1IAMA 2EC9U 5KVGE 2P42B 1TKWA 4JL1A 3P3RA 3BWAA 1GGCH 5SX5H 1GZQB 5EIIB 3UPRA 4TNWK 1QFOA 2OQJA 3LKPB 4MJIA 5SWZD 1VZHA 1F90H 2A73B 3TO4D 3TOPA 1BVLA 1NMCC 5H94A 4TXVB 3WBDA 1MZZA 2W59A 2XJLA 4YBLB 3MNMA 1BPVA 5K9OB 3NCYS 5JNYB 2WC7A 4QXUL 3GS4A 4JANA 4AUJA 3WCYA 4R0LA 3O0RH 5E94B 1QEWB 4OZHF 2A9ML 3MUGB 4PJ5A 5FKPB 5D7LD 1U30A 5T1LB 5ABZA 4FFVD 3ES6A 1YEGH 1NIDA 2FH8A 2JKXA 5LAXA 2CRIA 4GEJA 1ICTA 5BJTB 1YYCA 4ENED 2CH8A 3I75B 3ORJA 2LTQB 3U9PH 5FCSH 5IIEB 1XCQA 2WKOF 2ZPKL 3II1A 5KUKA 3R4DA 1DCEA 3BVDB 2B5IC 1X7TA 2PW2B 4CADA 3MN8A 2K4WA 2BFGA 2VXQA 5I82A 2EH7L 3DUSB 3OWRA 1KNOB 4EOWL 2CHXA 3X1EA 4NP9A 4IHOA 5GSRA 5J12C 5J6GB 2KBGA 1A4AA 3CLWA 5LN4A 3O9WA 4NRYA 5KVGL 5KYWB 2AAVA 5C0BE 5TGBB 4E41D 2GK0B 3VRIA 5DHEA 3VXPB 4XNQB 2AK1L 3OGCB 3VVVA 1LK2A 4J23A 3LZRA 5C0EA 3TVMB 3L1EA 3ABKB 2WLJA 3K8KA 4TQ8A 2YAPA 1ZXKA 3B7UX 1A65A 1I4FA 1Z3GH 2VR4A 1WT5A 2XFXB 5DD0H 1RKRA 1BDYA 5FECB 1CG9B 1XAKA 4PJBE 5E2WL 3ZZSA 3NEEA 4JFZL 3P9LA 4AQEB 3LJ3A 3KLHC 2H3KA 4QRQB 2BSTA 4W9KC 2GSGB 4OCXH 2FX8H 1C5DA 4UQAA 4HIIA 3KYNB 5IHUH 5HY9A 4BFGA 3SJVE 3EFOB 1TJIL 4ZX5A 3VG9C 4PJ9A 3LV3A 4LRIC 4ZZFA 1MG2C 2Z6FA 5BV7B 2NXYB 3EO1B 3H53A 4OJEH 1P9MC 5I15H 1H5BB 3GQFA 3H9SA 4YDLC 4QTHB 3CXHK 4PW4A 3F12B 2DQJH 4NPKA 3RHWK 2C9SA 2AXFB 4M5SA 2C3VB 1QEXA 1DQLH 5CEZL 1TTAA 1O6SB 5DC0A 3CH8A 3QFDA 3VUAA 1LWHA 5BVJB 2OYMA 2ZX7A 4KAQL 4QWWC 2R0LH 3DETC 5L6YL 3DX1A 1FFNB 3WEXB 1JDAA 5KOMC 2V8LA 4QTIH 5JW4Q 1X5JA 4XAKD 3MGTA 2X88A 3A6BH 3GSOA 1GSKA 4JZJA 4YBQC 5DRZB 3D50A 1U8KA 4AIEA 1X9RA 5GGSB 4N90E 1T5KA 1UJTA 2DS4A 3JV5A 4L9LB 4HH9A 5H35A 4LXFA 1F4AA 3C60C 5J13B 2JJSC 1NGPH 3NCYP 5EIVA 1RUQL 1RJLA 3QHFH 4YXHH 4AH2A 2GUYA 3QS2A 1TETL 1BXUA 1MCQA 4HSQA 5DJ0B 2F15A 1J48A 4XPAL 1QYGH 5SX4H 1ZK5A 4M7JL 3IE4A 3R4RA 4Q56A 5GGSY 1CB4A 3BZFA 5AB0A 1DE4B 3W39B 3EZJB 1LP9E 1OQXA 4W9HC 1V3MA 4QTFA 2MNUA 5F8RC 1T6WA 2HG5B 4YX2L 1BD2D 5ICXB 1HNYA 4Z76A 3HZVB 3LDBC 4WFFD 35C8L 1D5MB 4TNVF 2IAMA 2E76C 1CD1A 5HHNB 3ECWA 4Z7AA 4ZUSB 5I6PA 4JHBA 5EU6E 4JFSA 3IM1A 4JCMA 2EVJA 2BC4B 2DLFL 3S35H 4Y4HB 4EF3A 2VSKB 4NO0D 1S9WB 4GRLB 4OCRH 1ANUA 1FFOA 3L3GA 4XWGL 2Y1YA 3ZT5A 5CBEA 2C9UA 2HJKA 3IE9A 1WA0X 2WP3T 4K0OA 5CU9A 1JN6A 1WBYA 5AVZB 4RAHA 1EHLL 2HG0A 3ZMNA 2CGYA 1UXSA 1JYWA 3GMOA 4NSKB 1YRKA 4Y19D 1WAAA 2FT6A 3D12B 1C8PA 1F11A 4YL9A 1MWOA 2ARJB 2V0AA 1EDQA 2C1PA 2KT6A 2FGZA 1JOIA 3G04A 2RR3A 2JVUA 4DFHA 4S2SB 4DO5A 3SOTA 2E4TA 2LU4A 2W9DL 4XZUA 3GUFA 3TZVC 3ARBA 2NQCA 2BOCA 3F7YB 3FCUB 2YD3A 4OJFL 4PCTA 4A67A 4ZXBA 5ID1A 5BS0D 1G9NL 1KLFA 1YMMD 1RZKC 2Y3AA 2XKSA 3WO4B 4YWGL 5D72L 3VTAA 2ADYA 4QI3A 1T0MB 3MREB 4KVPA 1A22B 2FJHB 4WGVB 4I2XA 5KUMA 3ZJAA 1S4IA 2W0FA 4JFUA 3PWVB 3H42L 1VJSA 2ZX6A 4S1RH 3N1MC 3ML8A 3RWIB 2X1WL 1ASPA 2XPYA 2CXKA 3NFSL 3APNA 3Q6GL 2WUBL 4LHUG 1BVZA 1RUPL 3LQZA 1CICC 3WXWL 4RGNB 1BIIA 4LLUB 2QKIC 5K93A 5IOKA 4ZD3H 3JTTB 4E9YA 4HGKC 4YSQA 3MJ9L 2E47A 4HV8B 4U05A 5DGQA 2QPDB 4DSYA 5LGJA 2GTZB 3HR5B 3F64A 1H3PL 4DK3A 4TVSa 5A6LA 1N64L 3IJYB 3QQ9D 3MRBB 4NQUA 4FQ1H 5T3ZE 3KS0H 4A37A 3GI8L 5JXEA 3NACH 4FQHB 3CIQA 3F85A 3A6CH 4LCIL 3ZL4H 5J0BA 1BM3H 2HRLA 1PX3A 3PP4L 3SGEH 5DFAA 1A02N 2VM4A 1F3DH 5C7XH 4FG2A 2IF7A 4PCKA 1E4WH 4ADGA 4FJ6A 5FGBA 1E5CA 4LEXH 2OL3L 2BO0A 4TL4A 3P3UA 5CFHA 3LH8A 1T5WA 1CXIA 1AIZA 2CO7B 1BF5A 1RZFL 3OV6A 4FNLL 3MJ7A 2VXUL 1XIWA 4G43A 4D9RE 1A1MB 2G60H 1GC1H 1E2WA 1NANH 1DJSA 4ZUVB 2OP4H 1ZLUH 3HMXH 4F57L 1I3GH 5DYOA 4Z3FA 4LU5H 4NJAH 3MRPB 3N40F 4RAVB 3MA9H 2D9CA 5G5DA 3WDJA 1O5DT 1ODAA 3DGGB 4TUOA 4ZW7A 5A2IH 4IU3A 4N0FB 4M7ZC 2CR6A 3GHBH 3FN9A 3WMSA 4WTXA 2J71A 4WU7B 4PBXA 1XX9C 4HIHB 4PJGE 1QQDA 1CBJA 3UJTL 1CGYA 2BP3A 3HHRB 2X12A 2OMWB 5ACZB 3CZJA 4JPQA 5LGHH 3WUZA 1OCOB 5JA9A 3X14B 2IGTA 2XN0A 4YQXH 2EIZB 3GZOA 4PB9L 3S34H 4TULH 1H3PH 4QRRA 1R46A 5AW3B 1QR1A 4S1RL 1N6VA 3MJ8B 2J1XA 4JDTH 5E8DL 3VXTA 2AQTA 4HMCA 3ZL1A 3P77A 3QEQA 3G5ZB 5E8DH 3P0YL 4OI9A 5HDBE 1S3KL 1SBSH 4MAZA 1QI3A 4JO1L 3PWUB 5IY5B 3EGXB 3QS3A 1CLOL 1DVZA 5IVXA 2OX5B 2JCWA 3VG0H 5MENB 1UXLA 1AGEB 3IJSB 1S5HA 2YXWA 4BSJA 5IT2H 5C08A 3WGVB 1KTLB 2R29L 2VM3A 2XWTA 3A6CL 4LCIH 4C56A 1XH2A 2NY5L 1I75A 3WUWB 4GBXC 3GBNH 3HVDA 5FYLE 1TITA 4AIXA 4B9GA 2XA8L 1OGAA 3BPLC 2B3IA 1WA1X 4UNTA 2I5YH 4HJGB 2FT8A 3RWHB 3T0BA 3RTQD 1ID5I 2PPAA 2ZUWA 1XCTB 1A7BA 1TTGA 2KDYA 3BP5A 3ULVE 1TJGL 3RWIA 3QJFA 4HOWA 1X44A 2ITDB 2V5SA 1R4XA 2CHDA 1Q8MA 4YXKL 4L0PB 1U3HB 4NXSA 4AIZA 4G6KH 3X1GA 5EV7A 2OMTA 1FZKB 4N9OB 2J6EL 1WFJA 3I9AA 5B22A 4L1BA 5CIPB 1OPOA 1KTKE 3LNFA 3WEOA 3BKYH 5JDJA 1B6UA 3IJYA 1IARB 1P4BL 3NAAL 4K23H 3FO1A 1LP9F 3HTLX 3BPNB 1QD0A 5I30L 2FQDA 1P0SE 2O5YH 3L1FA 2FWOB 4GAGL 1SY6H 3DSFL 1UURA 3PJLA 5TPWL 4BBWA 1SJXA 1EHAA 5K39A 2E9JA 3F84A 5H35B 3Q8EA 4ZFOB 4AENB 2PNDA 5KAQF 5JHDB 1I7TA 3QEQE 3SDCA 4FXGA 5J6HB 3AC0A 2HMIC 3L81A 1WIUA 3O41B 5FA3A 4L3EE 2PWHA 4M00A 1IO4C 1XGRA 4Z95H 3KM1A 4WI4A 2NNAA 3OKNB 4U3XA 4F8QA 1RZPA 3RE0A 3CDZB 2UUDK 3SDYH 2P7TB 3CFMA 5KJRH 2L7UA 3W39A 2LFGA 1IUZA 4DJMA 1IB5A 1YYLL 2PPCA 3F6IA 1HK6A 4LSUH 1EFQA 4Y5YB 3AUVA 4X7TB 3HFFA 5DJ8A 3F7RA 4YDMA 2XBZA 1S9YB 2EEFA 5F1KC 3P0VL 3QPKA 3UGUA 5DT1H 1A6UL 3H8NA 1TZGL 2HFGH 5CGMA 3V4VA 4U6XA 4B50A 4PTTB 3U2IA 3UJJL 4O2EB 2ZWZA 2V7HB 3JTSB 3FZUD 2F08A 3AITA 1QA9A 5FECA 1H3XA 3SDDC 1J10A 2A7BA 2VL5B 4U1KA 1ZVSA 2K70A 2YUVA 2IPTL 3I6SA 3S5ZA 5DK0B 3OXRA 3VI3F 4U2YA 4LKCB 5ID0B 1CC3A 3SY0B 1JMZA 1IC7H 3QFJA 2WZ5A 4W81A 3U36B 3K6IA 1O9VA 2KC0A 3EO9H 5F8QC 3UC0L 3KVPA 1MKFA 3L1OL 4IK6A 4HUVB 1A0QH 2WPGA 4DZBB 3ARFC 2V2WA 2FJUB 2YD6A 3RURA 3S4SB 3IK2A 4GG8A 3N2JA 2CQVA 4N8VA 3DXAA 1CDYA 1SXNA 2FL5A 3CCHA 4ORZC 4NRYB 3QCUH 5JHLH 3QWRA 2X0VA 4XP4L 4Y0GA 3TFKD 4JFEA 1HHGB 1JI1A 2PW1A 5E5MA 4OCRL 4F20A 5J12B 4HJGA 2P52A 4I13B 4JHAL 4FHBD 5AOZA 4EMZA 5BRZA 2QGEA 5DD1H 3QJQB 4Y5VB 4GW5A 3L2LA 4N6RB 1ZXQA 1OZUA 5F3BA 2VISB 4NKDA 4H8PA 3VFTA 5ITFA 3FO9B 3WIHH 5L88H 2HFGL 4XCCL 3RWCA 3ABMB 3ME0A 4JHWL 4KGLA 4F9PA 4QLRA 4X4XA 4I1NB 2OL3B 4FTDA 3MI6A 4PJ5E 3FONB 5LLIC 1L6PA 3F5WA 4QNPE 3KYOA 3KL0A 3B56A 4LSUL 2X4TB 4M3JA 4GKSB 5GGTH 4J3OG 4TSCL 4BFFA 3UBGA 2XZCH 3HE6C 5F1IB 3FH7A 3KDMA 4WK0B 5E7FA 4LPXA 6TAAA 3RVTD 4X5WB 1FL6B 2B59B 4JN2A 2XG5A 4XCYB 1GMIA 4F91B 4JN1H 3DVIA 3IKKA 5KN5B 2KZWA 3MGOB 1R24A 1DSFH 5AB2A 2UXVA 1JXDA 3R0MA 4FZ8H 4HCFA 1INEL 4J4PC 1EXUB 1DDHB 3IDXH 5L4IA 4N68A 4RIRB 5E2WH 2P44B 5IB3B 1ZGLA 4L3CB 5ITBH 5B1BB 3WKML 5KS9F 2GHWB 2WSDA 1I7UA 3MRHA 1W0YT 2Z31B 2W0KA 4GRLA 4TSBL 3QIUB 1Z5LA 4WO4C 5DYOB 5CBEB 2QFPA 3IDNB 2EDKA 1IBDA 1KBBA 2K9FB 1BA9A 2AHIA 1XH3A 1JYXA 4D7PA 3CC1A 1DZ0A 3L3OA 5HSFA 4Z7WB 3J07A 2R9HC 1IQDB 1U8JB 3SCMD 5I18H 1KIPA 4N2NA 1IQWH 5HGBA 1RJYA 3HS9A 1YNTA 3BZFB 4Y16C 3ATFA 5JHLA 3F7PC 4KUZH 4APXB 2F8OA 5L2KE 3FAWA 4KX8A 4ZZKA 4KXZH 3W11C 3BVNA 5HVHB 4FQCH 5K1VA 4AGPA 1DVYA 1E9OA 2IPKA 4AW7A 5DJDA 1FVCB 5K59E 3TYFA 3ECUA 3F7VA 3B37A 1JPSH 2B14A 5DJZA 5DRXA 4IKJA 1KIUB 4UZUA 4TQPA 3FSZA 2BLFA 3K72A 4UINH 2WLLB 1BV8A 2WO2B 4BWTA 1H3TA 2C1OB 2ZF9A 2WO3B 2XWBB 3GHEH 4JPVH 4HJTA 5D6CA 4A6YA 5IW6B 4PRAA 4HIXH 3C2AH 3A47A 5TDPA 4BK4A 5JIIA 3TBYA 4OLWL 2UZYB 2VDRB 4XCEA 2OBGA 5AW8B 2JELH 2IV9A 3HC4L 4DN3H 4HUVA 5BUPA 4HUUA 1WBYB 1V05A 3FUNA 5GISL 3KPPA 5ICYA 3PQYB 5IB2B 4FI7A 2RFXA 2BNRD 3C9NB 2WJ5A 4HC1H 4JHUA 3NPSC 4KWUA 1L7IL 5J1SC 4YUEH 5IJDC 1MUJB 3MLTA 1P4BH 3NAAH 43C9A 3BVVA 3POCA 1AHWB 2CDEA 1X4XA 2BWDA 5BRZB 1FPTL 3KLKA 4JG5A 5D96C 1ILSA 1T03L 3GXNA 4LT7A 3F58L 1NMAH 4O2FA 3S7GA 3KLDA 4LARL 1O6VA 1MHPH 1UQSA 4BFOA 1RUAL 2B7DT 3CC5A 3H85A 4ZFOL 3FQWA 1XL6A 1GTFA 3GKWL 5J1AB 1F0LA 1OAKH 2EXYC 3BO8A 3CMOH 4P4RA 1OGTA 2G4GA 5F7EL 3UL4A 3VU2A 5FGCB 2YIHA 5CKGA 1GGIL 2ORBL 3ZE2B 2XQYG 3II2A 1H3GA 2ZSWA 3RGVD 2ADGB 4E9QA 3CFUA 3NSYA 2E74C 4L4VB 2APSA 4RQQB 2DF3A 5CWSB 3KW8A 4AQ1A 3IDGB 1RP8A 3A6OA 2HVJA 2Q5BA 1WHPA 1U8OA 1I7TB 1JTTA 2X44D 3IYLW 1KLUB 1QOKA 3OPZH 2P5WB 1IAIL 2FATH 1A9EB 4WWID 3FU5A 4XMPH 5HHPB 4JANB 3AG3B 3BPOC 4CNIB 1CI3M 2EIZA 1EJFA 3C60B 2F19H 3QJUB 1CBVL 2XYCA 4LCYA 4M6OL 3IKCB 3J2PA 5IWLA 1ZY9A 4AL8L 1EV2E 4Z3GA 1GZHA 2NDFA 4LLQB 5T3XE 3DO7B 1C5BL 3NCEB 1JXJA 4KKBD 1DN0A 2BNQB 5AD0B 1T5WB 1QTSA 2UZPA 4JO3L 4FQ2L 1K2DA 1ZHBA 1A6ZB 1J0IA 2JIXD 3AACA 3MJ9H 5C07E 1I1YA 3REWB 5CMAB 2EYSA 4P5SA 5E2UH 3AGWA 2EEAA 5IFAH 4M62H 4W4OA 2HFFA 2CKNA 4KTEL 3LKNB 2V3FA 4RMSA 1MDTA 3BP4A 4QRFA 4L29A 1IC5H 1H0DA 3E6HA 4B53A 4WW2B 1RIUL 1TZIA 3VRIB 1MRCH 1YECL 1L0QA 1LO0L 2B1OA 1I7RA 5C0CE 3Q1SL 3VJ6B 4O5LL 2ZX9A 4FKHA 3W82A 5FO7B 1ZT4B 3MYJB 4KK6D 1G9HA 2EDXA 1IFHL 3OG6B 1MJUL 1JGVH 1FBIH 4MWFA 4JFTA 3T71A 4Z77A 4PRAB 4XBGA 5JPNB 2G3MA 1CLVA 4F7EA 4FYQA 3MUZ1 4BSWA 2ICEA 4IGBD 3V5KB 3PU7A 4JFOB 2DQIH 3MXWL 2P45B 4JHWH 3RB7A 5JTWA 3JWDL 1MNUH 2E6PA 1CGSL 2X3CA 3KYNA 1M7IB 1UOVA 4I3SL 2Q7YA 3LQAL 3TF4A 1OCCB 4PWHA 15C8H 2X5PA 5AYQA 1YEJH 4F8PA 4OZHA 4UTBA 1BSIA 3ZTJG 3Q2NA 4U3SB 4P59L 1XCXA 3UTOA 3EOAA 1KACB 5DURB 3SZKC 2DAVA 1XSOA 2C4XA 2H1PH 2XHNA 3CIAA 4LCWD 4HOMA 2YSSA 4XB8A 5FPIA 1GH7A 4IOSA 4YZFF 5FKAA 3GUTB 1YAZA 2OW7A 1EERB 2VISA 2E56A 1H8SA 2VRAA 2DYPD 1LK2B 3BFWA 3D8MA 2VDOH 4K8RL 4U3HA 4M48H 1PYWA 2BRRL 2IIJA 1ID2A 1J8SA 4LAJH 5IQ9B 4LSPH 1XL4A 1GXEA 3R7QA 1XGTA 3GTVA 1MAJA 2DLTA 2MNWA 1Q9KA 3RBGA 2XWRA 1KBGH 5F6IC 4LL1A 5C0BB 3UAAA 4XGZA 5AVUB 1TO4A 3EIFA 2B59A 3C6LC 4TYUA 2D3VA 2RTTA 4K5MA 3VWJD 2BHZA 5JDSA 3RL1A 1ETZB 1GGYA 1JZ4A 1N2RB 1I8IA 1KFAH 3CLFL 5DD3H 4NOFA 3CVDA 2ITEA 1X4YA 4UQIM 2ICCA 1LO3L 3M7OA 1VPOL 4XVTL 5FYLL 4MMZA 3VXUB 2QQQA 3T3PB 2VXSL 4M1GH 3QGVA 4H8WC 3ULVC 4Y9BA 4ZDHA 3SE3A 2WJ7A 2EADA 3S37X 3CFNA 3KWWA 2AJUH 2ZCKL 2F5BL 2O1AA 4PJEA 1TEGA 2ZG1A 4ZW5A 2YAOA 3QULB 5B1KA 5C07A 2BP8B 4PGEA 4ZW8A 1BGXH 1LM8V 2X4NA 4CSTA 5IEKA 1P53A 5IHWA 2HPOA 3SO3B 3HS0C 3ZX1A 5JHDA 2EILB 5JW5A 5DZAA 1KTCA 2OJEA 3BN9D 2IPUK 1GIGH 3T0WA 4I9WD 1AR1D 3BYYA 3TBCA 2BH0A 2VLKE 2Z3FA 1H15A 2LR4A 5LGKA 1J1XL 1H3UA 1USZA 3V52L 3TBBA 4XP1H 5I0XA 2WVTA 1F1DA 1UM6H 1F4YL 4JM2B 1SY6A 2X2YA 3EDEA 1SOXA 2NYYD 5AEAA 4ZJ9A 5SWQA 1PKQA 5KSBA 1EEYB 3G6JB 2HVKB 3DSFH 4PVMA 3V0GA 4UTAL 5HJDA 4HS6A 4R7VA 1QSVA 2CNYA 3S3JA 3WELA 4R4FL 2VERA 1FC2D 1GGBL 3GMQA 4PN6A 4IIQA 4YXLH 5L9DH 4NN7B 4BE6A 3FB5A 3SGDI 1CICD 5HYIA 3AQDA 2KZKA 4XCEB 4KTEH 3S6CA 5CEZE 1S6NA 5DZPA 3IFPB 4HOZA 2GB2A 3QP3A 4LRNL 1E5YA 2AVFA 2NR6A 3RY6C 4G5AA 4GQPH 4LOUC 5B39G 4ZFGH 3VE0B 4FG4A 3VD4A 2D0FA 1WDAA 2ZQKA 4TPRH 1WZ1L 3VYNA 3QZOA 2MTAA 4TV3A 1JV2A 1JV5B 1E6OL 2L3BA 1MCBA 1SQ2N 3EHBB 4M6OH 4PJ6A 4X7SL 1JPTH 2LHAA 3EJRA 2NZ9C 1R24B 4Q8BA 1KEML 5HHME 4KNUA 3CFCH 5D7SL 1KGIA 4MDIB 5C0IB 5IQ7H 2EVGA 1HXKA 3C87A 1N26A 4LLMB 3QYCA 4HZAA 2XFXA 1H3VA 1C5CL 1BOGA 3FMGH 4N8CL 4YSRA 5ID1B 3C6SA 5JOFB 5GRYA 3UP6A 1HL5A 5GIRB 2GCYA 3VWJA 3GNML 5F3HA 2F53E 4U31A 1RFDH 1TLKA 3HCVB 3I6KA 5BZDB 2X0WA 2RGSA 3K0YA 2RD0A 2APVA 3OZKA 3QBTB 3EADA 4ODVL 5A2LH 3CDFA 3QIWD 5C0BA 4CILA 1AYOA 1M57B 1WBZA 3UP1A 3BRFA 4JY4B 5JDSB 3UDWA 1TKWB 3MFGB 3MACL 2QMKA 3HPLB 4FZEH 4R4BB 4KJQD 2IH9A 2X6MA 5GS1C 2DQEL 1IAKA 4RGMB 5FUOH 4YSTA 3PE9A 4KRMB 1BAGA 5DS2A 1KZQA 4RRPG 5CR8A 4MZ3A 3E8VA 1BBDL 2ED6A 3K74B 3N0AA 5HYSB 5IMLA 4GI6A 4YHKL 5DEFA 1G9NH 1DL7H 4KO7A 2H2SD 4I77H 4OT1L 1KCVH 3DROB 1DVFA 4NZTH 1U2YA 2LT9A 3LD8C 2F74A 2PYEA 1JHTB 4L8SB 4Z7UB 5TD4A 5DMJB 2Q76B 1TSRA 4I3RH 4YVNA 5FF6B 4X6DA 5DVLA 5IMOA 3FT3A 3ARFD 1VFBA 2VN7A 5FX3A 1JFHA 1U3YA 1A7OL 2DI7A 5B21A 5HI5C 3L9EA 3TEYA 2OV0A 1BD2A 3QDME 1TG8A 1HWHB 5FB8A 4N28A 2AJ3B 3DIFB 4KY2A 1A1MA 1U91B 1HCVA 2JKTM 4I1RA 2YKLL 3ETBF 1TZIB 4FNQA 2BS8A 4UQ3A 2GI0A 1W8EA 4ODXA 5FO7A 1M1XB 1G7MA 1ZEAH 2A4CA 2ZKHL 2A9MH 3ZKMD 2QFRA 2DLFH 4MWFB 4GW1B 1UH2A 5HHOE 3GM0A 1H19A 4Y2OA 1I8LA 3FQRA 1ZA3B 4EPSA 5T3ZD 2YKKA 5AL0A 1CQKA 4MNGE 3NP3A 4O4YH 4AYFA 1OAXL 4ZSOB 2ETWA 2XA3A 1HH9A 3QAQA 1QR1B 2D31A 2APWA 3ES6B 4G6AD 2G0KA 1OAXH 4PG9B 3OB0H 3PWJB 4I8DA 1G43A 3IU3A 3EOAB 3O6KH 3TASA 2ED7A 1F6AB 2OSYA 5AOJA 3D25B 5I2IB 4PJXB 2BP5M 3I02B 3OKOB 1XF4A 1XQ4A 5DZVA 3BH9B 3VFPA 3ABGA 3NJFA 3AUWB 3GXUB 5G4MA 3V4VL 5CN3A 4UT9A 5DJXB 2WANA 3C9NA 4L48A 2P5WA 5HHPA 3I9IA 3EJYD 2W91A 3X3FL 1U8HA 4G9DB 1NFKA 4PY7A 3X3GH 1R5WA 3AXHA 3SDAC 1SXAA 5SV4A 4E0RB 3UYPB 3D5OF 4B9KC 1CF8L 5D5MB 1P5VB 1ZD6A 2B77A 3UTPD 1L4IA 3FUKA 3CFDB 4G7VH 2VDLH 3QUMA 3EOBB 2W88A 2YUZA 1VEPA 4ONFL 3FQWB 3AREB 3B2UD 1E3ZA 4L1SA 3M8OH 4ODUB 1LDSA 2ROXA 4B60A 3BJLA 3D39B 2V17H 2B9AA 2YUWA 4A7QA 1MRDH 2NY1B 1DQIA 2FB4H 2V6HA 1ZIAA 2G2RB 1KELL 3DRTB 1FZMB 2NZIA 1JG9A 4MHHI 2AERT 3BAIA 4MCZA 3H54A 2X4QB 5AL8A 2A1WL 1ET7A 3EHBC 5KVMC 4QHLB 1NOLA 4L9DA 4RISL 4HBCH 5B8CC 2J4WH 4XP5L 2AQSA 2H8PB 4IRJD 3HBGA 1PSKL 3FBQA 5GRUH 4OBSA 5E1AA 3ARSA 4PJCF 5FK9B 1D9KC 2XWJB 4XO9A 2LABA 3SQOL 5E1QA 4R4ND 2PTTA 3NCMA 4X8JB 5EOQL 3RVWD 5FIEA 1XXDC 3TT1H 4ETQB 1KG0A 4MXQD 4ZI8A 4IOSD 3NA4A 4WGWB 3LEYH 4PJ5D 1GGUA 5BOPA 4LKCA 1ZTXH 4PRPB 4AEHH 2AJ3A 2FD6L 1C16A 2XN9D 3EH1A 3UPCA 3BEVA 4QRPB 4HG4J 1FJ1A 1KPUB 3LEVL 5F9JA 1ZHBB 1P6WA 3N6YA 2X9YA 3RFZB 4OLEA 5HYJB 2BVEA 5E1HB 4DGIH 4DOHE 1EJOH 3H7LA 4HIHA 3PWNA 5ILTH 1NFDE 1T83A 4OJDH 4JQXC 5LBGA 1WISA 4JPIB 1LD9A 2J1YA 3ZKQD 4HDIA 5CS7A 1NBYB 2XRAH 4BUHA 2DKUA 5AVQB 4MNHB 5TE4H 1J0YA 1GCFA 3RA7L 1A6TB 4JB9H 2M8XA 2QZQA 3C09C 4FRWA 4JRYA 4RRPA 4AQ1C 2ICWJ 5DWUL 4DQAA 5EWIH 1HHKA 5I8CB 2BSRA 2BIPA 3ABZA 2MQ3A 3HG4A 1YC7A 1X3DA 3CHXA 4JUTA 4NAMA 1OARH 3D9AL 2JFCA 4PBVC 2VRQA 1MHEA 1Q0YL 5HYSG 3OXRB 1QWHA 3QJZA 3LRHA 2WK2A 4QOKE 4R8WL 1KCRH 3D25A 5I2IA 1F58L 3HMWH 5DR5L 4P04A 2NQDA 5TFSL 4QJ5B 1AO7E 4TNEA 2NW2A 4EI6A 4Q9RH 1UZGA 2YD2A 1EA9C 5JZ7C 4GKZA 1RIHH 2W95A 2HT3D 3HCVA 3I6KB 5BZDA 1P4UA 3ZN6A 3GJFA 2NY0D 3CX2A 3WTTA 2OMVA 1CFBA 2IJ0C 2NY4D 4O2CB 2OSWA 2IALA 4KKBC 3MNZB 2VDQL 3LIUA 1B3IA 1XH0A 4KXCA 4R3SA 5I23A 4TTGA 1KGCE 3ULVF 2Q8AH 3VM5A 1EWHA 3SKMB 5KOVC 5KS9E 1FL3A 2R4RL 3QIBA 3DBSA 5LAPA 3WFZA 5KSVA 4JL2A 3IGLA 2AK4E 3FONA 5BRZD 2ESVA 1CYGA 3CTTA 3GBEA 3CFKB 1AFVH 3U7YL 1HSAA 4XOAA 1SGKA 4YHIB 2R4SL 3UAEA 3QZWB 4JFED 4ONHB 4KU1A 4I85A 2WVSA 5F0JB 2DWDA 1WV7T 3JVGC 2FIKB 2E7BA 3TONA 4G3YH 3P9MA 2FYYA 4AUYA 3VG0L 3NJIA 4FCAA 3SBPA 3UAJA 1NC4B 2GTQA 3U79A 4AKQA 4KK9C 3FB5B 1LK3L 3IJ8A 2EACA 1GMEA 3LPOA 4UMGA 2DMGA 4HEPG 1J1OL 5K59F 3ZY7A 1A5FL 3ULUH 2BXZA 4TRPL 3RX7A 3BSZL 1ORSB 4A2DA 4LMQI 5DTFA 2C9QA 3UAFA 2VAAA 2QQKL 5B1JC 4MA7H 4WSKA 4PLNC 3ULUL 2BNRA 1HESA 3HMXA 3TBYB 2R0KH 3UBXA 1YEDA 5GZOD 4HX1B 4DPBX 5DHYA 3GZPA 4P23D 4A39A 4M02A 2ZYHA 3UADA 4LCCA 3VNZA 1CFQB 1BMZA 3K5RA 5ACMA 1ND0B 1HL4A 4RGND 5I1EH 2VIRA 4L3EA 5GRVK 3WN5C 5I1IH 3VXMD 1K5NA 3FTGA 4IHOB 5GSRB 1S5HB 1OM9A 1NTDA 2L04A 4HETA 5DZNA 5FW6A 3OWEA 1CIUA 1J12A 4IQHA 2WIMA 3TO2A 5AYUL 5IMMB 5JQHC 3QYNA 4KKAC 4RETB 5I6LA 3ZDZF 1JRHL 3O6FB 2VLJE 3S36L 4YLCA 1SM3L 4GG6F 4G6MH 1A7PH 1NAMH 1AIFB 4WTZA 4L4VE 2FLMA 1KB5B 3QDHA 4KUCD 3EF4A 2IOIA 3BP5B 1PKQE 1FNGB 4YR6A 2WQXA 5IEHB 1PZ5B 2Z7YA 4EEEA 4WHCA 4QF1A 1T22A 1QP1A 3BIKB 1DCLA 2ZIDA 3KPSB 3CSYA 3CWGA 5CZKA 2H45A 2C9VA 3LH2H 1RCYA 4QRAA 4PGDB 4EDWH 1XV8A 3OJDA 3KMDA 3BPCA 5KSAD 4RNRA 3KEHA 1R6VA 1KB5H 4XX5A 2GTWA 3LRMA 4JDVA 4NKQB 2ATPA 4FQIH 4DESA 3FQTA 4FFWD 9CGTA 3F00A 4GRLD 3FRPG 3UCRA 1KDJA 4MJJA 1L7TL 5LCVH 3I6LD 3MRNB 2WXHA 4MQTB 4JMXA 1LO4H 4K7PX 5C6WH 1BOGB 1PQZB 5D1QB 4FMFA 4NM4H 4GB9A 4KK8C 3ECBA 1DJZA 1AO7B 2GCYB 4X6DB 3VWJB 1WD9A 1VFBB 3HBQA 4A2LA 5EUKA 1QNZH 4DT2A 4IRZA 4IRJA 2ZXBA 3KYOB 5EUOA 2VWEC 3C75A 4BQ6A 1HXYA 1RI8A 1FFNA 3WEXA 3STBA 5D7IA 3GS7A 3GO1H 4I2XB 3FB7A 3Q9PA 5I5IA 1NJ9A 3HNTH 2X4QA 4G8FB 1XSKA 1TZGH 1K2DB 3W1ZA 2A0LC 1BFTA 4JB9L 1UT2A 4X0KB 3MUGA 1Z1WA 5DD5H 3AS1A 2FIKA 1A8ZA 3GZKA 5BO0D 5CKAA 3RIFK 3N91A 4X4MA 1GL4B 3RWDB 2LQRA 1EZVY 5A2KH 3ELQA 3GT6A 2VC2L 3NIGB 5LGJB 1T0NB 3PDDA 1KLUA 3NIFF 2JCCF 3PV6B 2FX8L 4FQLH 3L9YA 3HJ0A 1I7RB 2VERN 3VQ2C 2D4FA 1ZT4A 4Z95L 4G5ZH 2OMXA 4Z77B 2EIEA 1JHTA 3C5ZB 4Z7UA 5F9JB 1EFXD 3A0OA 4MD5A 4JVWA 5IMOB 2YGOA 4UBDC 2K7QA 3BQUC 4G83A 2AQ1A 1G7PA 3UTZA 3ARVA 5ID0A 2A1WH 3HLKA 1DBBL 4Y4HA 3DXAD 4UQCA 4ZMTA 2GT9B 3IMRA 1NCTA 2M26A 4Y2DD 1S9WA 1X4ZA 2VZSA 1ZDSA 5KW9H 1A6ZA 3BT0A 3IB4A 2R51A 5T3ZH 4CC4C 1S7QA 5DI8A 1URZA 3U2SA 1UZ6F 1YO4A 5EEYA 4JRYB 4P99A 3GTNA 4Y16D 2V7NA 4HD5A 4NUGH 1NGZB 5DJDB 8FABA 3N04A 1Z0NA 5IMMA 5JW3L 2R2BA 4NUPA 1UD6A 4LPUA 2DN7A 5DQ9A 4KROD 3WGUB 4P05A 4RZCA 4MJ6A 4UTAA 4M43L 5LQBL 1TJGH 1MN4A 2ODHA 3K8MA 4IMKC 3ZHLA 3P9WB 3MX0B 4R26H 3NZHH 3BUYB 4GUCA 3B9VA 5D2NB 3WJJA 1I9JL 4KROB 4HWBL 3TA3C 4ODUA 3MREA 1YY8B 3BIKA 3MRJA 4EAEA 3KPPB 2DBJA 5LBSA 1QBLL 5K1JA 5DFTA 2VNCA 4KQ0A 2CHNA 2LV4A 4HEPA 2XN9E 1NKRA 1GPOL 4QT5B 1M7IA 1J0ZA 2W65A 1BZOA 4Z6AT 2ATKA 3P77B 2YA1A 5C0JA 1UFGA 5EU6D 1OTTC 4X99B 2XIIA 2QHRH 4EI0A 4JDVB 4OZIF 5F9AC 1FYHB 3BFOA 3NIDB 3AMLA 1ZVNA 4GRWE 3ILQD 3OJMB 5DJXA 2CUIA 3UTTD 1QSEE 3QI9D 4FQ2H 1KT2A 3HZMA 1HI6B 3FO0H 4N2EA 5I1LA 3Q8AA 3CZNA 2Z0UA 3BUBA 1UWGL 4XXDB 3CDCA 4JGMA 2IXQB 5C2BH 1ADQA 1FIEA 3FO0L 2WXLA 5DEGA 1KXHA 4U3CA 4ES9A 5IQ9A 4ZO6A 4HHAB 3HNVH 4G1EB 4LPTA 4MB4A 3VH8B 5BPPA 5FDYA 1KCVL 1PIGA 2VDLB 3KPRA 5L4JA 5IR1A 1J1OH 3QHZL 1BF8A 1G6RA 1Q9LA 3MBXH 3PDGA 1L0PA 4LSRL 4BFKA 3LZPA 3Q01A 5F9WC 1JIBA 2XN1A 1QX1A 1ZPUA 2VDNL 2FHBA 2UX7A 2BMKB 5EZLB 2FWLB 2VXQH 3RNQB 4ACPA 4FXTA 4K7PY 3WI9A 3MUJA 4KO5A 3JYBA 2MHAA 4MNGA 1Y0LA 4OFKA 4D8OA 3MA9L 1HINL 4ZQKB 4HHGA 5DC4B 2NUTB 4IMKA 1SDDA 3EBIA 1J0HA 1CUOA 2R8SH 2HLAA 4AG4H 1ZLWH 3MYZA 4M6MH 2MCG1 1YC8A 4IRZL 1V7NL 2HLFD 3SDDD 3QIWA 3MGOA 3IETA 1G7QA 4HF5H 3HC0B 1NBVL 2CIKB 2CHWA 2GJJA 5HGDB 1NBZA 3LS5L 2HJKB 3UBXB 4JM4H 2WLLA 2HA1A 2J72A 4NM8L 25C8H 5I1DA 4H8VA 1SJEB 4KRNA 4S1SL 2DPKA 1RUML 3C08L 4MAUH 3MJGX 2AP2A 4ZYKB 3S3SA 2AZUA 3BP7B 4XOCA 4YUEL 5EA0L 1JGUL 2JCCA 4QHMA 1RAMA 3FPYA 4LAQL 4LEOA 4KZEH 2PUQT 5JMOC 5C0ND 1CXHA 3QC5X 1UEMA 3F6LA 3QCUL 4W9EC 5JHLL 1JV2B 4X8GA 1FO0B 2C3WA 1EAQA 3APCA 1X6NA 1NSNL 1EX0A 1KBVA 4OV5B 3COOA 4F1ZA 1UA3A 4LVNB 5IW1B 2BNUB 4PV1C 1FC1A 4P2AA 1F41A 4AUUA 4RX4A 4WRLA 3U7WH 1MHHB 1T3FB 4OY9A 3KPNA 3B2VL 2OJZH 1WE5A 4R2GB 1Q9WA 1MWAA 2D9QB 32C2A 3C5XA 1AXIB 1BREA 1M6OB 1NFDB 4P2OB 3VXNB 2QKIA 1MY7A 4JFOA 1CICA 3SIKA 4FFYA 3IFPA 3P30H 1UM5H 2DJSA 5K9JL 4NZRL 1RPQA 2K6YA 3SPGA 2CA4A 2WLYA 5I17B 5DS8A 5KANG 5BZWB 5A16B 5E8OB 1G9MH 4M5YL 4WY7H 4ODBD 3MKGA 4PGJA 4R5XA 1FGNH 2ATKB 2JKWA 1RZJL 1X7SA 3TA4D 4Q0XH 4QCIB 2OYKA 4C4BA 5F2FA 4DFIA 5FAAA 4KKRA 3SDXF 3BCDA 3PGFH 3CX5K 2WYZA 5CNHA 3VXSA 3U4BL 5D96B 3GGWB 3ECBB 2BCKA 4DNLA 1E8XA 2WNXA 2XBDA 4NHCL 2EIBA 2WBWB 3EFDL 3P54A 3VYPA 1JNJA 2XSKA 3MVSA 3MUY1 1UGKA 3LIZH 1CFNB 5LXGH 1AH1A 4TSBH 3S0PA 1KY6A 3MRCA 4A7TA 5KYNA 4PJAA 5CP3A 1GZPB 1J7VR 1WAAE 5SWZE 2R1XB 3WKYA 5IG7A 2OKMA 1YPZE 3IBEA 1O9ZA 3R06A 4G5ZL 4Y5VA 3S98A 1PLGH 2XV3A 5FHBL 4LP8A 1SUHA 1NANI 1Y6MR 1W0WB 2ZXAA 4BSVB 1JTOA 4X0KA 4JM2F 4LLWA 2H32A 3T2QA 4N2BA 3K4AA 3QIBB 2XBTA 2OULB 3WFDL 5TF1H 2ADFH 2R56H 2J25A 3GBLA 4MZ2A 4MMZB 3MFFA 3CXDL 2ID5A 3CFKA 3I2CH 1F3DJ 4FADA 5EZPA 1YY9C 5BQDA 4F58L 2E27L 1A4BA 5IVZA 4XPAH 3OR6B 4CBZA 5L8KB 1N4XL 2CLVA 4XO8A 5AZUA 2JJVA 3DC0A 2BVTA 5DLLA 5T3XH 3PWPA 1ACCA 3DYPA 4N0YH 6FABL 2B1AH 2CIKA 2XN2A 3BLKA 4DCQB 4TKWA 2C3HA 4JO4H 5H37G 5BS0A 4QO1A 1AD0A 3MRKA 2GHZA 5C3LD 4RMWA 3DJZA 4OFPA 2HAZA 4XNYH 3FH8A 4DPCX 4LOFA 4F7KA 5JW4M 2F54E 3VQ1C 2O72A 5E56A 3BDXA 3ZDWA 3QA3B 3VXSE 2V7NB 4X6DE 3PGFL 3LN4A 1GYCA 3PAYA 4JY6B 3TBSA 4G8GE 4IM8A 4MJHA 1EAOA 3VNYA 1E9QB 1TZ8A 2BP0B 4HIJA 5CMAA 3KXFB 3MRLB 1SXCA 3QCVH 4UAOC 4FAAB 1S7VB 1EAJA 1ORQB 2V2TB 4F5CE 1F4HA 1HHHB 5KS9A 4IGBA 3QUZB 1I4FB 5D2LA 2VDML 1J5DA 3U9UA 2ZUXA 3UAJC 4KNQA 2B2XH 2ODIA 5JNYA 3JVGA 2RCSH 3MR9A 5E2TL 4OI8A 2Z9TA 1OZTG 4LRIA 3MYJA 3TLRA 5EZOL 3L13A 4MMXC 5TK2A 3INOA 3TURA 5ISZE 2AQPA 4FMKA 3QUMB 4FE9A 3EGDB 5AVTB 5DJYA 4DEWA 2JJTC 5C0JB 1UD3A 1KIRB 1H5BA 3H9SB 5DS1A 5AZ2H 1RSYA 3MRGB 4HUCA 3NSJA 4XMLL 4QRSB 3IGAA 5CU5A 3H9HA 1AQKH 4AL8C 3N85H 1ZEAL 5D1ZA 3KH4A 4I3SH 4OUUB 4I3GA 2RALA 4OCYH 4P8QA 3TV3L 3QFDB 4L4TD 2Y7MA 3BGMA 1OO2A 1U3HD 2Y7LA 1R3HB 4ZMNA 1Q1JL 3RVXD 3FTWA 3PUUA 4N0UE 3E6FB 1T89A 3MUUA 3ZDXF 2ZD0A 5GS2D 2O5ZL 2DWTA 5T33H 1TDQA 5FYKD 4EIBA 4OIIL 2Z93A 3RRQA 1Z7JA 1HYSD 2VUYA 1F3JA 1J8HB 2WCPA 3ATEA 3N1PC 3TJHC 4Y5YA 4NEHB 2OTUA 1SBSL 3PJSB 4HK3J 4J4PD 4XPFL 4PJ8A 1HIMH 3LKOA 3LNGA 2HT4C 5A7BA 1UZ8B 2W94A 4JZNB 3VD9A 2GITA 3HG1B 2DJ4A 5F7YC 4EIGB 5DI8B 2VO8A 3CVIH 5BS0E 3AXLB 2HP4A 2IH8A 1UB5B 4FQJH 2ADGA 4KJYA 4AOFA 3QEHA 1CGXA 1MPAL 3SJVA 1KN2H 4L4VA 2FO4A 4C57C 3QQDA 3VO0A 5D70L 4BKLA 5INDB 3K81A 2XIDA 3T4YA 2GEEA 4OD1L 4J5VA 4N5ED 4WJG3 5IB5B 3UJTH 4UV7L 2YN5A 1MAMH 4F27A 5KBKA 1BEYH 5MHSE 2C9AA 3FF8A 4NBXB 3ILEA 3VGAB 2GUOA 3UABA 4QKXB 2CDFA 1B2WL 2AV7A 3WE6A 5AZEL 1IAIH 4HG4K 3ZRCC 3IJHA 4PUBH 2WTOA 3G6JF 4PJCA 1SJVA 4WFGE 1XEUA 2P5EE 4P5RA 5E03A 3TJEL 1C16B 2EDNA 1VADB 2NY4C 3VRJA 1B0RB 3KPLB 1KYFA 4QXVA 4K5OA 1L9TA 2Q3ZA 3NFNB 3L5HA 4BCYA 3I3BA 5ANME 1PNCA 3S4SG 4CU6A 4PCYA 1S7QB 1IBFA 5C9JB 4Q89A 5EU7C 3TS8A 3NTCH 3O2DA 2E86A 4JPKL 1LO5A 4XNMB 1FWXA 4NJ9L 3WJJC 3DIDA 4YHOH 4XNXH 4ZSOA 1JMXA 4YFLF 3SYPA 1KYOK 4HS6B 3SGJA 3DUHA 4L0ZA 4ZFQA 3EYOA 1GGTA 4PJXE 3RILA 2GYSA 1U8LA 5E8OA 1SRDA 1PMYA 5JOPD 4JCLA 4QHNB 1IILE 4IOIA 1AS6A 3V5DA 5DHVA 3MXVL 2WSPA 1RD6A 4H8WL 4R7DB 3GKWH 4C47A 2KYIA 2A9AA 3K6FA 2B2XL 2G9KA 3KNBA 4XB7A 1KYUA 1IE5A 4PLOB 4WTWA 3N44F 4X6EB 5E9DD 5ANHA 2YAHA 4CC4A 3EUDA 3BP6B 1N67A 1GS7A 3HZKB 4PJFA 2MCAA 4KI5E 1N5AA 4LASH 3UEQA 5A6IA 2Y25A 2J5WA 1WBXA 4N4YB 2QZ5A 1IEAB 4F15C 1CLZL 3A5VA 3N06B 3L4UA 4Y4HC 5CP3H 4BZ2L 4FXKB 4HU8A 5IHZB 4CRPA 1I82A 1UZ6E 2DQMA 5AW2B 3ZYIA 3GSNB 1PZUB 4RSVA 2ARWA 4H20H 2IALB 1AZVA 4TOYL 3RGBA 4ZK8A 1T1ZB 1HCYA 4WWOA 4WIQA 2R27A 2YRBA 4LSQL 4N2AA 1NFDF 4XZUB 4UU9A 1OL0A 1NOAA 4A66A 4PTUA 3CVHH 4K9EC 4B9PA 1BVKB 3L1OH 1MRFH 1TJHH 3EO0A 1NCAH 1GYUA 3GIVB 1T7VA 4L1TA 4WGKA 2O93L 1NEZG 4OQTA 3QQ4A 2Z8RA 4FLSA 2ENYA 5JOPE 5KVDH 1P7QD 1G7IA 3KZ8A 1SXBA 1AC0A 1VZIA 4L37B 3CN0A 4U6TA 5C6TL 4NKIH 4P3DA 2N56A 5IMKA 2NY6C 4K94L 4M8QB 3OAZK 4NC1C 1A1OA 1BQHA 2V3DA 1CO1A 1TZHB 1FYTD 4YHZH 3T2NL 3WU1A 2WXOA 3HKFA 3QT2A 4ZDHB 2F7PA 3DI3B 3KPQA 4K7FA 4XPGL 5FYJD 4IRSB 4LBEA 3U6RA 1CICB 2VGLM 1D6EB 4KX7A 2BIHA 3RPIB 4OZ4A 5HGHA 5FB8B 1NL0L 4L8DB 4FQHA 4OF5A 2HUEA 1N0LB 3FNKA 4AQ8C 4PJ9B 2C9PA 4OJFH 4ZPVB 2GJPA 1NCWL 3QWRD 3E9UA 4ODTH 4CGTA 1BQUA 2HWZL 1BCIA 1H9VA 2EEXA 1ZT1A 2Y22A 4DK6A 4D94A 4LVHB 4KY1L 2ZP9A 3BAKA 4IDLA 2VWEE 1A0QL 4R7NA 2FB4L 1S9KC 4YGVA 1SF5A 2X1PA 5D6DA 2ZSVB 3O3AA 1K5NB 2YUXA