2D8WA

Structure of hyper-vil-trypsin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
220
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New methods to prepare iodinated derivatives by vaporizing iodine labelling (VIL) and hydrogen peroxide VIL (HYPER-VIL)
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 48
structure length 220
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d8wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d8wA02
1AFQC 1SMFE 3M61U 1NRRH 3ODFA 3M35A 5JBCS 1QB6A 2ALVA 2G81E 1A0HB 3K2UA 1OWJA 1PJPA 2UWPA 3MO9A 3V3MA 2J4IA 1OPHB 2KAIA 1FXYA 3V12A 2AEIH 1A46H 3NWUA 4NA9H 1MCVA 5EXNA 3RU4E 2PSYA 5TCCA 3QWCH 1FNIA 3I29A 3MNXA 3SU0A 1VGCC 2STAE 4A1XA 2D1JA 4GHQA 2FTMA 3BTME 2ZQ1A 3FP6E 1AFQB 3LJJA 2G5VA 4SGAE 2A4OA 1FUJA 1OSSA 3E91A 6CHAC 4IMZA 1K1PA 1EOLA 6LPRA 5GCHF 4FUGA 2IJOB 1ZHRA 1BRCE 2AGEX 2BXUH 2OQ5A 5I25A 4OGXA 1FY3A 4NFFA 1V2TT 3SOSA 2QY0B 1PPFE 3QTVH 3BTGE 1GHZA 5JBAS 4X0WU 1KTTB 3IG6B 4DURA 3K6ZA 4ISNA 1GI0A 3T26A 1UK3A 1ZTKA 4X6OA 1MBMA 4OS2A 4HZHA 1C5TA 4YLUA 4CREA 1O36A 1G3BA 4Q80A 3EGKH 4UFGH 3AVZA 1U6QA 1XXFA 2NU4E 1KY9A 3Q3KA 3RC5A 1QA0A 1OWEA 4X1PU 1W7GH 2DUCA 1S5SA 1VJAU 3C27B 2FYRA 2Q1JA 3TPIZ 2HPQH 1EZQA 4MNVA 1V2OT 4A1VA 1KLIH 3ZYEA 2ODQA 5AVDA 2WPMS 3OX7U 2UUJB 1N6YA 2QCYA 1O3MA 2H5CA 1TE0A 5JPMH 5LGOA 1UK2A 4IW4E 1F92A 1Y3XA 2BZAA 1A61H 1TOMH 2FI4E 1TX8A 2ZECA 3Q77A 1GDNA 2TPIZ 2W5EA 2FM2A 2XC5A 2VIVA 2XBVA 2SGFE 3A87A 1P57B 1QJ7B 4ISLA 1UVOA 1O5BB 4D9RA 2ZIQH 1TPAE 3ATLA 3T5FH 2Y5HA 1S85A 3RXOA 1MAYA 2SGDE 1WAYB 1SGIB 3A7ZA 3PB1E 3KHVA 2FOAA 3S69A 4JYVH 3TH3H 1BHXF 1YP9A 4MVNA 2ZPSA 2SGPE 3K65B 4Y0ZE 1ELEE 1FJSA 3QGNB 2BTCE 1OKXA 1V2RT 1AUJA 1SR5C 1VCQA 1VITH 3ELAH 2UWLA 4JZIA 3CENA 3ZV9A 4GAWA 4YT7H 3PLKA 1BIOA 1AB9B 4DJZB 2ZHFH 2BD9A 2H9TH 1BUIA 4THNH 2ZCKP 4K1SA 4A1TA 1ZOMA 1MD7A 2PKSC 4OGYA 2ZU1A 4AYVB 3JZ1B 4RN6A 1A5GH 1AZZA 1YPHE 1NM6A 2KAIB 2ZG0H 3UNSA 2ZCLP 1K1LA 4YOIA 1TNGA 4XFQA 1KYNA 4AB8A 2WINI 1IHTH 2YNAA 2PGBB 1QR3E 2ZPRA 1MTUA 5FBIA 5C20A 1DSUA 1SLUB 2PLXA 3RDZA 1K1JA 1ZJDA 1AU8A 2A5IA 3M7QA 2FEQH 4TWYA 4FUCA 5FX5A 3UOUA 2BD2A 1DANH 2CHAB 3AAUA 3ATMA 4FUEA 2P95A 1A0JA 3ZVDA 1W11U 4H6SB 2OUAA 9LPRA 4ZROA 1FAKH 2P59A 3RXQA 1T8MA 1ZGVA 1GCTB 4MPUA 4Q7YA 3UR6A 5FAHA 1HAIH 1FN6A 4D8NA 1CA8B 4NA8A 1O5CB 3A88A 2Q6FA 1SQAA 2HOBA 2TGTA 1TGCA 4WF8A 1SVPA 3M3VA 4UDWH 1HAGE 1YCPH 3DFJA 3P17H 3GY6A 1O2OA 2BD7A 2LNCA 1VITF 1HJAB 1ELAA 5DP9A 1FPHH 5EU8A 2PW8H 2STBE 1C5YB 3RXMA 4RKOB 1UTNA 3UOPA 3SV9A 1LHCH 1GI7B 1RXPA 1THSH 2Z94A 3RXIA 2TBSA 4J2YB 2XC4A 3F68H 4YT6H 4X1NU 1ESTA 1HAXB 3AW1A 4D76A 3ZZAA 2ZU4A 2F9NA 1NPMA 3SI3H 2FS9A 3HK3B 1O3FA 3A8DA 2GDDA 2R0LA 5J4QA 2B0FA 5T6FA 2W7UA 4FUBA 3MNCA 5EG4A 3NUMA 4AGKA 1SI5H 1SG8B 3A8CA 3GDUA 4CHAB 1VJ9U 1O3HA 4WVPE 3UQOA 5DP7A 3BF6H 3U8RH 5G4BA 1SQOA 3KIDU 3A7YA 3GCHC 3V7TA 2XNIA 3RM0H 3T2NA 3BTHE 3S9CA 5HM9A 1AI8H 1GMHF 3RXHA 1GVLA 3GY2A 3ZZ9A 2IN2A 1ZSLA 3M5OA 1HV7A 1EZUC 2J94A 3P70B 1HJ8A 1OP8A 1P02A 1EUFA 1LPKB 1GI9B 2SGEE 1GBTA 1G36A 1SGFA 1J9CH 1K1NA 1S0QA 1D4PB 1K1IA 5DP8A 2GGVB 1JBUH 1TBRH 1NRSH 1ARBA 2VU8E 1DLKB 2J92A 4TPYA 3SU6A 1A7SA 1TWXB 3FZZA 1BTPA 2PGQB 1Y5AT 1GBAA 1TPOA 1K1OA 1BDAA 3M7TA 5EQSA 1SGNE 2C93B 1MD8A 1TPPA 4HTCH 4CRAA 2OTVA 2FOEA 4BAKB 1EB1H 3ZVEA 2PHBA 2FLBH 4MPWA 2XTTB 1LVBA 3DFLA 3L6PA 1TNIA 2C90B 1TA2A 1P11E 2EI7A 3G01A 1MTNB 3OYPA 1P06A 3BEFB 1C2IA 4FUIA 3SHAH 4LXBH 5DP3A 4M7GA 3FVFB 1T7CA 1HLTH 1NRQH 1O2JA 1CT4E 5L2ZH 1YGCH 3SQHE 2BVSH 3NPSA 1A1RA 1THPB 1EAUA 2R3YA 1KXFA 1AHTH 2HNTC 1GJ4H 3U8TH 1GG6B 1ZJKA 1C5UA 3KL6A 5GDSH 1T4UH 3SU2A 1XKBC 5GIBA 1O5DH 3ATIA 5AHGH 5E8EH 1F0RA 4YESB 1GBLA 1RD3B 2BQ7B 1W13U 3EAJA 3RXVA 4ABBA 3T27A 4JK6A 5EOKA 1P10A 3SUFA 3GICB 5FCRA 1MTSA 2FO9A 5F8TA 1YBWA 2Q6DA 5L2YH 3RMNH 1VGCB 2CMYA 2VVVA 3BTEE 1W14U 4BNRA 1Q2WA 1FMGA 1LKBA 1C1OA 1H1BA 1SQTA 2A1DB 4CRFA 5BRRE 1OYTH 1MZAA 4NCYA 3LGVA 2BYAX 2RG3A 1RJXB 1Z71A 1EPTC 1JXPA 1V2MT 2ZCHP 1Y3YA 2FDAA 3FFGA 1W7XH 2C8ZB 2R2MB 4FUFA 4KTUA 3RXGA 1OS8A 1C2KA 3CS7A 1O35A 1MU6B 1UCYK 2F91A 1SGYE 1GJDB 1K9OE 3UNQA 3A85A 3O8DA 3A86A 2GMTB 2RA3A 3LPRA 1PPGE 2BX3A 4X1RU 2FTLE 3UFAA 4WH6A 1KLJH 1V3XA 3F9HA 1QB1A 1DUAA 2ANWA 2FOCA 1VITG 1OOKB 2C8XB 1RGQA 2G52A 1MQ5A 1GJ9B 5DP4A 4BANB 3BG4C 4CRGA 1MTVA 3BTQE 3HGPA 2BD3A 4WXVA 1CGJE 2Z3DA 4ABDA 1YM0A 1YPJH 1UVPA 1WU1A 1H9LB 1GGDB 2FLRH 3SJOA 1IQIA 1PFXC 3VEQB 3SI4H 3GCTF 3A7XA 2TRMA 1IQGA 2ZHEH 3LU9B 3OU0A 4NA7A 1P12E 5TCAA 2ZU5A 3BTWE 3B23B 1G32B 3MNBA 1ELGA 4ABAA 2P3FH 5HXFA 3L33A 4IMQA 5CMXH 1LVOA 1Y8TA 1O2HA 2OC7A 1KXDA 3SNCA 1GVKB 4ZKOU 2GP9B 1TMUH 4VGCB 1IQMA 1DLEA 3E16B 3IWMA 1XX9A 3MWIU 3SQEE 1DITH 1ELVA 4U32A 3EYDA 1C2EA 1G2MA 3UUZA 2V0BA 1BTWA 3MNSA 1YCPM 1LQDB 1XUFA 1LDTT 2SGAA 4K8YA 5FPYA 2ZFRH 1OX1A 4GVUA 4ZKRU 5I46H 1SLVB 2HVXA 4FU9A 3PTBA 3C1KA 1C1WH 1L1NA 2HWLB 1V2LT 1Z1IA 2D8WA 1O5GH 1TLDA 1KDQB 4O9VA 4AZ2B 1SGDE 4BTUB 1AIXH 3DT0H 4ZMAH 4WMFA 3SUEA 4WXIA 1EZXC 1QJ6B 1C1MA 1Z8JB 4OS4A 3ZV8A 1O3DA 2SNWA 1OP0A 4O3UA 1LO6A 1J17T 6CHAB 2D26C 1AO5A 3BTDE 1EJAA 2BDHA 4INLA 3KQCA 1TALA 2CJIA 2OD3B 4UFEH 2R0KA 1L0ZA 1UTJA 2ANKH 2B8OH 2OLGA 7ESTE 1K21H 2ZA5A 1ZYOA 2VNTA 4D7FA 4ISOA 1QBNA 2P93A 3SV8A 2GCTC 3VGCB 5B6OA 4NFEA 1G3EA 2ZEBA 4GLYA 2F83A 1NFXA 4ISIH 1DPOA 1ELDE 1AVGH 3TK9A 4B2CA 1GJ7B 3LGYA 1MAXA 3EA9A 4HGCA 1HJ9A 1G30B 3RMMH 5C67A 1ZPZA 3MU1A 3D65E 4B1TA 3E8LA 1GCDA 1Q3XA 3U1IB 1UO6A 3MO3A 1O2TA 4K2YA 4D9QA 4AORA 1SB1H 1L1JA 1SFQB 3TK6A 1GMDF 2JKHA 4D7GA 1C1RA 1C9PA 3GDVA 3NZIA 2PUQH 3S7HB 2PFEA 5SGAE 2QAAA 3VPKA 4I33A 1W10U 2Z9GA 1P2MA 1J15A 3JZ2B 2OBQA 2XCNA 1IQLA 3RXBA 3RXFA 1P0SH 2ZDNA 3GCNA 3SUGA 4Y8YA 1BMMH 2A0QB 2ZTXA 1G2LA 1FLEE 2BY8X 2VWNA 1ESBA 2HNTE 2BZ6H 3BG8A 3SGBE 1NESE 3T25A 2XXLA 1SLWB 1D6RA 3RXPA 1LHFH 4JZ1A 4X2YA 1E35B 3TNSA 3RXTA 4X6NA 2YOLA 5DP6A 1ORFA 1Y5UT 1TNJA 2GCHF 1A3EH 3SN8A 3KNXA 1IOEA 4IC6A 3IITA 5H4IB 1PPEE 4MNYA 2FIRH 2ZDVH 3VFEA 1ZZZA 3Q3YA 2A2XH 1TA6A 4XOJA 8LPRA 1GBFA 3ODDA 1V2KT 4DT7B 1CVWH 4OS1A 4Y6DA 4ZHMU 5EQRA 3M37A 1DOJA 1SGFG 1AUTC 3OTJE 2DE9A 3B9FH 2CXVA 4JZDH 1C4V2 1P09A 2XWBI 1WV7H 2ZFQH 2QF0A 1AE5A 3HK6B 1AZ8A 7KMEH 2A4RA 2ZHQH 3RXJA 5JB9S 2FI5E 1V2JT 3RU4D 5TJXA 2BDIA 8GCHF 1WBGB 1ZHPA 3BEUA 1YPKH 2H6MA 3QX5H 4JK5A 1YC0A 1XKAC 2Z7FE 4IN1A 2BD8A 1T8LA 1AMHA 3TU7H 1DWDH 2BD5A 2H9HA 2O8WA 2XBXA 2CV3A 1VR1H 4X8UH 5CHAC 1L4ZA 2H1UA 1A3BH 2BLOA 1AE8H 1XUJA 1TNKA 1HAVA 4X8VH 1TX6A 3O8RA 2A4QA 3SV6A 2O8TA 1E38B 3TITA 3GY4A 2XW9A 1QRXA 3PMJA 3DA9B 2AMPA 1O2MA 1P2IA 1GBBA 4K60A 4AFSA 1UHBA 1W3CA 3LJOA 2Y7XA 2WPKS 1ELFA 1XXDA 1EJNA 3VXFH 5JYIA 1BOQA 2JETC 5CHAB 3M5NA 1PYTC 1PPHE 1YPHC 2TIOA 4K1EA 2FWWA 4F49A 5J4SA 1TAWA 3HKJB 3KQEA 1HAYB 1LPGB 3MU0A 3M7UA 3MFJA 2AERH 1P03A 1BCUH 2D2DA 1EKBB 4DG4A 1T4VH 2P8OB 2GZ8A 4X8SH 4YTAA 2J38A 1EAXA 2F9UA 4CRCA 2FOHA 2ZQ2A 2P94A 1QQUA 1HNEE 2GX4A 1AN1E 4ZAEA 1HGTH 3EE0B 2OQUA 1IQNA 4AOQA 5DP5A 1C2FA 1GL0E 4FUHA 1GG6C 2BLQA 1L1GA 4JZEH 1KSNA 1DFPA 9ESTA 2BVXH 1VCPA 1NU9A 2ZDAH 4OS5A 4AN7A 1P9UA 2FMJA 3RLWH 3RXLA 1QNJA 5CE1A 5FX6A 1EASA 1Y5BT 3BEIB 1GHXH 1UVUH 2Y5GA 2FOFA 3MH4A 4GCHF 2PTCE 4FVBA 6GCHG 5T3HA 4SGBE 3U98H 2ZU2A 1VZQH 1O2KA 1AVWA 1D6WA 1O38A 4Y79A 1O3AA 1HAPH 4DY7B 2UUKB 5C1YA 4WMEA 4DVAU 1MKXH 3D23A 3MU8A 1C1VH 1A5HA 1EP6A 1O2LA 2FOBA 5E2PA 1C5RA 3STJA 2VIOA 3KEEA 3RUOA 1NFUA 4Y76A 1F7ZA 1GJCB 1GCTC 5A8ZA 1AWHB 2GMTC 1CHGA 4XBDA 3U1JB 2CF9H 2BOKA 1BMLA 3NKKA 2QXGA 1GMCF 2WPLS 1BB0B 1ID5H 4I8GA 3LC5A 3TNTA 4CH8B 1P04A 1HAOH 3URDA 3STIA 4WH8A 1C2LA 4MDSA 1PQAA 3E0PB 1FIZA 1P8VC 2ZF0H 2Q6GA 1DDJA 1C1TA 5EPYA 2QGRA 3SHCH 1WUNH 1V2PT 4BAOB 1VCWA 2ANMH 3H7TA 1ETSH 5DKMA 1QA7A 2RA0A 5T6DA 3KCGH 3QN7A 1WTGH 1O33A 1C2GA 1Y3UA 2OCVB 1WSSH 2XRCA 3D49H 1Z6EA 3P8OA 1MCTA 2NU0E 1TFXA 1SBWA 2NWNA 4X2XA 1ANEA 1IQKA 5HMAA 3MO6A 3FAOA 2Y81A 3PYHA 1CSOE 4CHAC 1A2CH 4HFPB 1A5IA 2DE8A 1J14A 3AAVA 1H4WA 2PUXB 3BTTE 1N8OC 3U9AH 1CA0B 3UREA 1TOCB 3ENSB 5AF9H 3UPEA 3ZVFA 3Q76A 1K28D 1Z6JH 1DWCH 2A5KA 2OC1A 1IHSH 4U2WA 1EPTA 4X1SU 2EA3A 3TGJE 5DO4H 5ESBA 4B2BA 1CBWC 3LH3A 3LKWA 3U8OH 1MBQA 1Z1JA 2WPJS 1DWEH 2ZNKH 2ZGBH 2THFB 4ABHA 4FUDA 3TH4H 3A8BA 1EX3A 4O3TA 1C4Y2 3RP2A 1O2RA 2W26A 1LKAA 3K6YA 3RXDA 3BTFE 1GBJA 1YKTA 1XVMA 2G4UA 2GCTB 4BXWA 4TYDA 2TGDA 1UMAH 1OWIA 4FU8A 2TGAA 3SJIA 1FY8E 5DG6A 1C5QA 3FANA 2FYQA 2ASUB 1MH0A 2BDGA 3RC6A 1NO9H 3EA7A 4XBCA 2I6SA 2A4GA 1LVMA 5GCHG 2VIQA 4B76A 5A0BA 1P2KA 5A0CA 1RFNA 3LDXH 1FZZA 2Z6BD 4CBNA 2G51A 4X2VA 1QGFA 2XYAA 3TGKE 1MTNC 1IQJA 2UUYA 3EA8A 3ZVAA 5EQQA 3ZZ3A 1KXEA 1AKSB 3A84A 3FZDA 1ELTA 2AIQA 2QXIA 2CF8H 4BOHA 2VGCC 4AYYB 1NTPA 1Z8GA 1PQ8A 2ZFFH 1P2OA 4B75A 1AWFH 4OS6A 3QO6A 4IGDA 5LPFA 1ZMNA 2G00A 1NN6A 2VWOA 1QL7A 3ZZ8A 1TABE 3T29A 1RS0A 4OS7A 3HGNA 4NIXA 3KGPA 2GTBA 1D9IA 2BB4A 3GY3A 3ZVBA 1T32A 1C5NH 1ABJH 2GCHG 1O5EH 1C5XB 1DSTA 1GJAB 2Y7ZA 2VGCB 5F8XA 4AFZA 2EI8A 1KXBA 1S84A 1P9SA 8ESTE 1OWDA 3P8NA 1JIMA 2WYJA 2FP7B 5FXLA 3R0FA 1S82A 2C8WB 1FONA 1QL8A 3VB5A 1EXFA 1J16A 4YZUA 5FBEA 3RXAA 1CE5A 3QZQA 1W0YH 3MHWU 1GJ8B 3URCA 2JH6D 4UFDH 1O2WA 3TJOA 1GDUA 4JYUH 3SNAA 4E06H 1HCGA 3ZZBA 1ELBA 1O3BA 1PPZA 2EI6A 2ESTE 2V6NA 3TJUA 2JH5D 8KME2 2LPRA 3QLPH 1D3QB 2ZFSA 1BT7A 3O8CA 4I8LA 2BDAA 4INHA 1JRSA 3ZVGA 4E7NA 1O30A 3SGQE 1O39A 2AS9A 2FXRA 1BZXE 4MTBA 1SGQE 3ZZ4A 2XC0A 3EQ0H 2P3UB 5EXMA 5ETXA 1AQ7A 1HXEH 2C4FH 2BMGB 3SU4A 4B71A 1DXPA 5HM2A 1T8OA 4B2AA 4JYTA 1EQ9A 1HAZB 1QCPA 1YPEH 3LGIA 5PTPA 3UNRA 2AYWA 2ZP0H 2VIPA 5EPNA 3ITIA 4I8HA 4I8JA 4K8BA 3KN2A 5DGJA 1IQEA 3I77A 1GI2A 4AG1A 2F9VA 3GY7A 3P6ZB 3T28A 3SJKA 1CT0E 2QC2A 1W8BH 1MQ6A 1SGTA 3A8AA 1TRMA 1B5GH 3E3TA 1ZGIA 3LT3A 1ZRBA 2PKAA 3CP7A 3EDXB 1KLTA 2WUBA 2QA9E 1NT1A 1D3TB 1UVTH 5IDKA 3PWBA 1INCA 1GBHA 1V2UT 1GHBF 1UCYH 5T6GA 2ZI2H 4QT8C 4XSKU 1C2JA 4IBLH 4UD9H 2R9PA 1FY4A 2GT8A 1C5WB 2PKSB 5A2MH 3LOXA 2R2WU 1HBTH 1DVAH 2VWLA 1MKXK 1GVZA 3SO3A 2K1QA 3RXSA 3RC4A 3RXKA 1F0TA 1DICA 3LC3A 3QTOH 5E0GA 1HDTH 1H8DH 1M9UA 1ANCA 2BQ6B 3LGTA 3A7VA 1ZSKA 1ZMJA 1O3GA 1IQHA 3BIVH 1OWHA 1QB9A 3TGIE 3TJNA 1UTMA 4INKA 3M3TA 1TIOA 1G37A 1LMWB 5EODA 4CRDA 1D3DB 2BY6X 4LZ1H 2CHAC 4DOQA 1YPMH 1BTYA 2HPPH 1KTSB 1W0ZU 4I7YH 3F1SB 1HXFH 5EW2H 5AFZH 1MKWK 4CRBA 2BDBA 3RXEA 1SOTA 1QJ1B 1BQYA 2QXJA 1UTLM 2ZTZA 3GCOA 4FXGH 2BHGA 1UCYE 4LOYH 1ETTH 2B5TB 5FPTA 1GHAF 4R8TB 2A31A 3RMLH 2ZDLA 3ATWA 3SU1A 4ZUHA 4I31A 1O3KA 1GHYH 1P2QA 1C5PA 2HLCA 4Q7XA 3PLPA 2H5DA 2BD4A 3LGWA 2ZU3A 1TGTA 1F2SE 3S9AA 1CT2E 4R0IA 4NWLA 1TGBA 1P05A 1ANBA 3RXCA 3AASA 3QGJA 5AFYH 2ZHDA 1HAHH 3LIWA 3MYWA 1MZDA 1E36B 3GCHB 4K69A 3GDSA 1TPSA 3ZYDA 3PMBB 1XM1A 3SUDA 2A45B 5GJ4B 2ZPQA 3ZVCA 1OP2A 1NU7B 1HIAA 1ZMLA 2BVRH 4Y8XA 1YCPK 2NU2E 2VIDA 4H42U 2XCFA 3FP7E 3PO1C 4ZKSU 3MH7A 1SGRE 2FX4A 4CR5A 1O34A 3OY5U 1EAWA 1SSXA 3RXUA 1C1NA 1XVOA 4YLQH 4X2WA 4KELA 2P8OC 4BAHB 1RIWB 2NU1E 4RKJB 5E0HA 1A4WH 1KIGH 3F9EA 3M3SA 4I8KA 4MLFB 1UTOA 1Y3WA 4WMDA 1SGPE 5A0AE 4Z6AH 2PKAB 4Y7BA 1NFWA 1O2VA 3F6UH 1BTZA 2GV6A 2ZDKA 1EP5A 2ZHWH 1Z7KA 3SNDA 1P2NA 1MUEB 2Z9KA 4Y11E 3P8FA 3TJVA 1SHYA 1HYLA 1RRKA 2BQWB 1BBRH 4Q2KA 3W94A 3BG4B 5EXLA 3HKIB 1ZTJA 1HJAC 1TMTH 4K1TA 2PTNA 2ZO3H 2QV1A 1TRYA 1GGDC 2BDYA 4IS5A 1SL3A 1SPJA 1FQ3A 3SZNA 5DJ7A 1YLDA 1O0DH 1LQEA 1MU8B 4A5TS 3D62A 1YF4A 3LGUA 5JBTA 2A7JA 7GCHG 6GCHF 1GI5A 1SHHB 1NROH 4U01A 1O3EA 1P2JA 1GBIA 4WJG2 1EOJA 1FI8A 1BMAA 3A89A 2GD4B 3A80A 1BA8B 1FY5A 5FPSA 3KQBA 2Z3EA 3H5CB 4CH2B 2PWXA 1O3JA 4X6PA 4F4OC 4H6TA 2Y80A 3T62A 4PROA 4ESTE 1MKWH 1AKSA 1WQVH 2A32A 2IPHA 4B74A 1ZTLA 1GHBG 1BITA 1O2NA 1QTFA 2BLWA 3PLBA 1OWKA 3U69H 3UTUH 1AD8H 4GCHG 1DS2E 1C5MD 5A8YA 3MTYA 5FHTA 2ODPA 4Y0YE 1P01A 1O2ZA 2AMDA 2WV4A 3O8BA 1T31A 1ARCA 1ETRH 3HPTB 2OC0A 4A92A 3MI4A 3BIUH 4CBOA 3H7OA 1UVSH 1K2I1 5DPAA 3DD2H 2FESH 2A7HA 1RTLA 3A82A 1O3OA 1WQSA 4NGAH 2GVFA 2XBYA 2NU3E 1F5LA 1O2IA 1XUKA 4XDEA 4GUXA 3SJ9A 2BY9X 3TIUA 3VB3A 5ESTE 1EB2A 4GHTA 1KXCA 3NK8A 1GBEA 1AGJA 1CU1A 1DY9A 3OY6U 2ILNA 1NY22 2Z9LA 3F9GA 1V2QT 4IN2A 4NG9H 1O3NA 4AFUA 1GMHG 2JH0D 2I6QA 4IC5A 1XUGA 4ZXYH 1BJUA 2CN0H 1ZPBA 4Z0KA 1PYTD 3ZZ6A 1NRNH 1C1SA 1TNLA 2AFQB 3TVJB 1HAVB 3TH2H 3NXPA 1AY6H 5A09A 5K7RA 1C2HA 4MPVA 1BTXA 1S83A 3SW2B 2PV9B 2ODYB 3E6PH 1QRZA 3I78A 5HYOA 2ZC9H 1GI1A 4FUJA 5F6MA 1O2QA 1CBWB 4AB9A 2Y5FA 1UJ1A 2XWAA 1OXGA 1NC6A 1BTUA 1TQ0B 2O8UA 4ZHLU 1KXAA 1LHEH 1QIXB 5DK1A 3Q3XA 3GOVB 4B73A 1E0FD 2OC8A 3SORA 2FPZA 3UR9A 1O5FH 2GKVE 4UONA 1B7XB 1C5ZB 5GWZA 1IAUA 1CGIE 1QQ4A 3MOCA 1ZPCA 3A81A 1O5AB 1TRNA 3SGAE 2WPHS 3E90B 3FP8E 1SFIA 2VINA 1JMOH 3MH6A 1P3EA 1O37A 5K0HA 4YO9A 1WYKA 1BJVA 1C1UH 1F5RA 1O32A 3QZRA 4AG2A 5C5NA 3UWIA 3TLOA 1V2NT 1LPZB 3SV7A 1SOZA 1L4DA 2A7CA 1GBDA 1J8AA 4ZH8A 8GCHG 4ZHAA 3UY9A 1CHOF 1S81A 1OYQA 2A2QH 4K5ZA 4NSYA 2Z3CA 1C1QA 5ABWA 4ABIA 3OSYA 1YPGH 4LZ4B 2G5NA 2J34A 2Z9JA 2BXTH 4FU7A 4ABGA 1EAIA 4MNWA 1RTFB 2CGAA 1FPCH 1UTKA 2SNVA 1F0UA 4XE4A 1S6FA 4A7IB 1H9IE 3RLYH 2ZGHA 4NIWA 3CS0A 3PROA 2BDCA 4UE7H 1GJBB 1WTHD 1TMBH 1C5OH 4ABJA 5EGMA 1RTKA 2ZFTA 2ANYA 1DY8A 2VWMA 4MG3A 1UTQA 1DWBH 2OINA 2O9QA 3A83A 1QRWA 4NWKA 1S0RA 1O2XA 3P92A 1T8NA 3M5MA 2BLVA 1TNHA 3PWCA 1LTOA 4J1YA 1FN8A 4BAMB 5GXPA 2BY7X 1O2PA 1YLCA 1DXWA 3GISB 4X6MA 2ZWLH 3P95A 3E1XB 2QN5T 3A7TA 2F9OA 1ABIH 2QIQA 4ZXXH 4DIIH 4XBBA 1CHOG 1CQQA 1Y3VA 7GCHF 1FY1A 4JCNA 2AIPA 1QURH 4CR9A 1O2SA 3GCTG 3M5LA 2BOHB 2M5TA 3LH1A 5LH8A 1QY6A 4E7RG 2EC9H 3S0NA 2C8YB 2SFAA 4ASHA 5HGGA 4GSOA 1JWTA 2GZ9A 5EW1H 1BRBE 2WV5A 1K1MA 3BN9A 1XMNB 1C2MA 1C4U2 1GI3A 3VB4A 2GZ7A 4FVDA 1SGEE 1S6HA 2HALA 3L3TA 5LPEA 3VGCC 2AMQA 2R3UA 1FDPA 1N1LA 4K3JA 3SV2H 3R3GB 1BHXB 1BTHH 1NRPH 2O8MA 1O3PB 3ESTA 1A0LA 2ZFPH 1EJMA 1TQ7B 4LK4A 3GYLB 1W12U 4NZQA 2GDEH 4HI3A 1ACBE 1B0FA 4RSPA 1LVYA 2O8LA 2VJ1A 3BV9B 6ESTA 1PPBH 1GDQA 2B9LA 1Z8RA 2ZKSA 1ANDA 1F0SA 2B7DH 2GT7A 1RIWC 3GY8A 1TB6H 2PSXA 4WWYA 4TPIZ 1O31A 2HRVA 2BX4A 1DX5M 2FOGA 3B8JA 1GMCG 2G55A 3ZZ5A 3MU5A 5GPIB 1UK4A 3WY8A 2Y82A 2HGTH 4TY7A 4ISHH 1GBMA 1GHVH 1N6XA 1JIRA 1TGSZ 3MH5A 3PMAB 2WPIS 2J9NA 4KGAA 4DCDA 1P3CA 1TBQH 4YM9A 1ZLRA 1TX7A 2ZGCA 3KQDA 3BSQA 2QF3A 1AB9C 1IQFA 2QXHA 3MU4A 2UUFB 3NCLA 2VB0A 5L30H 2XBWA 2YNBA 4KTCA 2VVCA 3RXRA 1GJ6A 1GI6A 5C3NA 1O3CA 1HFDA 3P8GA 4TY6A 1GMDG 4WY3A 3RMOH 1YYY1 4BTIB 1ELCA 1GHWH 1BRAA 1QL9A 4U30A 2FS8A 4ABEA 1JOUB 1X7AC 4Y7AA 4E05H 1V6DA 4ZKNU 4H4FA 1GI4A 1O3IA 1V2WT 4MNXA 1ZR0A 1QHRB 2FOMB 4UFFH 3PO1B 4YOJA 1TBZH 4DIHH 2IOTA 1C9TA 1QBVH 1CO7E 1AVXA 1FV9A 1FIWA 3F9FA 1BBRK 5IYTA 1WOFA 2AGIX 1EPTB 2RDLA 4Y71A 1Y59T 2OXSA 3PM3A 4X8TH 2C3SA 1C5LH 3BTKE 4JMYA 1XUIA 2AH4X 1F5KU 2W3IA 5C1XA 3UQVA 1DM4B 2VVUA 1O2GH 1G3CA 1UTPA 4NSVA 4BTTB 1O2YA 3VB6A 4AGJA 4NZLA 2V35A 3W95A 1DE7H 4DGJA 3ZZDA 3MMGA 5C2ZA 4KKDA 2FX6A 1ZHMA 1MTWA 1NS3A 1PQ7A 2UWOA 3PMHB 5E2OA 2VIWA 1YPLH 1C1PA 1HUTH 5LPRA 2Y6TA 1EZSC 2GV7A 1GWAA 1W2KH 4ABFA 2G8TA 3UIRA 3VB7A 4DW2U 1SC8U 1V2VT 2PR3A 1K22H 1EATA 1G3DA 1GBKA 2VH0A 1ZRKA 1GJ5H 1LHGH 1QFKH 2F9PA 2BM2A 3ATKA 1TGNA 3QK1A 1BBRE 3S7KB 3AW0A 3SJ8A 7LPRA 4Y10E 1TYNA 1XUHA 2ULLA 3SBKA 5L6NH 2Z9IA 3SU3A 3V0XA 3TK5A 4BXSA 3V13A 3KF2A 1DUEA 5JB8S 1C5SA 1E34B 3DUXH 1NZQH 1GPZA 5E0JA 1HIAB 2H9EH 1PPCE 2W7SA 1GI8B 4A6LA 2ZDMA 1GBCA 3N7OA 2FODA 1SLXB 2JETB 3Q00A 4BAQB 1BMNH 2FI3E 1PQ5A 5BPEA 3QUMP 1NFYA 3PTNA 2AGGX 2SGQE 2V3OH 2W3KA 2OP9A 3HATH 1FAXA 5JDUB 1BRUP 2J2UA 2F3CE 1Z8IB 1LCYA 2VH6A 1QBOA 2WYGA 2G4TA 1LHDH 2BY5X 1TONA 3PV4A 2WUCA 3ZZCA 3LONA 1V2ST 2A5AA 4Q7ZA 4MQAA 3DHKH 1D3PB 1ZSJA 1G9IE 1B0EA 1UHBB 3UWJH 4AFQA 1H8IH 1CA0C 1E37B 2RCEA 4X1QU 2HNTF 2P3TB 3A7WA 1O2UA 4MPXA 1SGCA 3VXEH 4O97A 4TWWA 1C2DA 5A8XA 4KP0A 2ZGXH 2TGPZ 3GY5A 5F03A 1ESAA 2OBOA 3E0NB 4KTSA 4AX9H 2ZTYA 2J95A 4O03A 1L2EA 2ZGJA 4Y8ZA 4GPGA 1KDQA 2P16A 3RM2H 2QYIA 1H9HE 1CGHA 4NIVA 1HRTH 1Q31A 1N8OB 4NIYA 1AFEH 4I32A 2ALPA 3RU4T 1THRH 1DT2A 1MMJN 1O3LA 1WCZA 4YOGA 5FCKA 3GYMA 4UEHH 3SNBA 3SNEA 5C5OA 2EEKA 1GHAG 1HPGA 2V3HH 2ZZUH 3QDZB 3SU5A 3ZZ7A 4JZFH 1JRTA 4VGCC 5C1UA 5F8ZA 1GL1A 2H2ZA 3S9BA 3K9XB 3M36A 1HB0B 5JBBS 2FZZA 1C5VA 2F9BH
chains in the Genus database with same CATH superfamily
1AFQC 1SMFE 3M61U 1NRRH 3ODFA 3M35A 5JBCS 1QB6A 2ALVA 2G81E 1A0HB 3K2UA 1OWJA 1PJPA 2UWPA 3MO9A 3V3MA 2J4IA 4ASUD 1OPHB 2KAIA 1FXYA 3V12A 2AEIH 1A46H 3NWUA 4NA9H 1MCVA 5EXNA 3RU4E 2PSYA 5TCCA 3FO8D 3QWCH 1FNIA 3I29A 3MNXA 3SU0A 1VGCC 2STAE 4A1XA 2D1JA 4GHQA 2FTMA 3BTME 2ZQ1A 3FP6E 1AFQB 3LJJA 2G5VA 4SGAE 3EE7A 2A4OA 1FUJA 1OSSA 3E91A 6CHAC 4IMZA 1K1PA 1EOLA 6LPRA 5GCHF 4FUGA 2IJOB 1ZHRA 1BRCE 2AGEX 3KYGA 2BXUH 2OQ5A 5I25A 4OGXA 1FY3A 4NFFA 1V2TT 3SOSA 2QY0B 1PPFE 3QTVH 3BTGE 1GHZA 5JBAS 4X0WU 1KTTB 3IG6B 4DURA 3K6ZA 4ISNA 1GI0A 3T26A 1UK3A 1ZTKA 4X6OA 1MBMA 4OS2A 4HZHA 1C5TA 4YLUA 4CREA 1O36A 1G3BA 4Q80A 3EGKH 4UFGH 3AVZA 1U6QA 1XXFA 2NU4E 1KY9A 3Q3KA 3RC5A 1QA0A 1OWEA 4X1PU 1W7GH 5GNDA 2K8IA 2DUCA 1S5SA 1VJAU 3C27B 2FYRA 2Q1JA 3TPIZ 2HPQH 1EZQA 4Z1MD 4MNVA 1V2OT 4A1VA 1KLIH 3ZYEA 2ODQA 5AVDA 2WPMS 3FN8A 3OX7U 2UUJB 1N6YA 2QCYA 1O3MA 2H5CA 1TE0A 5JPMH 5LGOA 1UK2A 4IW4E 1F92A 1Y3XA 2BZAA 1A61H 1TOMH 2FI4E 1TX8A 2ZECA 3Q77A 1GDNA 2TPIZ 2W5EA 3OEED 2FM2A 2XC5A 1W0KD 2VIVA 2XBVA 2SGFE 3A87A 1P57B 1QJ7B 4ISLA 1UVOA 1O5BB 4D9RA 2ZIQH 1TPAE 3ATLA 3T5FH 2Y5HA 1S85A 3RXOA 1MAYA 2SGDE 1WAYB 3OTPA 1SGIB 3A7ZA 3PB1E 3KHVA 2FOAA 3S69A 4JYVH 3TH3H 1BHXF 1YP9A 4MVNA 2ZPSA 2SGPE 3K65B 4Y0ZE 1ELEE 1FJSA 3QGNB 2BTCE 1OKXA 1V2RT 1AUJA 1SR5C 1VCQA 1VITH 3ELAH 1FX0B 2UWLA 4JZIA 3CENA 3ZV9A 4GAWA 4YT7H 3PLKA 1BIOA 1AB9B 4DJZB 2ZHFH 2BD9A 2H9TH 1BUIA 4THNH 2ZCKP 4K1SA 4A1TA 1ZOMA 1MD7A 2PKSC 4OGYA 2ZU1A 5HIYA 4AYVB 3JZ1B 4RN6A 1KMHB 1A5GH 1AZZA 1YPHE 1NM6A 2KAIB 2ZG0H 3UNSA 2ZCLP 1K1LA 4YOIA 1TNGA 4XFQA 1KYNA 4AB8A 3UAIC 2WINI 1IHTH 2YNAA 2PGBB 1QR3E 2ZPRA 1MTUA 5FBIA 5C20A 1DSUA 1SLUB 2PLXA 3RDZA 1K1JA 1ZJDA 1AU8A 2A5IA 3M7QA 2FEQH 4TWYA 4FUCA 4RT1A 5FX5A 3OE7D 3UOUA 2BD2A 3SZEA 1DANH 2CHAB 3AAUA 3ATMA 4FUEA 2P95A 1A0JA 3ZVDA 1W11U 1BMFD 4H6SB 2OUAA 9LPRA 4ZROA 1FAKH 2P59A 3RXQA 1T8MA 1ZGVA 1GCTB 4MPUA 4Q7YA 3UR6A 5FAHA 1HAIH 1FN6A 4D8NA 1CA8B 4NA8A 3WWFA 1O5CB 3A88A 2Q6FA 1SQAA 2HOBA 1QZ8A 2TGTA 1TGCA 4WF8A 1SVPA 3M3VA 4UDWH 1HAGE 1YCPH 2M2AA 3DFJA 3P17H 3GY6A 1O2OA 2BD7A 2LNCA 1VITF 1HJAB 1ELAA 5DP9A 1FPHH 5EU8A 2PW8H 2STBE 2WHXA 1C5YB 3RXMA 4RKOB 1UTNA 2F4LA 3UOPA 3SV9A 1LHCH 1GI7B 1RXPA 1THSH 2Z94A 2L74A 3RXIA 2TBSA 4J2YB 2XC4A 3F68H 4YT6H 4X1NU 1ESTA 1HAXB 3AW1A 4D76A 3ZZAA 3SYJA 2ZU4A 2F9NA 1NPMA 2JIZD 3SI3H 2FS9A 3HK3B 1O3FA 3A8DA 2GDDA 2R0LA 2K0QA 5J4QA 2B0FA 5T6FA 2W7UA 4FUBA 3F2GA 3MNCA 5EG4A 3NUMA 4AGKA 1SI5H 1SG8B 3A8CA 3GDUA 4CHAB 1VJ9U 1O3HA 4WVPE 3UQOA 5DP7A 3BF6H 3U8RH 5G4BA 1SQOA 3KIDU 3A7YA 3GCHC 3V7TA 2XNIA 3RM0H 3T2NA 3BTHE 3S9CA 5HM9A 1AI8H 1GMHF 3RXHA 1GVLA 3GY2A 3ZZ9A 2IN2A 1ZSLA 3M5OA 1HV7A 1EZUC 2J94A 3P70B 1HJ8A 1OP8A 1P02A 1EUFA 1LPKB 1GI9B 2SGEE 1GBTA 1G36A 1SGFA 1J9CH 1K1NA 1S0QA 1D4PB 1K1IA 5DP8A 2GGVB 1JBUH 1TBRH 1NRSH 1ARBA 2VU8E 1DLKB 2J92A 4TPYA 3SU6A 1A7SA 1TWXB 2YMSB 3FZZA 1BTPA 2PGQB 1Y5AT 1GBAA 1TPOA 1K1OA 1BDAA 3M7TA 5EQSA 1SGNE 2LELA 2C93B 1MD8A 1TPPA 4HTCH 4CRAA 2OTVA 2V7QD 2FOEA 4BAKB 1EB1H 2OK5A 3ZVEA 2PHBA 2FLBH 4MPWA 2XTTB 1LVBA 3DFLA 3L6PA 1TNIA 2C90B 1TA2A 1P11E 2EI7A 3G01A 1MTNB 3OYPA 1P06A 3BEFB 1C2IA 4FUIA 3SHAH 4LXBH 5DP3A 4M7GA 3DSPA 3FVFB 1T7CA 1HLTH 1NRQH 1O2JA 1OHHD 1CT4E 5L2ZH 1YGCH 3SQHE 2BVSH 3NPSA 1A1RA 1THPB 1EAUA 2R3YA 1KXFA 2HNTC 1AHTH 1GJ4H 3U8TH 1GG6B 1YLNA 1ZJKA 1C5UA 3KL6A 5GDSH 1T4UH 3SU2A 1XKBC 5GIBA 1O5DH 3PRDA 3ATIA 4HG6A 5AHGH 5E8EH 1F0RA 4YESB 1GBLA 1RD3B 2BQ7B 1W13U 3EAJA 5C94A 3RXVA 4ABBA 3T27A 4JK6A 5EOKA 1P10A 3SUFA 3GICB 2JJ1D 5FCRA 2QF5A 1MTSA 2FO9A 2J98B 5F8TA 1YBWA 2Q6DA 5L2YH 3RMNH 1VGCB 2CMYA 2VVVA 3BTEE 1W14U 4BNRA 1Q2WA 1FMGA 1LKBA 1C1OA 1H1BA 1SQTA 2A1DB 4CRFA 5BRRE 1OYTH 1MZAA 4NCYA 3LGVA 2BYAX 2RG3A 1RJXB 1Z71A 1EPTC 1JXPA 1V2MT 2ZCHP 1Y3YA 2FDAA 3FFGA 1W7XH 2C8ZB 2R2MB 4FUFA 4KTUA 3RXGA 1OS8A 1C2KA 3CS7A 1O35A 1MU6B 1UCYK 2F91A 1SGYE 1GJDB 1K9OE 3UNQA 3A85A 3O8DA 3A86A 2GMTB 2RA3A 3LPRA 1PPGE 2BX3A 4X1RU 2FTLE 3UFAA 4WH6A 1KLJH 1V3XA 3F9HA 1QB1A 1DUAA 2ANWA 2FOCA 1VITG 1OOKB 2C8XB 1RGQA 2G52A 1MQ5A 1GJ9B 5DP4A 4BANB 3BG4C 4CRGA 1MTVA 3BTQE 3HGPA 2BD3A 4WXVA 1CGJE 2Z3DA 4ABDA 1YM0A 1YPJH 1UVPA 1WU1A 1H9LB 1GGDB 3H09A 2FLRH 3SJOA 1IQIA 1PFXC 3VEQB 3SI4H 3GCTF 3A7XA 2TRMA 1IQGA 2ZHEH 3LU9B 3OU0A 4NA7A 1P12E 5TCAA 2ZU5A 3BTWE 3B23B 1G32B 3MNBA 1ELGA 4ABAA 2P3FH 5HXFA 3L33A 4IMQA 5CMXH 1LVOA 1Y8TA 1O2HA 2OC7A 1KXDA 3SNCA 1GVKB 4ZKOU 2GP9B 1TMUH 4VGCB 1IQMA 4TSFD 5IK2D 4AC9A 1DLEA 3E16B 3IWMA 1XX9A 3MWIU 3SQEE 2JDID 1DITH 1ELVA 4U32A 3EYDA 1C2EA 1G2MA 3UUZA 2V0BA 1BTWA 3MNSA 1YCPM 1LQDB 1XUFA 1LDTT 2SGAA 4K8YA 5FPYA 2ZFRH 1OX1A 4GVUA 4ZKRU 5I46H 1SLVB 3PV5A 2HVXA 4FU9A 3PTBA 3C1KA 1C1WH 1L1NA 2HWLB 1V2LT 1Z1IA 2D8WA 1O5GH 1TLDA 1KDQB 4O9VA 4AZ2B 1SGDE 4BTUB 1AIXH 3DT0H 1NBMD 4WMFA 3OFND 3SUEA 4WXIA 4ZMAH 1EZXC 1QJ6B 1C1MA 1Z8JB 4OS4A 3ZV8A 1O3DA 2SNWA 1OP0A 4O3UA 1LO6A 1J17T 3KQ5A 6CHAB 2D26C 1AO5A 3BTDE 1EJAA 2BDHA 4INLA 3KQCA 1TALA 2CJIA 2OD3B 4UFEH 2R0KA 1L0ZA 1UTJA 2ANKH 2B8OH 2OLGA 7ESTE 1K21H 2ZA5A 1ZYOA 2VNTA 2WSSD 3DCLA 4ISOA 4D7FA 1QBNA 4F55A 2P93A 3SV8A 2GCTC 3VGCB 3ZIAD 5B6OA 4NFEA 1G3EA 2ZEBA 4GLYA 2F83A 1NFXA 4ISIH 1DPOA 1ELDE 1H8ED 1AVGH 3TK9A 4B2CA 1GJ7B 3LGYA 1MAXA 3EA9A 4HGCA 1HJ9A 1G30B 3RMMH 5C67A 1ZPZA 3MU1A 3D65E 4B1TA 3E8LA 1GCDA 1Q3XA 3U1IB 1UO6A 3MO3A 1O2TA 4K2YA 4D9QA 4AORA 1SB1H 1L1JA 1SFQB 3TK6A 1GMDF 2JKHA 4D7GA 1C1RA 1C9PA 1H8HD 3GDVA 3NZIA 2PUQH 3S7HB 2PFEA 5SGAE 2QAAA 3VPKA 4I33A 1W10U 2Z9GA 1P2MA 1J15A 3JZ2B 2OBQA 2XCNA 1IQLA 3GS9A 3RXBA 3RXFA 1P0SH 2ZDNA 3GCNA 3SUGA 4Y8YA 1BMMH 2A0QB 2ZTXA 1G2LA 2J5UA 1FLEE 2BY8X 2VWNA 1ESBA 2HNTE 2BZ6H 3BG8A 3SGBE 1NESE 3T25A 2XXLA 1SLWB 1D6RA 3RXPA 1LHFH 4JZ1A 4X2YA 1E35B 3TNSA 3RXTA 4X6NA 2YOLA 5DP6A 1ORFA 1Y5UT 1TNJA 2GCHF 1A3EH 3SN8A 3KNXA 1IOEA 4IC6A 3IITA 5H4IB 1PPEE 4MNYA 2FIRH 2ZDVH 3VFEA 1ZZZA 3Q3YA 2A2XH 1TA6A 4XOJA 8LPRA 1GBFA 3ODDA 1V2KT 4DT7B 1CVWH 4OS1A 4Y6DA 4ZHMU 5EQRA 3M37A 1DOJA 1SGFG 1AUTC 1E1QD 2DE9A 3B9FH 2CXVA 3OTJE 4JZDH 1C4V2 1P09A 2XWBI 1WV7H 2ZFQH 2QF0A 1AE5A 3HK6B 1AZ8A 7KMEH 2A4RA 2ZHQH 3RXJA 5JB9S 2FI5E 1V2JT 3RU4D 5TJXA 2BDIA 8GCHF 2KR7A 1WBGB 1ZHPA 3BEUA 1YPKH 2H6MA 3QX5H 4JK5A 1YC0A 1XKAC 2Z7FE 4IN1A 2BD8A 1T8LA 1AMHA 3TU7H 1DWDH 2BD5A 2H9HA 2O8WA 2XBXA 2CV3A 2V3MA 1VR1H 4X8UH 5CHAC 1L4ZA 2H1UA 1A3BH 2BLOA 1AE8H 1XUJA 1TNKA 1HAVA 4FOUC 4X8VH 1TX6A 3O8RA 2A4QA 3SV6A 2O8TA 1E38B 3TITA 3GY4A 2XW9A 1QRXA 3PMJA 3DA9B 2AMPA 1O2MA 1P2IA 1GBBA 4K60A 4AFSA 1UHBA 1W3CA 3LJOA 2Y7XA 2WPKS 3DSGA 4RT0A 1ELFA 1XXDA 1EJNA 3VXFH 5JYIA 1BOQA 2JETC 5KEDA 5CHAB 3M5NA 1PYTC 1PPHE 1YPHC 2TIOA 4K1EA 2FWWA 4F49A 5EJLA 5J4SA 1TAWA 3HKJB 3KQEA 1HAYB 1LPGB 3VG8A 3MU0A 3M7UA 3MFJA 2AERH 1P03A 1BCUH 2D2DA 3CNRA 1EKBB 4DG4A 1T4VH 2P8OB 2GZ8A 4X8SH 4YTAA 2IPQX 2J38A 1EAXA 2F9UA 4CRCA 2FOHA 2ZQ2A 2P94A 1QQUA 1HNEE 2GX4A 1AN1E 4ZAEA 4RI0A 5C17A 2HVYB 1HGTH 3EE0B 2OQUA 1IQNA 4AOQA 5DP5A 1C2FA 1GL0E 4FUHA 1GG6C 2BLQA 1L1GA 4JZEH 1KSNA 1DFPA 9ESTA 2BVXH 1VCPA 1NU9A 2ZDAH 4OS5A 4AN7A 1P9UA 2FMJA 3RLWH 3RXLA 1QNJA 5CE1A 5FX6A 1EASA 1VKYA 1Y5BT 1COWD 3BEIB 1GHXH 1UVUH 2Y5GA 2FOFA 3MH4A 4GCHF 2PTCE 4FVBA 6GCHG 5T3HA 4SGBE 3U98H 2ZU2A 4P02A 1VZQH 1E1RD 1O2KA 2XOKD 1AVWA 1D6WA 1O38A 4Y79A 1O3AA 1HAPH 4DY7B 2UUKB 5C1YA 3KYFA 4WMEA 4XRNA 4YXWD 4DVAU 1MKXH 3D23A 3MU8A 1C1VH 1A5HA 1EP6A 1O2LA 2FOBA 5E2PA 1C5RA 3STJA 2VIOA 3KEEA 3RUOA 1NFUA 3FKSD 4ZCNA 4Y76A 1F7ZA 1GJCB 1GCTC 5A8ZA 1AWHB 2GMTC 1CHGA 4XBDA 3U1JB 2CF9H 2BOKA 1BMLA 3NKKA 2QXGA 1GMCF 2WPLS 1BB0B 1ID5H 2EY4C 4I8GA 3LC5A 3TNTA 4CH8B 1P04A 1HAOH 3URDA 3STIA 4WH8A 1C2LA 4MDSA 1PQAA 3E0PB 1FIZA 1P8VC 2ZF0H 2Q6GA 1DDJA 1C1TA 5EPYA 2QGRA 1E79D 3SHCH 1WUNH 1V2PT 4BAOB 1VCWA 2ANMH 3H7TA 1ETSH 5DKMA 1QA7A 2RA0A 5T6DA 3KCGH 3QN7A 1WTGH 1O33A 1C2GA 1Y3UA 2OCVB 1WSSH 2XRCA 3D49H 1Z6EA 3P8OA 1MCTA 2NU0E 1TFXA 1SBWA 2NWNA 4X2XA 1ANEA 1IQKA 5HMAA 3MO6A 3FAOA 4I86A 2Y81A 3PYHA 1CSOE 4CHAC 1A2CH 4HFPB 1A5IA 2DE8A 1J14A 3AAVA 1H4WA 2PUXB 3BTTE 1N8OC 3U9AH 1CA0B 3UREA 1TOCB 3ENSB 5AF9H 3UPEA 3ZVFA 3Q76A 1K28D 1Z6JH 1DWCH 2A5KA 2OC1A 1IHSH 4U2WA 1EPTA 4Q63A 4X1SU 2EA3A 3TGJE 5DO4H 5ESBA 4B2BA 1CBWC 3LH3A 3LKWA 3U8OH 1MBQA 1Z1JA 2KFWA 2RDEA 2WPJS 4F48B 4P00A 1DWEH 2ZNKH 2ZGBH 2THFB 4ABHA 4FUDA 3TH4H 3A8BA 1EX3A 4O3TA 3N7EA 1C4Y2 3RP2A 1O2RA 5EIYA 2W26A 1LKAA 3K6YA 3RXDA 3BTFE 1GBJA 1YKTA 1XVMA 2G4UA 2GCTB 4BXWA 4TYDA 2TGDA 1UMAH 1OWIA 4FU8A 2TGAA 3SJIA 1FY8E 5DG6A 1C5QA 3FANA 2FYQA 1SQRA 2ASUB 1MH0A 2BDGA 3RC6A 1NO9H 3EA7A 4XBCA 2I6SA 2A4GA 1LVMA 5GCHG 2VIQA 4B76A 5A0BA 1P2KA 2JJ2D 5A0CA 4OM9A 1RFNA 3LDXH 1FZZA 2Z6BD 4CBNA 2G51A 4X2VA 1QGFA 2XYAA 3TGKE 1MTNC 1K0HA 1IQJA 2UUYA 3EA8A 3ZVAA 5EQQA 3ZZ3A 1KXEA 1AKSB 3A84A 3FZDA 1ELTA 2AIQA 5HIZA 2QXIA 2CF8H 4BOHA 2VGCC 4AYYB 1NTPA 1Z8GA 1PQ8A 2ZFFH 1P2OA 4B75A 4TT3D 1AWFH 4OS6A 3QO6A 4IGDA 5LPFA 1ZMNA 2G00A 1NN6A 2VWOA 1QL7A 3ZZ8A 1TABE 3T29A 1RS0A 4OS7A 3HGNA 4NIXA 3KGPA 2GTBA 1D9IA 2BB4A 3GY3A 3ZVBA 1T32A 1C5NH 1ABJH 2GCHG 1O5EH 1C5XB 1DSTA 1GJAB 2Y7ZA 2VGCB 5F8XA 4AFZA 2EI8A 1KXBA 1S84A 1P9SA 8ESTE 1OWDA 3P8NA 1JIMA 2WYJA 2FP7B 1NBME 5FXLA 3R0FA 1S82A 2C8WB 1FONA 1QL8A 3VB5A 1EXFA 1J16A 4YZUA 5FBEA 3RXAA 1CE5A 3QZQA 1W0YH 3MHWU 1GJ8B 3URCA 2JH6D 4UFDH 1O2WA 3TJOA 1GDUA 4JYUH 3SNAA 4E06H 1HCGA 3ZZBA 1ELBA 1O3BA 1PPZA 2EI6A 2ESTE 2V6NA 3TJUA 2JH5D 8KME2 2LPRA 3QLPH 1D3QB 2ZFSA 1BT7A 3O8CA 4I8LA 2BDAA 4INHA 1JRSA 3ZVGA 4E7NA 1O30A 3SGQE 1O39A 2AS9A 2FXRA 1BZXE 4MTBA 1YWUA 1SGQE 3ZZ4A 2XC0A 3EQ0H 2P3UB 5EXMA 5ETXA 1AQ7A 1HXEH 2C4FH 2BMGB 3SU4A 4B71A 1DXPA 5HM2A 1T8OA 4B2AA 4JYTA 1EQ9A 1HAZB 1QCPA 1YPEH 3LGIA 5PTPA 3UNRA 3OEHD 2AYWA 2ZP0H 2VIPA 5EPNA 3ITIA 4I8HA 4I8JA 3F3BA 4K8BA 3KN2A 5DGJA 1IQEA 3I77A 1GI2A 5EJZA 4AG1A 2F9VA 3GY7A 3P6ZB 3T28A 3SJKA 4DT4A 1CT0E 2QC2A 1W8BH 1MQ6A 1SGTA 3A8AA 5FL7D 1TRMA 1B5GH 3E3TA 1ZGIA 3LT3A 1ZRBA 2PKAA 3CP7A 3EDXB 1KLTA 2WV9A 2QA9E 2WUBA 1NT1A 1D3TB 1UVTH 5IDKA 3PWBA 3NRLA 1INCA 5F53A 1GBHA 1V2UT 1GHBF 1UCYH 5T6GA 2QE7D 2ZI2H 4QT8C 4XSKU 1C2JA 4IBLH 4UD9H 2R9PA 1FY4A 2GT8A 1C5WB 2PKSB 5A2MH 3LOXA 2R2WU 1HBTH 1DVAH 2VWLA 1MKXK 1GVZA 3SO3A 2K1QA 3RXSA 5DN6D 3RC4A 3RXKA 1F0TA 1DICA 3LC3A 3QTOH 5E0GA 1HDTH 1H8DH 1M9UA 1ANCA 2BQ6B 3LGTA 3A7VA 1ZSKA 1ZMJA 1O3GA 1IQHA 3BIVH 1OWHA 1QB9A 3TGIE 3TJNA 5DSFA 1UTMA 4INKA 3M3TA 1TIOA 1G37A 1LMWB 5EODA 4CRDA 1D3DB 2BY6X 4LZ1H 2CHAC 4DOQA 1YPMH 1BTYA 2HPPH 1KTSB 1W0ZU 4I7YH 3F1SB 1HXFH 5EW2H 5AFZH 1MKWK 4CRBA 2BDBA 3RXEA 1SOTA 1QJ1B 1BQYA 2QXJA 1UTLM 2ZTZA 3GCOA 4FXGH 2BHGA 1UCYE 4LOYH 1ETTH 2B5TB 5FPTA 1GHAF 4R8TB 2A31A 2YMSC 4FETA 3RMLH 2ZDLA 3ATWA 3SU1A 4ZUHA 4I31A 1O3KA 1GHYH 1P2QA 1C5PA 2HLCA 4Q7XA 3PLPA 2H5DA 2BD4A 3LGWA 2RFKC 2ZU3A 1TGTA 1F2SE 3S9AA 1CT2E 4R0IA 4NWLA 1TGBA 1P05A 2QF4A 1ANBA 3RXCA 3AASA 3QGJA 5AFYH 2ZHDA 1HAHH 3LIWA 3MYWA 1MZDA 1E36B 3GCHB 4K69A 3GDSA 1TPSA 3ZYDA 3PMBB 1XM1A 3SUDA 2A45B 5GJ4B 2ZPQA 3ZVCA 1OP2A 1NU7B 1HIAA 1ZMLA 2BVRH 4Y8XA 1YCPK 2NU2E 2VIDA 4H42U 2L6OA 2XCFA 3FP7E 2WPDD 3PO1C 4ZKSU 3MH7A 1SGRE 2FX4A 2GJGA 4CR5A 1O34A 3OY5U 1EAWA 1SSXA 3RXUA 1C1NA 1XVOA 2KCOA 4YLQH 4X2WA 4KELA 2P8OC 4BAHB 1RIWB 4ACAA 2NU1E 4RKJB 5E0HA 1A4WH 1KIGH 3F9EA 3M3SA 4I8KA 4MLFB 1UTOA 1Y3WA 4WMDA 1SGPE 3F0PA 5A0AE 4Z6AH 2PKAB 2W6ID 4Y7BA 1NFWA 1O2VA 3F6UH 1BTZA 2GV6A 2ZDKA 1EP5A 2ZHWH 1Z7KA 3SNDA 1P2NA 1MUEB 2Z9KA 4Y11E 2KCPA 3P8FA 3TJVA 1SHYA 1HYLA 1RRKA 2BQWB 1BBRH 4Q2KA 3W94A 3BG4B 5EXLA 3HKIB 1ZTJA 1HJAC 1TMTH 4K1TA 2PTNA 2ZO3H 2QV1A 1TRYA 1GGDC 2BDYA 4IS5A 1SL3A 1SPJA 1FQ3A 3SZNA 5DJ7A 1YLDA 3MQKC 1O0DH 1LQEA 1MU8B 5CHBA 4A5TS 3D62A 1YF4A 3LGUA 5JBTA 2A7JA 7GCHG 6GCHF 1GI5A 1SHHB 1NROH 4U01A 1O3EA 1P2JA 1GBIA 4WJG2 1EOJA 1FI8A 1BMAA 3A89A 2GD4B 3A80A 1BA8B 1FY5A 5FPSA 3KQBA 2Z3EA 3H5CB 4CH2B 2PWXA 1O3JA 4X6PA 4F4OC 5B6LA 2KX4A 4H6TA 2Y80A 3T62A 4PROA 4ESTE 4B6FA 1MKWH 1AKSA 1WQVH 2A32A 2IPHA 4B74A 1ZTLA 1GHBG 1BITA 1O2NA 1QTFA 2BLWA 3PLBA 1OWKA 3U69H 3UTUH 1AD8H 4GCHG 1DS2E 1C5MD 5A8YA 3MTYA 5FHTA 2ODPA 4Y0YE 1P01A 1O2ZA 2AMDA 2WV4A 3O8BA 1T31A 1ARCA 1ETRH 3HPTB 2OC0A 4A92A 3MI4A 3BIUH 4CBOA 3H7OA 1UVSH 4B6EA 1K2I1 5DPAA 3DD2H 2FESH 2A7HA 1RTLA 3A82A 1O3OA 1WQSA 4NGAH 2GVFA 5HKKD 2XBYA 2NU3E 1F5LA 1O2IA 1XUKA 4XDEA 4GUXA 3SJ9A 2BY9X 3TIUA 3VB3A 5ESTE 1EB2A 4GHTA 1KXCA 3NK8A 1GBEA 1AGJA 1CU1A 1DY9A 3OY6U 2ILNA 1NY22 2Z9LA 3F9GA 1V2QT 4IN2A 4NG9H 1O3NA 4AFUA 1GMHG 2CK3D 2JH0D 2I6QA 4IC5A 1XUGA 4ZXYH 1BJUA 2CN0H 1ZPBA 4XD7D 4Z0KA 1PYTD 3ZZ6A 1NRNH 1C1SA 1TNLA 2AFQB 3TVJB 1HAVB 3TH2H 3NXPA 1AY6H 3PRBA 5A09A 5K7RA 1C2HA 4MPVA 1BTXA 1S83A 3SW2B 2PV9B 2ODYB 3E6PH 1QRZA 3F0OA 3I78A 5HYOA 2ZC9H 1GI1A 4FUJA 5F6MA 1O2QA 1CBWB 4AB9A 2Y5FA 1UJ1A 2XWAA 1OXGA 1NC6A 1S6LA 1BTUA 1TQ0B 3UB0A 2O8UA 4ZHLU 1KXAA 1LHEH 1QIXB 5DK1A 3Q3XA 3GOVB 2J97A 1E0FD 2OC8A 4B73A 3SORA 2FPZA 3UR9A 1O5FH 2GKVE 4UONA 3N7DA 1B7XB 1C5ZB 1W0JD 4Q4LA 5GWZA 1IAUA 1CGIE 1QQ4A 3MOCA 1ZPCA 3A81A 1O5AB 1TRNA 3SGAE 2WPHS 1YY3A 3E90B 3FP8E 1SFIA 2VINA 1JMOH 3MH6A 1P3EA 1O37A 5K0HA 4YO9A 1WYKA 1BJVA 1C1UH 1F5RA 1O32A 3QZRA 4AG2A 5C5NA 3UWIA 3TLOA 1V2NT 1LPZB 3SV7A 1SOZA 1L4DA 2A7CA 1GBDA 1J8AA 4ZH8A 8GCHG 4ZHAA 2XNDD 3UY9A 1CHOF 1S81A 1OYQA 2A2QH 4K5ZA 4NSYA 2Z3CA 1C1QA 5ABWA 4ABIA 2LP6A 3OSYA 1YPGH 4LZ4B 2G5NA 2J34A 2Z9JA 2BXTH 4FU7A 4ABGA 1EAIA 5CDFE 4MNWA 2VBCA 1RTFB 2YMSD 2CGAA 1FPCH 1UTKA 2SNVA 1F0UA 4XE4A 1S6FA 4A7IB 3F2HA 1H9IE 3RLYH 2ZGHA 4NIWA 1EFRD 3CS0A 3PROA 2BDCA 4UE7H 1GJBB 1WTHD 1TMBH 1C5OH 4ABJA 5EGMA 1RTKA 2ZFTA 2ANYA 1DY8A 2VWMA 4MG3A 1UTQA 1DWBH 2OINA 2O9QA 3A83A 1QRWA 4NWKA 1S0RA 1O2XA 3P92A 1T8NA 2EQNA 3M5MA 5KECA 5C0TA 2BLVA 1TNHA 2PP6A 1LTOA 3PWCA 4J1YA 1FN8A 4BAMB 5GXPA 2BY7X 1O2PA 1YLCA 1DXWA 3GISB 4X6MA 2ZWLH 3P95A 3E1XB 2QN5T 3A7TA 2F9OA 1ABIH 2QIQA 4ZXXH 4DIIH 4XBBA 1CHOG 1CQQA 1Y3VA 7GCHF 1FY1A 4JCNA 2AIPA 3DSOA 1QURH 4CR9A 1O2SA 3GCTG 3M5LA 2BOHB 2M5TA 3LH1A 5LH8A 1QY6A 4E7RG 2EC9H 3S0NA 2C8YB 2SFAA 4ASHA 5HGGA 4GSOA 1JWTA 2GZ9A 5EW1H 3WWBA 1BRBE 2WV5A 1K1MA 3BN9A 1XMNB 1C2MA 1C4U2 1GI3A 3VB4A 2GZ7A 4FVDA 1SGEE 1S6HA 2HALA 3L3TA 5LPEA 3VGCC 2AMQA 2R3UA 1FDPA 1N1LA 4K3JA 3SV2H 3R3GB 1BHXB 1BTHH 1NRPH 2O8MA 1O3PB 3ESTA 1A0LA 2ZFPH 1EJMA 1TQ7B 4LK4A 3FOAA 3GYLB 1W12U 1WXRA 4NZQA 2GDEH 4HI3A 1ACBE 1B0FA 4RSPA 1WDIA 1LVYA 2O8LA 2VJ1A 3BV9B 6ESTA 1PPBH 1GDQA 2B9LA 1Z8RA 2ZKSA 2KCAA 1ANDA 1F0SA 2B7DH 2GT7A 1RIWC 3GY8A 4ACBA 1TB6H 2PSXA 4WWYA 4TPIZ 1O31A 2HRVA 2BX4A 1DX5M 2FOGA 3B8JA 3W1EA 1GMCG 2G55A 3ZZ5A 3MU5A 5GPIB 1UK4A 3WY8A 2Y82A 2HGTH 4TY7A 4ISHH 1GBMA 1GHVH 1N6XA 1JIRA 1TGSZ 3MH5A 3PMAB 2WPIS 2J9NA 4KGAA 4DCDA 1P3CA 1TBQH 3F2FA 4YM9A 1ZLRA 1TX7A 2ZGCA 3KQDA 3BSQA 5T1VA 2QF3A 1SKYE 1AB9C 1IQFA 2QXHA 2F43B 3MU4A 2UUFB 3NCLA 2VB0A 5L30H 2XBWA 2YNBA 4KTCA 2VVCA 3RXRA 1GJ6A 1GI6A 5C3NA 1O3CA 1HFDA 3P8GA 4TY6A 1GMDG 4WY3A 3RMOH 1YYY1 4BTIB 1ELCA 1GHWH 1BRAA 1QL9A 4U30A 2FS8A 4ABEA 1JOUB 1X7AC 4Y7AA 4E05H 1V6DA 3AK5A 4ZKNU 4H4FA 1GI4A 1O3IA 1V2WT 4MNXA 1ZR0A 1QHRB 2FOMB 4UFFH 3PO1B 4YOJA 1TBZH 4DIHH 4M9FA 2IOTA 1C9TA 1QBVH 1CO7E 1AVXA 1FV9A 1FIWA 3F9FA 1BBRK 5IYTA 1WOFA 2AGIX 1EPTB 2RDLA 4Y71A 1Y59T 2OXSA 3PM3A 3U28C 4X8TH 2C3SA 1C5LH 2J98A 3BTKE 4JMYA 1XUIA 2AH4X 1F5KU 2W3IA 5C1XA 3UQVA 1DM4B 2VVUA 1O2GH 1G3CA 1UTPA 4NSVA 4BTTB 1O2YA 3VB6A 4AGJA 4NZLA 2V35A 3W95A 5C0UA 1DE7H 2WZQA 4DGJA 3ZZDA 3MMGA 2IJD1 4KKDA 5C2ZA 2FX6A 1ZHMA 1MTWA 1NS3A 1PQ7A 2UWOA 3PMHB 5E2OA 2VIWA 1YPLH 1C1PA 5KGOA 1HUTH 5LPRA 2Y6TA 1EZSC 2GV7A 1GWAA 1W2KH 4ABFA 2G8TA 3UIRA 3VB7A 4DW2U 1SC8U 1V2VT 2PR3A 1K22H 1EATA 1G3DA 1GBKA 2VH0A 1ZRKA 1GJ5H 1LHGH 1QFKH 2F9PA 2BM2A 3ATKA 1TGNA 3QK1A 1BBRE 3S7KB 3AW0A 3SJ8A 7LPRA 4Y10E 1TYNA 1XUHA 2ULLA 3SBKA 5L6NH 2Z9IA 3SU3A 3V0XA 3TK5A 4BXSA 3V13A 3KF2A 1DUEA 5JB8S 1C5SA 1E34B 2KZ4A 3DUXH 2KCYA 1NZQH 1GPZA 5E0JA 1HIAB 2H9EH 2W6JD 1PPCE 2W7SA 1GI8B 4A6LA 2ZDMA 1GBCA 3N7OA 2FODA 1SLXB 2JETB 3Q00A 1MABB 1BMNH 2FI3E 4BAQB 1PQ5A 5BPEA 3QUMP 1NFYA 3PTNA 2AGGX 2SGQE 2V3OH 2W3KA 2OP9A 3HATH 1FAXA 5JDUB 1BRUP 2J2UA 2F3CE 1Z8IB 1LCYA 2VH6A 1QBOA 2WYGA 2G4TA 1LHDH 2BY5X 1TONA 3PV4A 2AHME 2WUCA 3ZZCA 3LONA 1V2ST 2A5AA 2HLDD 4Q7ZA 4MQAA 3DHKH 1D3PB 1ZSJA 1G9IE 1B0EA 1UHBB 3UWJH 4AFQA 1H8IH 1CA0C 1E37B 2RCEA 4X1QU 2HNTF 2P3TB 3A7WA 1O2UA 4MPXA 1SGCA 3VXEH 4O97A 4TWWA 1C2DA 5A8XA 4KP0A 2ZGXH 2TGPZ 3GY5A 5F03A 1ESAA 2OBOA 3E0NB 4KTSA 4AX9H 2ZTYA 2J95A 4O03A 1L2EA 2ZGJA 4Y8ZA 4GPGA 1KDQA 2P16A 3RM2H 2QYIA 3OAAD 1H9HE 1CGHA 4NIVA 3WW7A 3PV2A 1HRTH 1Q31A 1N8OB 4NIYA 1AFEH 4I32A 2ALPA 3RU4T 1THRH 1UW7A 1DT2A 1MMJN 1O3LA 1WCZA 4YOGA 5FCKA 3GYMA 4UEHH 3SNBA 3SNEA 3N99A 2EEKA 5C5OA 1GHAG 1HPGA 2V3HH 2ZZUH 3QDZB 5EJ1A 3SU5A 3ZZ7A 4JZFH 1JRTA 4VGCC 5C1UA 5F8ZA 1GL1A 2H2ZA 3S9BA 3K9XB 2KM0A 3M36A 1HB0B 5JBBS 2FZZA 1C5VA 2F9BH
chains in the Genus database with same CATH topology
1AFQC 1SMFE 3M61U 1NRRH 3ODFA 3M35A 5JBCS 1QB6A 2ALVA 2G81E 1A0HB 3K2UA 1OWJA 1PJPA 2UWPA 3MO9A 3V3MA 2J4IA 1OPHB 2KAIA 1FXYA 3V12A 2AEIH 1A46H 3NWUA 4NA9H 1MCVA 5EXNA 3RU4E 2PSYA 5TCCA 3QWCH 1FNIA 3I29A 3MNXA 3SU0A 1VGCC 2STAE 4A1XA 2D1JA 4GHQA 2FTMA 3BTME 2ZQ1A 3FP6E 1AFQB 3LJJA 2G5VA 4SGAE 2A4OA 1FUJA 1OSSA 3E91A 6CHAC 4IMZA 1K1PA 1EOLA 6LPRA 5GCHF 4FUGA 2IJOB 1ZHRA 1BRCE 2AGEX 2BXUH 2OQ5A 5I25A 4OGXA 1FY3A 4NFFA 1V2TT 3SOSA 2QY0B 1PPFE 3QTVH 3BTGE 1GHZA 5JBAS 4X0WU 1KTTB 3IG6B 4DURA 3K6ZA 4ISNA 1GI0A 3T26A 1UK3A 1ZTKA 4X6OA 1MBMA 4OS2A 4HZHA 1C5TA 4YLUA 4CREA 1O36A 1G3BA 4Q80A 3EGKH 4UFGH 3AVZA 1U6QA 1XXFA 2NU4E 1KY9A 3Q3KA 3RC5A 1QA0A 1OWEA 4X1PU 1W7GH 2DUCA 1S5SA 1VJAU 3C27B 2FYRA 2Q1JA 3TPIZ 2HPQH 1EZQA 4MNVA 1V2OT 4A1VA 1KLIH 3ZYEA 2ODQA 5AVDA 2WPMS 3OX7U 2UUJB 1N6YA 2QCYA 1O3MA 2H5CA 1TE0A 5JPMH 5LGOA 1UK2A 4IW4E 1F92A 1Y3XA 2BZAA 1A61H 1TOMH 2FI4E 1TX8A 2ZECA 3Q77A 1GDNA 2TPIZ 2W5EA 2FM2A 2XC5A 2VIVA 2XBVA 2SGFE 3A87A 1P57B 1QJ7B 4ISLA 1UVOA 1O5BB 4D9RA 2ZIQH 1TPAE 3ATLA 3T5FH 2Y5HA 1S85A 3RXOA 1MAYA 2SGDE 1WAYB 1SGIB 3A7ZA 3PB1E 3KHVA 2FOAA 3S69A 4JYVH 3TH3H 1BHXF 1YP9A 4MVNA 2ZPSA 2SGPE 3K65B 4Y0ZE 1ELEE 1FJSA 3QGNB 2BTCE 1OKXA 1V2RT 1AUJA 1SR5C 1VCQA 1VITH 3ELAH 2UWLA 4JZIA 3CENA 3ZV9A 4GAWA 4YT7H 3PLKA 1BIOA 1AB9B 4DJZB 2ZHFH 2BD9A 2H9TH 1BUIA 4THNH 2ZCKP 4K1SA 4A1TA 1ZOMA 1MD7A 2PKSC 4OGYA 2ZU1A 4AYVB 3JZ1B 4RN6A 1A5GH 1AZZA 1YPHE 1NM6A 2KAIB 2ZG0H 3UNSA 2ZCLP 1K1LA 4YOIA 1TNGA 4XFQA 1KYNA 4AB8A 2WINI 1IHTH 2YNAA 2PGBB 1QR3E 2ZPRA 1MTUA 5FBIA 5C20A 1DSUA 1SLUB 2PLXA 3RDZA 1K1JA 1ZJDA 1AU8A 2A5IA 3M7QA 2FEQH 4TWYA 4FUCA 5FX5A 3UOUA 2BD2A 1DANH 2CHAB 3AAUA 3ATMA 4FUEA 2P95A 1A0JA 3ZVDA 1W11U 4H6SB 2OUAA 9LPRA 4ZROA 1FAKH 2P59A 3RXQA 1T8MA 1ZGVA 1GCTB 4MPUA 4Q7YA 3UR6A 5FAHA 1HAIH 1FN6A 4D8NA 1CA8B 4NA8A 1O5CB 3A88A 2Q6FA 1SQAA 2HOBA 2TGTA 1TGCA 4WF8A 1SVPA 3M3VA 4UDWH 1HAGE 1YCPH 3DFJA 3P17H 3GY6A 1O2OA 2BD7A 2LNCA 1VITF 1HJAB 1ELAA 5DP9A 1FPHH 5EU8A 2PW8H 2STBE 1C5YB 3RXMA 4RKOB 1UTNA 3UOPA 3SV9A 1LHCH 1GI7B 1RXPA 1THSH 2Z94A 3RXIA 2TBSA 4J2YB 2XC4A 3F68H 4YT6H 4X1NU 1ESTA 1HAXB 3AW1A 4D76A 3ZZAA 2ZU4A 2F9NA 1NPMA 3SI3H 2FS9A 3HK3B 1O3FA 3A8DA 2GDDA 2R0LA 5J4QA 2B0FA 5T6FA 2W7UA 4FUBA 3MNCA 5EG4A 3NUMA 4AGKA 1SI5H 1SG8B 3A8CA 3GDUA 4CHAB 1VJ9U 1O3HA 4WVPE 3UQOA 5DP7A 3BF6H 3U8RH 5G4BA 1SQOA 3KIDU 3A7YA 3GCHC 3V7TA 2XNIA 3RM0H 3T2NA 3BTHE 3S9CA 5HM9A 1AI8H 1GMHF 3RXHA 1GVLA 3GY2A 3ZZ9A 2IN2A 1ZSLA 3M5OA 1HV7A 1EZUC 2J94A 3P70B 1HJ8A 1OP8A 1P02A 1EUFA 1LPKB 1GI9B 2SGEE 1GBTA 1G36A 1SGFA 1J9CH 1K1NA 1S0QA 1D4PB 1K1IA 5DP8A 2GGVB 1JBUH 1TBRH 1NRSH 1ARBA 2VU8E 1DLKB 2J92A 4TPYA 3SU6A 1A7SA 1TWXB 3FZZA 1BTPA 2PGQB 1Y5AT 1GBAA 1TPOA 1K1OA 1BDAA 3M7TA 5EQSA 1SGNE 2C93B 1MD8A 1TPPA 4HTCH 4CRAA 2OTVA 2FOEA 4BAKB 1EB1H 3ZVEA 2PHBA 2FLBH 4MPWA 2XTTB 1LVBA 3DFLA 3L6PA 1TNIA 2C90B 1TA2A 1P11E 2EI7A 3G01A 1MTNB 3OYPA 1P06A 3BEFB 1C2IA 4FUIA 3SHAH 4LXBH 5DP3A 4M7GA 3FVFB 1T7CA 1HLTH 1NRQH 1O2JA 1CT4E 5L2ZH 1YGCH 3SQHE 2BVSH 3NPSA 1A1RA 1THPB 1EAUA 2R3YA 1KXFA 1AHTH 2HNTC 1GJ4H 3U8TH 1GG6B 1ZJKA 1C5UA 3KL6A 5GDSH 1T4UH 3SU2A 1XKBC 5GIBA 1O5DH 3ATIA 5AHGH 5E8EH 1F0RA 4YESB 1GBLA 1RD3B 2BQ7B 1W13U 3EAJA 3RXVA 4ABBA 3T27A 4JK6A 5EOKA 1P10A 3SUFA 3GICB 5FCRA 1MTSA 2FO9A 5F8TA 1YBWA 2Q6DA 5L2YH 3RMNH 1VGCB 2CMYA 2VVVA 3BTEE 1W14U 4BNRA 1Q2WA 1FMGA 1LKBA 1C1OA 1H1BA 1SQTA 2A1DB 4CRFA 5BRRE 1OYTH 1MZAA 4NCYA 3LGVA 2BYAX 2RG3A 1RJXB 1Z71A 1EPTC 1JXPA 1V2MT 2ZCHP 1Y3YA 2FDAA 3FFGA 1W7XH 2C8ZB 2R2MB 4FUFA 4KTUA 3RXGA 1OS8A 1C2KA 3CS7A 1O35A 1MU6B 1UCYK 2F91A 1SGYE 1GJDB 1K9OE 3UNQA 3A85A 3O8DA 3A86A 2GMTB 2RA3A 3LPRA 1PPGE 2BX3A 4X1RU 2FTLE 3UFAA 4WH6A 1KLJH 1V3XA 3F9HA 1QB1A 1DUAA 2ANWA 2FOCA 1VITG 1OOKB 2C8XB 1RGQA 2G52A 1MQ5A 1GJ9B 5DP4A 4BANB 3BG4C 4CRGA 1MTVA 3BTQE 3HGPA 2BD3A 4WXVA 1CGJE 2Z3DA 4ABDA 1YM0A 1YPJH 1UVPA 1WU1A 1H9LB 1GGDB 2FLRH 3SJOA 1IQIA 1PFXC 3VEQB 3SI4H 3GCTF 3A7XA 2TRMA 1IQGA 2ZHEH 3LU9B 3OU0A 4NA7A 1P12E 5TCAA 2ZU5A 3BTWE 3B23B 1G32B 3MNBA 1ELGA 4ABAA 2P3FH 5HXFA 3L33A 4IMQA 5CMXH 1LVOA 1Y8TA 1O2HA 2OC7A 1KXDA 3SNCA 1GVKB 4ZKOU 2GP9B 1TMUH 4VGCB 1IQMA 1DLEA 3E16B 3IWMA 1XX9A 3MWIU 3SQEE 1DITH 1ELVA 4U32A 3EYDA 1C2EA 1G2MA 3UUZA 2V0BA 1BTWA 3MNSA 1YCPM 1LQDB 1XUFA 1LDTT 2SGAA 4K8YA 5FPYA 2ZFRH 1OX1A 4GVUA 4ZKRU 5I46H 1SLVB 2HVXA 4FU9A 3PTBA 3C1KA 1C1WH 1L1NA 2HWLB 1V2LT 1Z1IA 2D8WA 1O5GH 1TLDA 1KDQB 4O9VA 4AZ2B 1SGDE 4BTUB 1AIXH 3DT0H 4ZMAH 4WMFA 3SUEA 4WXIA 1EZXC 1QJ6B 1C1MA 1Z8JB 4OS4A 3ZV8A 1O3DA 2SNWA 1OP0A 4O3UA 1LO6A 1J17T 6CHAB 2D26C 1AO5A 3BTDE 1EJAA 2BDHA 4INLA 3KQCA 1TALA 2CJIA 2OD3B 4UFEH 2R0KA 1L0ZA 1UTJA 2ANKH 2B8OH 2OLGA 7ESTE 1K21H 2ZA5A 1ZYOA 2VNTA 4D7FA 4ISOA 1QBNA 2P93A 3SV8A 2GCTC 3VGCB 5B6OA 4NFEA 1G3EA 2ZEBA 4GLYA 2F83A 1NFXA 4ISIH 1DPOA 1ELDE 1AVGH 3TK9A 4B2CA 1GJ7B 3LGYA 1MAXA 3EA9A 4HGCA 1HJ9A 1G30B 3RMMH 5C67A 1ZPZA 3MU1A 3D65E 4B1TA 3E8LA 1GCDA 1Q3XA 3U1IB 1UO6A 3MO3A 1O2TA 4K2YA 4D9QA 4AORA 1SB1H 1L1JA 1SFQB 3TK6A 1GMDF 2JKHA 4D7GA 1C1RA 1C9PA 3GDVA 3NZIA 2PUQH 3S7HB 2PFEA 5SGAE 2QAAA 3VPKA 4I33A 1W10U 2Z9GA 1P2MA 1J15A 3JZ2B 2OBQA 2XCNA 1IQLA 3RXBA 3RXFA 1P0SH 2ZDNA 3GCNA 3SUGA 4Y8YA 1BMMH 2A0QB 2ZTXA 1G2LA 1FLEE 2BY8X 2VWNA 1ESBA 2HNTE 2BZ6H 3BG8A 3SGBE 1NESE 3T25A 2XXLA 1SLWB 1D6RA 3RXPA 1LHFH 4JZ1A 4X2YA 1E35B 3TNSA 3RXTA 4X6NA 2YOLA 5DP6A 1ORFA 1Y5UT 1TNJA 2GCHF 1A3EH 3SN8A 3KNXA 1IOEA 4IC6A 3IITA 5H4IB 1PPEE 4MNYA 2FIRH 2ZDVH 3VFEA 1ZZZA 3Q3YA 2A2XH 1TA6A 4XOJA 8LPRA 1GBFA 3ODDA 1V2KT 4DT7B 1CVWH 4OS1A 4Y6DA 4ZHMU 5EQRA 3M37A 1DOJA 1SGFG 1AUTC 3OTJE 2DE9A 3B9FH 2CXVA 4JZDH 1C4V2 1P09A 2XWBI 1WV7H 2ZFQH 2QF0A 1AE5A 3HK6B 1AZ8A 7KMEH 2A4RA 2ZHQH 3RXJA 5JB9S 2FI5E 1V2JT 3RU4D 5TJXA 2BDIA 8GCHF 1WBGB 1ZHPA 3BEUA 1YPKH 2H6MA 3QX5H 4JK5A 1YC0A 1XKAC 2Z7FE 4IN1A 2BD8A 1T8LA 1AMHA 3TU7H 1DWDH 2BD5A 2H9HA 2O8WA 2XBXA 2CV3A 1VR1H 4X8UH 5CHAC 1L4ZA 2H1UA 1A3BH 2BLOA 1AE8H 1XUJA 1TNKA 1HAVA 4X8VH 1TX6A 3O8RA 2A4QA 3SV6A 2O8TA 1E38B 3TITA 3GY4A 2XW9A 1QRXA 3PMJA 3DA9B 2AMPA 1O2MA 1P2IA 1GBBA 4K60A 4AFSA 1UHBA 1W3CA 3LJOA 2Y7XA 2WPKS 1ELFA 1XXDA 1EJNA 3VXFH 5JYIA 1BOQA 2JETC 5CHAB 3M5NA 1PYTC 1PPHE 1YPHC 2TIOA 4K1EA 2FWWA 4F49A 5J4SA 1TAWA 3HKJB 3KQEA 1HAYB 1LPGB 3MU0A 3M7UA 3MFJA 2AERH 1P03A 1BCUH 2D2DA 1EKBB 4DG4A 1T4VH 2P8OB 2GZ8A 4X8SH 4YTAA 2J38A 1EAXA 2F9UA 4CRCA 2FOHA 2ZQ2A 2P94A 1QQUA 1HNEE 2GX4A 1AN1E 4ZAEA 1HGTH 3EE0B 2OQUA 1IQNA 4AOQA 5DP5A 1C2FA 1GL0E 4FUHA 1GG6C 2BLQA 1L1GA 4JZEH 1KSNA 1DFPA 9ESTA 2BVXH 1VCPA 1NU9A 2ZDAH 4OS5A 4AN7A 1P9UA 2FMJA 3RLWH 3RXLA 1QNJA 5CE1A 5FX6A 1EASA 1Y5BT 3BEIB 1GHXH 1UVUH 2Y5GA 2FOFA 3MH4A 4GCHF 2PTCE 4FVBA 6GCHG 5T3HA 4SGBE 3U98H 2ZU2A 1VZQH 1O2KA 1AVWA 1D6WA 1O38A 4Y79A 1O3AA 1HAPH 4DY7B 2UUKB 5C1YA 4WMEA 4DVAU 1MKXH 3D23A 3MU8A 1C1VH 1A5HA 1EP6A 1O2LA 2FOBA 5E2PA 1C5RA 3STJA 2VIOA 3KEEA 3RUOA 1NFUA 4Y76A 1F7ZA 1GJCB 1GCTC 5A8ZA 1AWHB 2GMTC 1CHGA 4XBDA 3U1JB 2CF9H 2BOKA 1BMLA 3NKKA 2QXGA 1GMCF 2WPLS 1BB0B 1ID5H 4I8GA 3LC5A 3TNTA 4CH8B 1P04A 1HAOH 3URDA 3STIA 4WH8A 1C2LA 4MDSA 1PQAA 3E0PB 1FIZA 1P8VC 2ZF0H 2Q6GA 1DDJA 1C1TA 5EPYA 2QGRA 3SHCH 1WUNH 1V2PT 4BAOB 1VCWA 2ANMH 3H7TA 1ETSH 5DKMA 1QA7A 2RA0A 5T6DA 3KCGH 3QN7A 1WTGH 1O33A 1C2GA 1Y3UA 2OCVB 1WSSH 2XRCA 3D49H 1Z6EA 3P8OA 1MCTA 2NU0E 1TFXA 1SBWA 2NWNA 4X2XA 1ANEA 1IQKA 5HMAA 3MO6A 3FAOA 2Y81A 3PYHA 1CSOE 4CHAC 1A2CH 4HFPB 1A5IA 2DE8A 1J14A 3AAVA 1H4WA 2PUXB 3BTTE 1N8OC 3U9AH 1CA0B 3UREA 1TOCB 3ENSB 5AF9H 3UPEA 3ZVFA 3Q76A 1K28D 1Z6JH 1DWCH 2A5KA 2OC1A 1IHSH 4U2WA 1EPTA 4X1SU 2EA3A 3TGJE 5DO4H 5ESBA 4B2BA 1CBWC 3LH3A 3LKWA 3U8OH 1MBQA 1Z1JA 2WPJS 1DWEH 2ZNKH 2ZGBH 2THFB 4ABHA 4FUDA 3TH4H 3A8BA 1EX3A 4O3TA 1C4Y2 3RP2A 1O2RA 2W26A 1LKAA 3K6YA 3RXDA 3BTFE 1GBJA 1YKTA 1XVMA 2G4UA 2GCTB 4BXWA 4TYDA 2TGDA 1UMAH 1OWIA 4FU8A 2TGAA 3SJIA 1FY8E 5DG6A 1C5QA 3FANA 2FYQA 2ASUB 1MH0A 2BDGA 3RC6A 1NO9H 3EA7A 4XBCA 2I6SA 2A4GA 1LVMA 5GCHG 2VIQA 4B76A