2D96A

Solution structure of the death domain of nuclear factor nf-kappa-b p100
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
109
structure length
109
Chain Sequence
GSSGSSGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Death domain of Nuclear factor NF-kappa-B p100
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Nuclear factor NF-kappa-B p100 subunit
total genus 17
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2d96A01
4QOBA 3MOPK 2MN4A 2GF5A 4EWIA 2MS8A 1CWWA 2L6AA 4FH0A 3EZQB 2KM6A 1ICHA 4LWDA 2DBHA 2MPCA 4N1JA 2HM2Q 1Z6TA 1A1WA 2N80A 1UCPA 1E41A 3LQRA 2N83A 4E9MA 2YQFA 2L9MA 2YGSA 4F44A 2MS7A 2N7ZA 2BBZA 2N00A 2OF5A 4P4HI 4ZBWA 2DBDA 1WH4A 2G7RA 2IB1A 4IZ5E 4NQKA 2N1FA 3EZQA 4O9LA 3CRDA 1WXPA 3KATA 1D2ZA 4P4HA 1WMGA 2DO9A 4N1KA 4JQWA 3T6PA 4IZ7B 4D8OA 4O6XA 1DGNA 4IZAB 3CL3A 1D2ZB 2YU0A 3YGSC 2P1HA 4DWNA 4I16A 4F42A 1NGRA 2D96A 4M9SA 1DDFA 3YGSP 2NAQA 2DBFA 4A2WA 2NZ7A 3J63A 4JUPA 4UZ0A 1CY5A 2MB9A 4RHWE 4M9ZA 2LS7A 2LWDA 1YGOA 2M5VA 2NSNA 1PN5A 3J6JA 1E3YA 3MOPA 1N3KA 4O9FA 2A5YB 3MOPG 3LQQA 1A1ZA 2N97A 2BBRA 4M9XA 2B1WA 2DBGA 4N1LA 2O71A 2KN6A 4O7QA 2OF5H 1FADA 1C15A 2F1SA 4A2QA 2VGQA 2LWEA 2YVIA 4RHWA 3QF2A 2A9IA
chains in the Genus database with same CATH superfamily
4QOBA 3MOPK 2MN4A 2GF5A 4EWIA 2MS8A 1CWWA 2L6AA 4FH0A 3EZQB 2KM6A 1ICHA 4LWDA 2DBHA 2XV9A 2MPCA 4N1JA 2HM2Q 1Z6TA 1A1WA 2N80A 1UCPA 1E41A 3LQRA 2N83A 4E9MA 2YQFA 2L9MA 2YGSA 4F44A 2MS7A 2N7ZA 2BBZA 2N00A 2OF5A 4P4HI 4ZBWA 2DBDA 1WH4A 2G7RA 2IB1A 4IZ5E 4NQKA 2N1FA 3EZQA 4O9LA 3CRDA 1WXPA 3KATA 1D2ZA 4P4HA 1WMGA 2DO9A 4N1KA 4JQWA 3T6PA 4IZ7B 4D8OA 4O6XA 1DGNA 4IZAB 3CL3A 1D2ZB 2YU0A 3YGSC 2P1HA 4DWNA 4I16A 4F42A 1NGRA 2D96A 4M9SA 1DDFA 3YGSP 2NAQA 2DBFA 4A2WA 2NZ7A 3J63A 4JUPA 4UZ0A 1CY5A 2MB9A 4RHWE 4M9ZA 2LS7A 2LWDA 1YGOA 2M5VA 2NSNA 1PN5A 3J6JA 1E3YA 3MOPA 1N3KA 4O9FA 2A5YB 2MJMA 3MOPG 3LQQA 1A1ZA 2N97A 2BBRA 4M9XA 2B1WA 2DBGA 4N1LA 2O71A 2KN6A 4O7QA 2OF5H 1FADA 1C15A 2F1SA 4A2QA 2VGQA 2LWEA 2YVIA 4RHWA 3QF2A 2A9IA
chains in the Genus database with same CATH topology
4QOBA 3MOPK 2MN4A 2GF5A 4EWIA 2MS8A 1CWWA 2L6AA 4FH0A 3EZQB 2KM6A 1ICHA 4LWDA 2DBHA 2XV9A 2MPCA 4N1JA 2HM2Q 1Z6TA 1A1WA 2N80A 1UCPA 1E41A 3LQRA 2N83A 4E9MA 2YQFA 2L9MA 2YGSA 4F44A 2MS7A 2N7ZA 2BBZA 2N00A 2OF5A 4P4HI 4ZBWA 2DBDA 1WH4A 2G7RA 2IB1A 4IZ5E 4NQKA 2N1FA 3EZQA 4O9LA 3CRDA 1WXPA 3KATA 1D2ZA 4P4HA 1WMGA 2DO9A 4N1KA 4JQWA 3T6PA 4IZ7B 4D8OA 4O6XA 1DGNA 4IZAB 3CL3A 1D2ZB 2YU0A 3YGSC 2P1HA 4DWNA 4I16A 4F42A 1NGRA 2D96A 4M9SA 1DDFA 3YGSP 2NAQA 2DBFA 4A2WA 2NZ7A 3J63A 4JUPA 4UZ0A 1CY5A 2MB9A 4RHWE 4M9ZA 2LS7A 2LWDA 1YGOA 2M5VA 2NSNA 1PN5A 3J6JA 1E3YA 3MOPA 1N3KA 4O9FA 2A5YB 2MJMA 3MOPG 3LQQA 1A1ZA 2N97A 2BBRA 4M9XA 2B1WA 2DBGA 4N1LA 2O71A 2KN6A 4O7QA 2OF5H 1FADA 1C15A 2F1SA 4A2QA 2VGQA 2LWEA 2YVIA 4RHWA 3QF2A 2A9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QOB A;  3MOP K;  2MN4 A;  2GF5 A;  4EWI A;  2MS8 A;  1CWW A;  2L6A A;  4FH0 A;  3EZQ B;  2KM6 A;  1ICH A;  4LWD A;  2DBH A;  2MPC A;  4N1J A;  2HM2 Q;  1Z6T A;  1A1W A;  2N80 A;  1UCP A;  1E41 A;  3LQR A;  2N83 A;  4E9M A;  2YQF A;  2L9M A;  2YGS A;  4F44 A;  2MS7 A;  2N7Z A;  2BBZ A;  2N00 A;  2OF5 A;  4P4H I;  4ZBW A;  2DBD A;  1WH4 A;  2G7R A;  2IB1 A;  4IZ5 E;  4NQK A;  2N1F A;  3EZQ A;  4O9L A;  3CRD A;  1WXP A;  3KAT A;  1D2Z A;  4P4H A;  1WMG A;  2DO9 A;  4N1K A;  4JQW A;  3T6P A;  4IZ7 B;  4D8O A;  4O6X A;  1DGN A;  4IZA B;  3CL3 A;  1D2Z B;  2YU0 A;  3YGS C;  2P1H A;  4DWN A;  4I16 A;  4F42 A;  1NGR A;  2D96 A;  4M9S A;  1DDF A;  3YGS P;  2NAQ A;  2DBF A;  4A2W A;  2NZ7 A;  3J63 A;  4JUP A;  4UZ0 A;  1CY5 A;  2MB9 A;  4RHW E;  4M9Z A;  2LS7 A;  2LWD A;  1YGO A;  2M5V A;  2NSN A;  1PN5 A;  3J6J A;  1E3Y A;  3MOP A;  1N3K A;  4O9F A;  2A5Y B;  3MOP G;  3LQQ A;  1A1Z A;  2N97 A;  2BBR A;  4M9X A;  2B1W A;  2DBG A;  4N1L A;  2O71 A;  2KN6 A;  4O7Q A;  2OF5 H;  1FAD A;  1C15 A;  2F1S A;  4A2Q A;  2VGQ A;  2LWE A;  2YVI A;  4RHW A;  3QF2 A;  2A9I A; 
#chains in the Genus database with same CATH topology
 4QOB A;  3MOP K;  2MN4 A;  2GF5 A;  4EWI A;  2MS8 A;  1CWW A;  2L6A A;  4FH0 A;  3EZQ B;  2KM6 A;  1ICH A;  4LWD A;  2DBH A;  2XV9 A;  2MPC A;  4N1J A;  2HM2 Q;  1Z6T A;  1A1W A;  2N80 A;  1UCP A;  1E41 A;  3LQR A;  2N83 A;  4E9M A;  2YQF A;  2L9M A;  2YGS A;  4F44 A;  2MS7 A;  2N7Z A;  2BBZ A;  2N00 A;  2OF5 A;  4P4H I;  4ZBW A;  2DBD A;  1WH4 A;  2G7R A;  2IB1 A;  4IZ5 E;  4NQK A;  2N1F A;  3EZQ A;  4O9L A;  3CRD A;  1WXP A;  3KAT A;  1D2Z A;  4P4H A;  1WMG A;  2DO9 A;  4N1K A;  4JQW A;  3T6P A;  4IZ7 B;  4D8O A;  4O6X A;  1DGN A;  4IZA B;  3CL3 A;  1D2Z B;  2YU0 A;  3YGS C;  2P1H A;  4DWN A;  4I16 A;  4F42 A;  1NGR A;  2D96 A;  4M9S A;  1DDF A;  3YGS P;  2NAQ A;  2DBF A;  4A2W A;  2NZ7 A;  3J63 A;  4JUP A;  4UZ0 A;  1CY5 A;  2MB9 A;  4RHW E;  4M9Z A;  2LS7 A;  2LWD A;  1YGO A;  2M5V A;  2NSN A;  1PN5 A;  3J6J A;  1E3Y A;  3MOP A;  1N3K A;  4O9F A;  2A5Y B;  2MJM A;  3MOP G;  3LQQ A;  1A1Z A;  2N97 A;  2BBR A;  4M9X A;  2B1W A;  2DBG A;  4N1L A;  2O71 A;  2KN6 A;  4O7Q A;  2OF5 H;  1FAD A;  1C15 A;  2F1S A;  4A2Q A;  2VGQ A;  2LWE A;  2YVI A;  4RHW A;  3QF2 A;  2A9I A; 
#chains in the Genus database with same CATH homology
 4QOB A;  3MOP K;  2MN4 A;  2GF5 A;  4EWI A;  2MS8 A;  1CWW A;  2L6A A;  4FH0 A;  3EZQ B;  2KM6 A;  1ICH A;  4LWD A;  2DBH A;  2XV9 A;  2MPC A;  4N1J A;  2HM2 Q;  1Z6T A;  1A1W A;  2N80 A;  1UCP A;  1E41 A;  3LQR A;  2N83 A;  4E9M A;  2YQF A;  2L9M A;  2YGS A;  4F44 A;  2MS7 A;  2N7Z A;  2BBZ A;  2N00 A;  2OF5 A;  4P4H I;  4ZBW A;  2DBD A;  1WH4 A;  2G7R A;  2IB1 A;  4IZ5 E;  4NQK A;  2N1F A;  3EZQ A;  4O9L A;  3CRD A;  1WXP A;  3KAT A;  1D2Z A;  4P4H A;  1WMG A;  2DO9 A;  4N1K A;  4JQW A;  3T6P A;  4IZ7 B;  4D8O A;  4O6X A;  1DGN A;  4IZA B;  3CL3 A;  1D2Z B;  2YU0 A;  3YGS C;  2P1H A;  4DWN A;  4I16 A;  4F42 A;  1NGR A;  2D96 A;  4M9S A;  1DDF A;  3YGS P;  2NAQ A;  2DBF A;  4A2W A;  2NZ7 A;  3J63 A;  4JUP A;  4UZ0 A;  1CY5 A;  2MB9 A;  4RHW E;  4M9Z A;  2LS7 A;  2LWD A;  1YGO A;  2M5V A;  2NSN A;  1PN5 A;  3J6J A;  1E3Y A;  3MOP A;  1N3K A;  4O9F A;  2A5Y B;  2MJM A;  3MOP G;  3LQQ A;  1A1Z A;  2N97 A;  2BBR A;  4M9X A;  2B1W A;  2DBG A;  4N1L A;  2O71 A;  2KN6 A;  4O7Q A;  2OF5 H;  1FAD A;  1C15 A;  2F1S A;  4A2Q A;  2VGQ A;  2LWE A;  2YVI A;  4RHW A;  3QF2 A;  2A9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...