2D97A

Structure of vil-xylanase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
189
structure length
185
Chain Sequence
b'TIQPGTGNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title New methods to prepare iodinated derivatives by vaporizing iodine labelling (VIL) and hydrogen peroxide VIL (HYPER-VIL)
pubmed doi rcsb
molecule tags Hydrolase
total genus 51
structure length 185
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d97A00
1C5IA 3VZKA 1W2UA 3B5LB 1ENXA 2NLRA 3MF6A 1HIXA 4S2DA 1KS4A 3WP4A 2QZ2A 3VZMA 1UU4A 1H4HA 3AKRA 4XPVA 1H0BA 2VULA 3WQ7A 4XQ4A 2QZ3A 1AXKA 2DCYA 3VGIA 1BCXA 3AMPA 1XNKA 1HV0A 4XQWA 2D97A 1H8VA 3MFAA 3VHPA 2B45X 4S2FA 3RI8A 2JENA 3WP3A 1UU6A 2B46X 3EXUA 1H4GA 2JEMA 3WQ1A 2F6BA 3AKPA 1BK1A 3AKQA 3WQ0A 1BVVA 3M4FA 1UU5A 1M4WA 3VLBB 2D98A 3WR0A 1QH6A 3VZJA 3VHNA 4H7MA 2DCZA 1C5HA 1T6GC 3HD8B 1XNBA 1OA2A 3WP5A 3AMNA 1PVXA 2BWCA 1TE1B 1QH7A 2B42B 4HKWA 4S2HA 3WXPA 3WX5A 3VHOA 1HV1A 1UKRA 1REDA 1XYPA 1XYOA 4IXLA 3RI9A 1XYNA 3AKSA 2NQYA 1OA4A 1REFA 3LGRA 1IGOA 2VUJA 3WY6A 3VZOA 5HXVA 1OLRA 4S2GA 3WT3A 3AMHA 4HK8A 3AMMA 3LB9A 3MFCA 3VZLA 1XNDA 3O7OA 4HK9A 2DFBA 3VL9A 2BW8A 3AMQA 2BVVA 3AKTA 1XNCA 2JICA 3B7MA 1REEA 2VG9A 1KS5A 3VZNA 2DCJA 1YNAA 3MF9A 2Z79A 5EJ3A 4HKOA 1OA3A 4XQDA 2BWAA 3ZSEA 3WP6A 1OLQA 5K7PA 1XXNA 4HKLA 2DCKA 4NPRA 2C1FA 1F5JA 2VGDA 3VL8A 2DFCA 5K9YA 1NLRA 1H1AA
chains in the Genus database with same CATH superfamily
1NCRA 3AYAA 5LK7B 1O3TA 5JCTA 3NMBA 2W1QA 1HRV2 4M3CE 4HANA 1I9RA 2X5IB 2XQXA 4M3CB 3WZ1A 1PZ9A 3VD5A 4TYSA 1SLTA 1C1LA 4OZOA 1OOPA 3VBOC 2YFZA 3TEZA 4DEVA 2ZEZA 2JG9C 3H7YA 4E9KA 4E4SA 1ZBE3 1O3QA 1AR93 2XKOA 3ZXGA 5JI7A 3MICA 5FUPA 2WO2A 3MIHA 3B3QE 1GANA 4DMIA 4ZXEA 4YW1A 1UU6A 4YVSC 2ADDA 4QB6A 2JDHA 4P5YA 1WMXA 4YG0A 5FMOL 4LT5A 4YYOA 1KITA 2ZX0A 2VNVA 5FYCA 1O4TA 2R041 3WUDA 4ET7A 5FWJA 5IVVA 5KHJA 1FX5A 1A6CA 1N1YA 3AKPA 3MIBA 5M0TA 2GH2A 2P1BA 3KVBA 4LO4B 4YW4A 1EUTA 2VM9A 5FZ3A 1UU5A 1TMF1 1ULDA 2GSYA 3BU7A 4A41A 1DLCA 3A0NA 4HN0A 4OVEA 1CAVA 1JW6A 2J1AA 4Q27A 5GALA 2YPJA 1V9U2 1UPIA 3S5QA 5BNNA 3GZUC 2UYAA 4KG0A 1DFQA 2PAKA 3AMNA 3C7OA 1AL23 1RMU3 2D44A 1I5PA 2WA3A 3POYA 2RHPA 3PUQA 3W9AA 2MEV1 1KDMA 3IDEA 2OZJA 3N7MA 3BKZA 5J96B 2R1DA 4D7TA 4X8PA 1L7QA 1QQP2 1TG7A 2JDMA 3M7AA 4XMIA 2VAUA 4UAPA 3TAYA 3BIEA 3K46A 1MS3A 2CTVA 2RS52 2Y6GA 4CDUC 1DQ1A 4YZ3A 3UT0A 4TTGA 4CCEA 1XRUA 3M3QA 4GA9A 2A1XA 3FBYA 4LO8A 4AQSA 2C26A 4V2VA 3WNNA 2C4XA 4HBNA 4LJHA 3PUSA 3KHCA 1V0AA 1UYZA 4S2GA 5A3LA 1COV1 2WUHA 4FXKB 1GP4A 5EIYB 3FC0A 4I09A 3H50A 4Z2AA 3AJYA 3UV9A 2VTXA 1BVP1 1C57A 2BW8A 5FR3A 2BVVA 3TOJA 2AR6A 3OGVA 4MGIE 4COVA 4AI9A 4G4FA 1XNCA 1W2TA 3ZSKA 2WT0A 2A3YA 4MGKE 4HLTA 4B1MA 4FFGA 1CZSA 1FNYA 1ENSA 4R4XA 1RUC1 2GNMA 2W2IA 4KBZA 4QDRA 4YW5A 5A6XA 1X9PA 2ETEA 4LK7A 3USSA 2RS12 5JSPA 4XZPA 4GB31 3HMYA 2PQQA 1WUVA 2JJ6A 4JDOA 2OA2A 4QHBA 5JMOA 2C9KA 3BTYA 2R16A 3PDQA 3T09A 1FT9A 1TME3 1URXA 1VBD3 2RJKA 5H9SA 4OHYA 3U11A 3K3NA 5D8AB 1IHMA 3NWKA 2BOJA 2B9UA 4U2AA 5DQ0A 1OH3A 1EV13 4SBVA 1U0AA 1LAJA 2EAAA 2WS91 3D0SA 5FZ6A 4AFMA 1HQLA 2UURA 4BQXA 4FAHA 2X8KA 3PTRB 2HWD2 3U1XA 2BU9A 3M70A 1QY4A 4O65A 2WZR3 3GZTB 3UKNA 2HKXA 1APNA 1FPN2 1G9FA 1TQ5A 4XFIA 3KV4A 1C8NA 4L2NA 4XQ4A 1LOFC 2QZ3A 3ST7A 5GJ6A 3ZFFB 3AB0A 2E26A 2JDAA 2WAOA 3ZR6A 1SPPA 3X29B 3RZGA 3S30A 4JGZA 5GLWA 2VOTA 3WP3A 3A7QA 3H7JA 1F4HA 1MZEA 2AENA 1AR73 1BBT1 1HN0A 2CSGA 2G9FA 1RUI1 4RSUA 1H8TC 3CQOA 3WUCA 4Q8KA 2VJXA 5JOZA 5JZGB 2IXHA 4DRVA 1YI9A 5F5QA 4EN9B 2B4KA 5F3EA 2RM23 4XTMA 4WVVA 4M4PA 4B29A 5GZEA 4XCBA 4XJZA 2FBEA 3APBA 5D2AA 5ACA3 3K4AA 2I74A 3W20A 5FZEA 4IETA 4A3XA 3G7DA 4N43A 5C6CA 2X09A 3HD8B 3VV1A 5C71A 2GN7A 1CN1A 2BDRA 4IE5A 1ODMA 2XBO3 4Q0QA 3UYJA 1SLBA 1MEC1 5IK7A 1AL0G 1R1A3 4Y3OA 1DLLA 1XB9A 1BEV1 5HCBA 4XBQA 4TN7A 3AVSA 4RHV3 3WHTA 3OD0A 4IE4A 4AQ6A 3WW1A 1EY2A 1DZTA 2PLV3 4GAZA 1RMU2 4IXLA 5EWSA 5LB6A 5A70A 4XUPA 1W9TA 3S5AA 2F4LA 1UZYA 3A22A 5CFCB 3T0BA 2BPA2 4HSJA 4ZU5A 5JXHA 2WO7A 4QX2A 3T2TA 3UJQA 3NKTA 1NG0A 4JRLA 5FY7A 4O61A 4FT8A 3D3AA 5LASA 1VRBA 3F2ZA 2ZGKA 2WO3A 1OXCA 3ZFGA 3LB9A 2PXJA 2J1RA 1S0IA 5TSWA 1QOSA 3U78A 3RYKA 1FYUA 1Q8OA 1F15A 3ACLA 4PIYA 5DAXA 3JBG3 1ASJ1 3LEKA 3BODA 3FLPA 1UKGA 3HNMA 3JB4C 3QLQA 2V72A 1WZXA 4A6SA 3ZM8A 1ACCA 3S7IA 3B01A 2JX9A 4F8AA 4F83A 1I1EA 3TBDA 1DZRA 1MS9A 2A5ZA 4XURA 2VUCA 5JOWA 3JXSA 4QPWA 1OBNA 4Y1YA 4BZ4A 2Q30A 1IG0A 3ZSEA 1U5IA 2R071 4GULA 4DEQA 5FQ0B 1IKQA 3JQXA 2GN3A 4NWWA 1S2BA 5FZCA 1IQAA 4YZ2A 2VQUA 1UN1A 3RS6A 1SCSA 1VJ2A 2GNBA 2QJVA 2QQOA 4Y1VA 1B35C 3DXTA 2QDNA 5K0UC 2YC0A 5IVCA 1VBE3 3C7FA 1TME2 1VBD2 5FXVA 1UIKA 5FMBA 1CAWA 5FYZA 1GOGA 4K21A 4X6QB 1NA1A 2P3IA 3LOIA 3ZYRA 4GWMA 2KXLA 4E4DX 3JD73 1GP5A 3W59A 3LOBA 4PLMA 3GBGA 3WDUA 4QQHA 1H8VA 4RFRB 2FDGA 3KWVA 1RUJ3 2XHKA 4ASKA 1SQ4A 2D3PA 1OQEA 1CIWA 3OY8B 1ND3A 5KHHA 4JTNA 1JI6A 1O59A 2ZGLA 4JQRA 1K5MC 1YQ5A 4KWUA 5AVAA 5CFDA 1MS5A 1AX1A 2A6VA 2VOVA 3I54A 4NOTA 1LOGA 4Q4X3 3VDDA 4AI8A 4DS0A 5JOXA 4LQRA 4FXGB 5T5LA 2EIEA 1A78A 5DMYA 3O0WA 4PQ9A 3BTAA 4EV0A 5F7UA 5KR7A 2CGOA 1U5XA 2P3JA 4XJ9A 2WAAA 1AR72 2Y0OA 1UMHA 1POV3 2ZEWA 4RGKA 4RQPA 4XMAA 3WDXA 3NJXA 3WR0A 5H9QA 3AL5A 4KWJA 3POBA 3POSA 1PMJX 2RM22 1C5HA 1SFPA 4AHYA 1D2QA 1GWMA 2R063 5C4WB 4LE3A 2ADEA 5ACA2 4QB1A 2FDFA 3V65A 1UW8A 3RZZA 3VBUA 4CSWA 4META 2E51A 2D6OX 3KQ4B 4S2HA 4LUKA 4Y1UA 1RUH1 2GC1A 4CCMA 4YVWA 2LALA 1UNBA 4CCCA 3T4VA 1R093 1C8M1 1PO23 5H9RA 3AKSA 4CUGA 2ZKNA 1R1A2 2NQYA 4BPZA 3DXUA 3GZAA 1W6NB 3ZSJA 1AYN3 4HSLA 1LULA 5L7OA 2VUJA 3LQCA 4RHV2 1GZCA 2WNUA 4GJZA 3VBSC 1LU2A 2HWB1 1WW4A 3B69A 3WY6A 4D6SA 5J1XA 4WVWA 2FDHA 1GFF2 2IVIB 3POIA 2VW0A 5IWFA 2XL7A 2ARCA 4FOWA 2VTFA 4I3GA 4D3WA 4YZ4A 5A6QA 5CG8A 4JDNA 5JLVA 3SMHA 1OKQA 1TNFA 4XUQA 2AACA 3S7EA 2I07B 4D94A 4XIKA 5FZGA 1BYHA 4JVAA 2W94A 4WZCA 3ORJA 3QOPA 1BQPA 3S6PA 1Z7S2 5HV0A 1OUSA 4PIXA 4Y5TA 3ZR5A 4AW7A 2I45A 1RUF1 2HBUA 5FPAA 1ZRFA 1QJX3 5CKNA 1E5IA 3JU9A 4MLOA 3UESA 3KQRA 1IZ3A 3K2OA 1RB8G 3CKHA 1DYKA 4DFSA 3B9CA 3H42B 3JBG2 1AR61 1ZRRA 1LGNA 3N9OA 3QH7A 4H2AA 1UX6A 3ZPYA 3FN9A 5C9AB 2BWAA 2E7TA 4GMP3 4QB2A 2V5DA 5A7QA 1YYNA 4O7XA 5FY9A 4BQ3A 5CFDB 2H6BA 2ENRA 5K8SA 5A80A 4JQTA 1SBEA 5IVEA 3O1VA 2WIIB 4FPHA 3TYJA 5SV5A 4Q5OA 5F2WA 5DUVA 3H1WA 1MACA 1YIPA 4LNVA 3MF6A 4IGPA 3VDAA 3RJRA 2HWF1 2AEYA 2ZHKA 3PU3A 4C91A 5FY8A 1JXNA 1YHFA 2BFUL 1JYXA 2ZPXA 1QXJA 1YQ6A 4DNYA 4PQQA 2NYYA 4MOAA 2ZGMA 4XDPA 3CEWA 4H14A 3HVDA 3IIIA 3N7LA 3OBRA 4IV1C 1A3KA 3NNFA 4J6GA 1UU4A 1RUG3 2FCUA 1H4HA 5HXMA 1UY4A 4BMEA 1AYM2 5A33A 1H6YA 1VBA3 2EVXA 4QWNA 3HBKA 1X7NA 3J9SA 5BNOC 5C3QA 3AXDA 3MFAA 4FSJA 1UY3A 3FHQA 4ISQA 1G9CA 3JD72 3OGGA 3LFMA 3CIHA 1WCKA 4XBLA 4XFHA 1J83A 1GYKA 1J58A 3WQ1A 1RINA 3T2PA 5L7OB 2BERA 1PIV3 3OYWA 3RPQA 4KNCA 3AVRA 5DG2A 3WSOA 4DXRA 4KU7A 2GP3A 4DPNA 4MADA 2WT2A 2TEPA 3ME2A 4EWDA 4N8MA 3VLBB 1UOJA 1VR3A 1PO12 5F5IA 2E63A 1NCQB 4FOVA 2R1BA 4XETA 4CEYA 3VD4A 1QH6A 4IV3C 4JZRA 3VZJA 4ZZ8A 3VHNA 3I59A 2XVGA 3E5XA 4IUGA 1ZZBA 4CP9A 5ABJB 1DCSA 1QF3A 4IEOA 5FXXA 4K7JA 2VPVA 1QWRA 2G1MA 5L9VA 3DPRB 4HVRA 5T5JA 2VQ0A 2ZGRA 3L9JT 4INDA 4P5HA 4RS5C 5J98B 3WX5A 2E53A 4JTOA 4CU6A 4J1XA 4AVVA 2XJRA 5J7MA 3P6BA 1OVPA 3POFA 4Q4W3 5F32A 2JDYA 4LBKA 4NIHA 5CKQA 2TUNA 5C3RA 1RUD3 5GZDA 4Y4RA 1RVF2 2VW2A 2W95A 2FDKA 1MS1A 3LEIA 4JDMA 4PLOA 2VZUA 3VBHC 3W21A 4AVCA 3PNAA 1OHFA 1DYOA 2DWRA 3NKGA 4D6RA 4KG8A 2V4AA 4NVPA 1HXS1 1W0PA 1AF9A 4WM8C 3ZYBA 1W6QA 4MGYE 3VUOA 3O0VA 1R092 3BGAA 2GMMA 1PO22 4FPEA 4B8EA 1FATA 3HIFA 3TN93 4LA3A 5KHKA 1F2NA 1XNTA 4CXXA 4NAMA 3KT4A 1LHVA 2W91A 1D4M2 3ZFEA 3MDPA 1XBFA 5CB7A 3PHMA 2W1SA 4LBLA 5A33B 2VNGA 4P9LA 5DDJ2 2YU2A 1UOGA 5T52A 3E97A 3DKWA 1NCRC 2BVBA 2DCJA 1AXYA 4NHLA 2WSUA 4M01A 5KXEA 1OC1A 4YM2A 3POEA 2A3WA 2R49A 4BQWA 4QDQA 2DVAA 5L73A 3RWNA 2PAMA 2OW4A 1PK6C 1Y4WA 4YG6A 4QXHA 3RZMA 3ZMOA 3TB0A 1SLCA 1OOPC 2Q1FA 1PVC3 4NPRA 3PL0A 1W39A 2HLEA 1W2AX 1W8HA 3H3LA 3HWJA 2DBNA 5A7PA 1OF4A 4AFCA 4FPYA 2VVDA 2XQRA 2DBIA 2BP6A 3ZIWA 3MV01 2PHRA 4FTEA 5BY5A 2KA3A 5L19A 3I2JA 3SITA 5FY4A 3E6BA 3C8XA 1Y9MA 3J7HA 4YRDA 2XXZA 3I59B 5A6ZA 1GOHA 3BIWE 3WF0A 4XFGA 1PGW2 1NXD1 4LO7A 5FJKA 4CP9B 2LROA 5E1RA 5C5UA 4YW3A 3SH3A 3ACHA 2PHWA 3E6CC 2ORXA 4FTBA 3NO8A 4GIQA 1MQTB 2H6CA 4NO4A 2HYXA 2DF7A 4CU8A 3IBMA 1C28A 1HB1A 1XOYA 3GDBA 4XQWA 1OD5A 2OPWA 4LO6B 3RI8A 1OLMA 1RUG2 4OMCA 4DXZA 4COZA 5BNNC 5GZGA 1D0HA 2EAKA 4MXWA 1R083 5GLTA 2YDEA 2P3YA 4AE2A 4LMFA 2QQUA 2RS33 4PCRA 1HJFA 3R4DB 2WNVB 1W6PB 4E8CA 4B1LA 2HJIA 3OBTA 2V4VA 2QBXA 3BTZA 4B4RA 1UL9A 4UT5A 4AI2A 2UY8A 5E88A 1X8EA 1NQDA 5FZOA 2AREA 3P3NA 1HRI1 1L7RA 1W8NA 3OSDA 2RMU1 4MVTA 2JIJA 1AHSA 2XJUA 1NX9A 3OEBA 4QPGA 2YBSA 3AP6A 4Q4V1 3ZFEB 1J1LA 2VQAA 4WVMA 5F5AA 3D4KA 1R1ZA 3SKJE 4CEWA 2GNTA 3JUUA 1QDCA 2BWCA 2B42B 5F1RA 1RIRA 1QJY3 1GQHA 1SDDB 3MPBA 4IEQA 4W4ZA 2D5HA 4A42A 5T54A 1KJRA 3VBRC 5FZBA 1YCIA 2GC0A 4CDXB 4CDQA 2ZMKA 4B3NA 1CPNA 2VVFA 4CU7A 4Q1RA 1GBGA 2N7GA 2HH9A 3N9QA 1OA4A 5LBBA 3WHUA 1ULCA 1DQ2A 4X8NA 1W8FA 3LZZA 4Z92B 4R9AA 4ATEA 3ZN5A 3NV2A 1MS8A 1AUYA 4XAEA 1O3RA 4Q4W2 5FZHA 1VAKA 2ZMLA 4D7SA 3LAGA 4RL7A 5A32B 1RUD2 1DGWA 1ZX5A 3DN7A 3WCSA 1W03A 4DOUA 2RV9A 4RFT0 2X5IA 2O8OA 2WINB 1VRH1 1LGCA 1IG3A 1S4CA 5JMCA 3ACFA 2OQ6A 3DL3A 3CF6E 1QJU1 2XG3A 5DAWA 5A3NA 2CAUA 3GM8A 5I8TA 3F95A 4FAGA 1W8TA 3OOXA 1JYWA 2CAVA 3RMYA 1W8WA 3DCQA 1H2MA 5DXDA 4QX5A 3N9PA 2PYTA 2Z79A 4YZ1A 1EPZA 3MI8A 4AAPA 4AQTA 3N7JA 3NNMA 3I49A 3OUJA 3NAPB 1S0CA 3NSTA 3J7LA 5T55A 2JXAA 4ZHNA 3H8OA 3C7GA 5JVVA 5LWBA 3LSEA 3D82A 3NL1A 1AVBA 1CQ9A 4N53B 3T1LA 3ZO0B 5FPBA 3WG1A 3MIFA 4BYYA 3ZYHA 1SCRA 4JGZC 3IPVB 4AHXA 5CG9A 1W6MA 3VZKA 1HQWA 4BIFA 1VBC2 5EV7A 4CPBA 5FK8A 2ZKLA 2J42A 1W9SA 3P1IA 3L2HA 1W3VA 3HAGA 3O1OA 1J1TA 1WLCA 2IC1A 3MW3A 4WVMB 1N1VA 2Q8EA 5F6KA 5J48A 5F9TA 5FPVA 1FOD1 2Y6LA 4XPVA 3THTA 3LPGA 1ZZ6A 1JYVA 1WW5A 2BNNA 2ZOEB 3EMRA 1HRV1 4GJYA 1AXKA 4NPLA 3KF3A 3MV11 3Q8AA 4Y1XA 2WQ8A 5GKAC 1COV3 5KXDA 5T5PA 4N43C 4Q0PA 3LWCA 2ZBJA 2YFUA 2ILMA 2J1SA 4GQ7A 4TZDA 4KMQA 3DGTA 1MZFA 3OEAA 4ARXA 4GWIA 5A7NA 5T50A 4UBHA 3DECA 4HPKA 3HNBM 1QJFA 4N9HA 2CGPA 1XE8A 4QX3A 4O9EA 1Q8PA 4JV4A 4XYXA 3ZDSA 2JIGA 3J4UH 4PIZA 4GKYA 3ZLIA 3WNPA 2RS32 3P5BA 1RUC3 2P4EA 2EF6A 3VD7A 1DQ4A 4BLJA 3IN9A 4BQ4A 5FYHA 4ES8A 4NIDA 4NPMA 4WV8A 4GB33 1JYTA 4DY5A 4WM7A 2UWAA 5KHGA 3RG0A 3DKQA 1ST8A 4BQ2A 1MS4A 3PJQA 4SLIA 4A45A 2VZVA 1SBDA 1V9U1 3Q8EA 1XU2A 3I2OA 3ZFGC 1JZ7A 1UF2C 1DGRN 4ASMB 4CP1A 4CCLA 4Q8LA 1IOAA 1L7LA 3AYDA 5FO8B 2H0BA 1HKDA 4C8DA 5D8AA 5F3IA 1QJY2 4RR3A 4JC1A 2WN2A 1F5FA 4Z2WA 2O14A 3U0ZA 3LGRA 1QQP1 2WFF2 5LZ6A 3EB7A 2XUMA 2R32A 4AQ2A 2A73B 2TBVA 2RS51 1VIWB 1W04A 5FKCA 3VBFA 4YFZA 4OI0A 1W6MB 1H1MA 2YBKA 2ZZJA 4OLLA 2Q8OA 5FY5A 2W3JA 3O1TA 2ZZQA 1RUE2 4K9SA 3E1F1 4WZFA 4KGGA 2Q4SA 3ZXLA 1C3HA 1AXZA 4AEDC 3AMQA 1UPSA 2WRAA 5BNQA 2BGCA 3ZFFA 1VBB3 4YM3A 2WSVA 1RXFA 2JICA 1RUI3 3HQUA 1D0GA 1F31A 1UWWA 3JB8A 4IL7A 4QXBA 4AWDA 4D69A 2DCTA 1US2A 3FLTA 5I0TA 4P02B 2XUEA 1PX4A 2DVGA 1OQDA 2PHXA 3KLSA 2HWC2 5BNPA 3EJKA 3WDWA 5FP3A 4QXCA 1GMMA 3GXUA 4I0WB 1OA3A 5JZGA 3O1MA 1NA1C 4NRMA 5FY0A 1FMD2 2A7AA 5FXWA 1G9DA 5A7WB 4LBNA 4P9JA 4CRQA 3OUHA 3H8UA 4B7EA 3SLIA 5I8YA 4IE7A 5FFOC 4HPKB 2RS11 4D6QA 4GKXA 4CDWA 4FI9A 5CYYA 1MEC3 1P8JA 1VAVA 4QX1A 1BEV3 2D3SA 5L36A 3B5LB 3OGRA 4QPIB 1ND3C 3V56A 3B93A 3PMEA 4IERA 2QQJA 4QPYA 4QQLA 1HIXA 4V2WA 5EYXA 5I0SA 2LW8A 2G9ZA 3KGLA 1WGPA 2ZCWA 3POJA 1JTZX 3PVNA 3MIEA 3VDDC 3AK0A 4WM7B 4BU2A 5IVFA 1GQPA 4LBMA 4P9GA 4XF4A 3AKRA 4AI3A 2JKXA 4HG6B 5FOBB 5LA0A 1H0BA 5F6LB 4RQPC 3GYDA 3WG3A 2L9LA 4LO5B 4EWEA 5F5CA 4AR2A 2HWD1 1QJZA 3ZX7A 1HV0A 1LHUA 4Z8BA 2D97A 2ID4A 2J22A 1EPWA 2IFWA 2R30A 3I7DA 3JCIA 3LKJA 5CIRA 5CFCA 1FPN1 3BPZA 4FPFA 5I93A 3J7MA 2E7AA 3MLKA 1F8VA 3MEPA 3NV1A 1V6MA 4RR3B 2ZHLA 4K1YA 1GNYA 1SFYA 1JU3A 2JEMA 1ENRA 3OJBA 3QCWA 1J3PA 4GH4B 4TLGA 3E5UA 3VBUC 5G05L 1QNYA 3H3ZA 3AM2A 1V6IA 1RHI2 3AZZA 3NV4A 2Z42A 4AGGA 3R0RA 3VBFB 4AVTA 3GF6A 1YO8A 4YVWC 2B9VA 4ISRA 3WNLA 1WKYA 5HPOA 3ZXEA 4AEKA 3ALQA 4M3CF 5LA2A 4AHZA 4W50A 2P6HA 4L99A 1C4RA 2AGSA 2PHDA 3JQWA 2DYCA 3D5OA 4FP2A 4PI0A 5FK7A 5LW9A 1MZ6A 1DQ5A 2WNUC 3KS7A 3AZYA 3PIJA 1CAUB 2R073 4EZ4A 5JXJA 4YW2A 3K75B 2WJSA 1UYPA 2FQPA 2XWJB 3AYEA 1RITA 4E2GA 1S1AA 2DURA 1SHWB 2XKPA 5CNAA 3MIGA 1ZBE2 2OVUA 1AR92 2V5YA 4QKFA 4E2SA 5BNPB 1K12A 1X82A 4GB32 1CPMA 4B4QA 3ROUA 1CR7A 5LA9A 5FQ0A 4UF0B 1BMV2 5SV8A 1N1SA 2JB8A 5DABA 4OQ8A 5FAXA 2VMHA 4ASLA 2A75A 4UWDA 2PHTA 1YFXA 2JG8C 4W6WA 4HETA 2OZ6A 2VZ1A 2ZAHA 5FCCA 4CDWB 4RGAA 1RMU1 2PHFA 4LULA 5DZFA 5C8CB 2ZX4A 2BNMA 3NJYA 1UMIA 1GZTA 1W8UA 5EP9A 4CTEA 3O1PA 1OD3A 3AMHA 3IDAA 5DAPA 3WF1A 5LATA 2AYHA 5FLIA 4HK9A 4QX8A 5FPZA 4FPLA 5CEHA 3USUA 3U07A 2JKBA 4JGYB 3GCWA 1KXGA 4IEZA 4QKBA 4OHZA 1AL22 4IEXA 3NVCA 2FZ2A 2ZXQA 3OY8A 3H8XA 3H8RA 4AVBA 4YM0A 5FZMA 3CMGA 4DY3A 4AFDA 1VBB2 5JOYA 4XABA 2JDPA 5AFEA 1BKZA 5KBFA 1DP0A 3L2YA 2C24A 3UL2A 3GBFA 5FJHA 1NOVA 4DUXA 1OUXA 3I2KA 3OUIA 3N4MA 3ZN6A 2VNOA 4CUBA 2W1WA 3RDIA 2ZEXA 3RFRA 5DPNA 2VOXA 3RWKX 3WF3A 5LY2A 3PUIA 4BLIA 2GH8A 1J84A 4CXWA 5C4WA 3VBOA 1E5SA 4JKMA 1DF0A 1H2KA 4EN0A 2RE9A 2XPJA 4LE4A 1LOAA 1Z78A 3T08A 4TSVA 1H9PA 1BEV2 2UU8A 1VBD1 3RZKA 2UWCA 2CNAA 1KGYA 1ZZ7A 5F3CA 1RYYA 4EYUA 3LIGA 1WMFA 4CEYC 1W6NA 1Y7BA 4E27A 1OFNA 1CJPA 4EJRA 3ZSMA 4QHZA 1UMZA 1NZCA 3RYRA 4DZGA 2YC2A 1OFSA 4HONA 3PVOA 1CZTA 3H1YA 4XHBA 4AXOA 5B4NA 2RDNA 2FZ1A 2V09A 3AKQA 5EPAA 4OFGA 4Q1PA 4LBQA 1H30A 4A7KA 1RUF3 1LOBA 3OF1A 2QKDA 4GWNA 5DAQA 1Z0HA 1EV12 5A7OA 2PN5A 1AR63 5LK5A 2Y60A 1W90A 3MUY1 4I0AA 4UFLA 3USUB 3GCXA 3WP5A 1WBLA 1AR71 1V6NA 2CDOA 1OPMA 1Y43B 5DUUA 1PVXA 3C3VA 4L8QA 1TE1B 2WZR2 4YW7A 5FZ4A 4NHMA 3CBNA 1AR83 3GBWA 5C9AA 3MZHA 5A7SA 3T0DA 1PGL2 4XDOA 1VMHA 5IFTA 5JIAA 3U10A 1KD7A 2WN3A 4H55A 3WOGA 2LS6A 3EO6A 2XONA 3ZKYA 1JYNA 2HWF3 1SMVA 1I5ZA 2Y6HA 1WW7A 1WW6A 4GALA 1HLCA 3K4ZA 5A3WA 2XOMA 2HEVF 3KMHA 1QOTA 3ZN6B 5LBCA 1QDOA 4URTA 3VKOA 4DXSA 5GZFA 3TRSB 3VZOA 2JE9A 1UCXA 3ZYGA 3ACGA 2VBDA 3VBOB 1YJLA 3WVJA 3AMMA 1M06G 3GHMA 4RHV1 2JG9B 2ARBA 3MBWA 4QGLA 1ND2C 2WZPP 2J1TA 3VL9A 4CA9A 4XEZA 4ATFA 1YJKA 3INAA 1OH4A 3PUAA 2GP5A 4F7ZA 3P3PA 1UY0A 1G7YA 3I4IA 1WMEA 1AJKA 1W0NA 2PTMA 5FZAA 2XBO2 4YVSB 1ZZ9A 2HBTA 4XILA 4QKDA 2P2KA 1JHJA 3WG4A 5JWPA 2JD9A 1KRIA 4MYEA 2VZTA 2Y0IA 3MF9A 4QMAA 2ZGTA 1Z7S1 3AFGA 3OGJA 1HB2A 4KWKA 1SFNA 5C3OA 1TNRA 5C7GA 4HVQA 3KT1A 4NJ4A 2CWSA 4YPJA 2PLV2 4J1WA 1O7FA 2ATFA 2W68A 4IEVA 5HBAA 4Q0UA 1BZWA 1F5JA 3I2HA 5ISLA 3JBG1 1ZYBA 2JDNA 4L11A 2B5HA 3FMGA 4LBQB 4RA0A 1HN1A 2OYZA 3N7KA 1NCQA 1CIYA 2JE8A 4P9YA 1NLRA 4PBOA 3TEXA 3CZUA 3M3CA 1UY1A 4IE0A 4XXPA 3ZMNA 3ILRA 4UXAA 1U12A 3THDA 4FPJA 5ABJA 3AP9A 2WR9A 4Q29A 2RVAA 4S2DA 5A3OA 3KCCA 2C0ZA 3CU7A 5HCFA 4FFFA 3DPRA 2QVSB 4LBJA 4IEWA 4NHXA 4XJUA 1WCSA 4BISA 1S55A 3PMSA 2WA4A 3SH4A 2P34A 4O9GA 1NZIA 4CDUB 4W8JA 1HXS3 1D2SA 2D93A 2DCYA 4BK4A 1YUDA 2WQ4A 3MIDA 2NMNA 4I0BA 4YFWA 3TEYA 4MXVA 2JENA 2W52A 4QPGC 1JN2P 1AYM1 4BH9A 3J8F3 4PDWC 2GAUA 1H4GA 1QXRA 3VD9A 4CEWC 2BZDA 5FYBA 4BA6A 1BK0A 2F6BA 3I2GA 3AXEA 4LEJA 2P6CA 3POWA 1IKPA 1G86A 2XLAA 3C7HA 3WNKA 1GP6A 2IXIA 2HEYF 4CDQC 2OX0A 2OPKA 4XFCA 1GLHA 2E7QA 3N36A 3LEMA 4K8RB 4BJ0A 5J36A 3NNLA 3MLLA 1VBE2 3IT8A 4K20A 2AH2A 1XE7A 2VZSA 1U5YA 1JS9A 3HN1A 2FDJA 2VE1A 2Q8CA 1RUF2 2Q5TA 5KXBA 4XUTA 1WWYA 1PO11 3AL6A 2C6SA 4COYA 4C90A 1K42A 1EAH1 2RR11 2X5IC 4ZS2A 4YSFA 3ETPA 1AR62 5FDBA 4DINB 1SDWA 2A6WA 5L9BA 4UW4A 3OPWA 1YRZA 4LORA 1NLSA 1RUJ2 1F4AA 2GC3A 2QQKA 3BOWA 1AR82 4FPOB 3PJYA 5JSRA 1PNFA 4EE2A 4YLZA 1NYWA 2PELA 3FE5A 4M4RA 4Q26A 4Q4X2 2ZEYA 3GALA 1W0OA 1RVF1 4CU9A 1OLRA 1KDKA 4IE6A 3PLQA 4GWJA 3WT3A 1OVSA 1UZWA 3ATGA 3T1MA 1LOCA 3WEZA 2QQIA 2ZX3A 4JAAA 1LOEA 3ZXAC 3SNMA 2W39A 1XNDA 4Y1ZA 1Q8VA 1MQTA 5FWEA 5IJRA 2ZX1A 1R091 4OZXA 1PO21 1ZBA3 3I2DA 3NNJA 3HJRA 4OUEA 4N90A 4BMBA 2D6MA 4COUA 1REEA 2R062 1NT0A 1WLWA 1YWKA 2OUJA 3VKFC 1NE4A 4F3JA 5FO7B 4CYDA 1OF3A 5E89A 2B7YA 3RYPA 3EHKA 4KL1A 1H8TB 3FBMA 2JB4A 4C1WA 1D4M1 2JD4A 3DYPA 4A7YA 1VAMA 3MLJA 3SISA 1S0GA 1F35A 2WNVA 3LD8A 1W6PA 5JAXA 1HRI3 2A6YA 5IVYA 1OLQA 3O5SA 5DDJ1 3MW2A 1PZ7A 1CGPA 3N9NA 3HT1A 2OKXA 2VQTA 3KCXA 3PVEA 2VMFA 5K0UA 4BQYA 4BXSV 5C3PA 2QDRA 4Q4V3 4XIOA 4COWA 1AYN2 1RJ7A 1GNHA 4K3UA 3SCFA 3CL1A 1MVQA 3PURA 3A0KA 3ITQA 1TVGA 5ANQA 2VMIA 1C5IA 3D0JA 3ZXJA 2AZ5A 3BN6A 1IS3A 3O1SA 4B7KA 2W46A 1N3QA 1NQJA 1X33A 1LTEA 3Q8BA 4E2QA 4Y5SA 5FKBA 2HWE3 2DVDA 4GMP1 1IPSA 1LEDA 2GDFA 2VECA 2Y33A 5JXGA 5KC6A 4CDXA 1QU0A 5F37A 2FDIA 3VGIA 3I2IA 3LA3A 1QJX2 1XU1A 4QAWA 2WFPA 1B09A 1W2NA 1G8WA 1K5JA 2ARXA 4G9SB 3B94A 1YFWA 1LKNA 1ZZ8A 1UO9A 4QU1A 2XL9A 1QJU3 1VB2A 5FP7A 1PM4A 2EALA 4C1XA 1UAIA 5A32A 5JIUA 5CBLA 1D4VB 1JZ2A 4Y22B 2FMDA 4NRQA 4XF0A 4QHOA 4MZUA 1POQA 1M4WA 5T3NA 4PF1A 3J8F2 5FV3A 2VCAA 5C3SA 2JE7A 3I2FA 1V6LA 5JSOA 4I30A 3THPA 4LK6A 1Q8QA 1IQDC 4ZONA 5D8AC 1LHOA 5FYSA 4H7MA 3T2QA 1QEXA 1RUOA 4G3YC 2WLPA 4KI5M 3N35A 5CISA 4XHXA 5HCAA 3NJVA 4LOSA 3NQHA 5FO9B 3AJZA 3E6DA 2VD7A 4P08A 4FO9A 4Q4Y1 3KCYA 4BE3A 2CWMA 4HKWA 3OBZA 4NAOA 3NAPA 4UFJA 1VBA2 1HV1A 2ARAA 2K46A 1TZOA 4RYDA 1REDA 1XYPA 2VZRA 2J1EA 3IMMA 4YW6A 2F17A 2Q1MA 3I3EA 2Q8DA 4A7ZA 3N9LA 4OI2A 4YWAA 3RI9A 3BCWA 4N53A 1Q8SA 3ZFFC 3RZHA 3CJXA 1ONAA 1W8OA 2VY0A 3ABZA 1B35B 3GGLA 1KFUL 5K0UB 1TEIA 3ON7A 1IGOA 1DYPA 3IPVA 4ONUA 2YU1A 4R9BA 1O91A 3ILNA 5E8AA 2OQ7A 3NW4A 1FOD3 1PIV2 2ZHMA 4XFFA 4EROA 5JZGC 5KHIA 1HRV3 2LRPA 1ENQA 2BJSA 4FQZA 4HK8A 1MS0A 2DUPA 4Q4W1 3VZLA 2C5DA 2HEWF 4BOWA 1RUD1 4D0QA 1ULEA 1DGWX 5HCHA 1YQCA 3IDBB 4TWTA 4CP0A 1WCDJ 1GNZA 4JKKA 4AZZA 2YB7A 4FPKA 2QTWB 4UOJA 2EICA 1K5MB 3GJBA 3CLPA 1GKBA 2XJTA 1ZBA2 1JZ8A 1DBNA 2QCSB 2YGLA 1ZRCA 3RSJA 3R05A 1V00A 1UY2A 1GSLA 2R0HA 4NE9A 3FHAA 3K77A 3FHIB 1BXHA 2VZQA 3AP4A 3KF5A 4JHTA 3VL8A 3BI3A 2NPIA 2VCMA 2PA7A 3JZVA 1FV2A 3M1HA 3U75A 3RZLA 5IAVA 4IEYA 2QNKA 3BPSA 4XW3A 1HRI2 5F3GA 1A8DA 1LB2A 4BCUA 2PMWB 4IV1A 1UYYA 4UFHA 5CFCC 1V9U3 1NY72 2BUKA 4AK3A 1VMJA 2NLRA 3FJSA 3TN92 3ASIA 4DUVA 1HQNA 3WDVA 4XACA 4AAXA 2NMOA 1WD3A 2R043 1PNGA 1W2OA 4PLNA 4LA2A 2FCVA 2BEOA 2IXCA 3VZMA 2KD7A 2XVKA 1W6OB 2WC2A 1TMF3 2A70A 3UGHA 1VBC1 1LODA 4XJAA 4UFKA 2BYVE 4EWAA 1BCXA 3AMPA 3UGFA 4DXTA 2HWE2 3VHPA 1LCLA 3W5NA 5FBZA 5FZ9A 5FXZA 3KV9A 3SCGA 4FFIA 4FOYA 4OI1A 3VBSB 1WCQA 1GWLA 1OT5A 2D6PA 2DUOA 4FOQA 1UXXX 3RVHA 2EA7A 2MEV3 3A23A 2RDRA 4I02A 3S57A 5DZGA 1PVC2 3H0OA 4HXCA 1BK1A 3ZYFA 3T0AA 3U14A 5FZ7A 5FUIA 3ZYIB 5C70A 2VBBA 2BQPA 2VR4A 4ZS3A 2ZMNA 3GHNA 1ZM1A 4Y20B 4QM8A 4NMIA 1GZWB 1UZVA 4CCDA 1LHNA 1JYIA 2E9QA 1GICA 3A4UA 4Z82A 4L92A 1F9KA 3ETQA 5CU1A 2YC4A 3WNMA 5A6YA 1PMIA 2J1UA 2VMCA 1YQ2A 3IB3A 1E5RA 2RS31 3KM5A 3MYXA 2FHRA 5J37A 3C7EA 5JR7B 3VBHA 2RS13 2UWBA 2XGXA 4HOOA 5A7WA 2ZGQA 3CDZB 3HQRA 4D7YA 4MSVA 3WW3A 5FMDA 2YXSA 3ZDVA 3KB5A 2FCTA 1E57A 1R082 3NRUA 2EXIA 2IUWA 4CXYA 3HT2A 5F8PA 4NIAA 3QD6A 2BRTA 1BMV1 4YNIA 4Q0VA 4GD4A 4QPIA 1G9AA 5C8WA 2BTVC 5EFUA 5EHDA 4KQ7A 4IV1B 1MPXA 1ODNA 1QJY1 1IS6A 3ZPOA 4LUMA 4BDVB 2WFF1 4HFSA 2HWD3 1LESA 2BNOA 3V0BA 3B00A 1LJ7A 2VC9A 1ULOA 2EXJA 5FZ1A 1UOFA 4UFIA 5CAZA 2ZX2A 2IXJA 5H9PA 1FPN3 4UW5A 2ET1A 4MHRA 5BNOB 1FOD2 2GMEA 4JKLA 4OHVA 4AFAA 4AOCA 1JODA 3G6JB 3RJ2X 4M0NA 2D6KA 1S2EA 1RUE1 2RG4A 1PK6A 2WS93 5C33A 1KQRA 5EJ1B 3ZN4A 5C4WC 3IAPA 3WW2A 1RTVA 4GH4A 5FBJA 3CZJA 3SXWA 1KJLA 1X8MA 2VH9A 3LDKA 1QIQA 1GV9A 3O1UA 2DCKA 2X10A 3WF2A 2VGDA 1LR5A 2GU9A 2HWC1 4AYUA 4UBGA 3QBQA 3Q8CA 4XE9A 3W58A 4IV3B 4XFBA 4HMZA 2ORZA 4V1PA 1FMD1 1BJQA 1NKGA 2JDKA 3OB8A 2YV8A 2W47A 4C0HA 1CAXA 1QHDA 3ZOIA 1JMUB 1BBT3 5AC93 3WDYA 1E5HA 3IAQA 1CAUA 1CESA 2Z69A 4LOTA 4XXAA 5CKMA 4ZY9A 4AG4A 1KS4A 1Y9QA 4RS5B 1LEMA 5LEKA 1X50A 4EN7B 4UYBA 4CE8A 5EZWA 5JR2A 5GLUA 3KV5A 2VL4A 1DHKB 5LRRA 1EP0A 2BV4A 5IUQA 4UF0A 3VBHB 1N3PA 1O4YA 5HI0A 4EZHA 4DQAA 2R042 5KWRA 1RUNA 3UGGA 3MUZ1 4N7IA 4WM8B 5GLVA 3VKLA 1TMF2 2F4PA 1PM7A 2B46X 3EXUA 5C8CA 3A21A 1NLQA 1MVEA 3MHZA 3RRDA 2Y6KA 3PU8A 1ZRDA 3K48A 5C9AC 3CJIA 1K45A 4FPCA 2WO1A 1DZQA 4MGQA 5FYUA 5CFDC 2NZ9A 1DGLA 2K2SA 4QKNA 4XJ8A 3V0BB 2MEV2 4QQ2A 5BUVA 4JGYA 1RHI1 1HW5A 2DCZA 2ZGSA 1NCRB 4YGDA 1T6GC 3AYCA 2WNEA 2VXJA 3BTXA 2EIBA 3FUOA 4K8FA 3VBRA 1G9BA 2GZWA 3H1MA 3KGZA 4LPLA 4AGVA 5ANNA 1OURA 2G19A 4QQOA 1PK6B 3URFA 3K3OA 3K4DA 1CX4A 5BYNA 5IATA 3PVBB 3W5MA 2RJLA 1OOPB 4W6YA 1DU3D 2YZ4A 3VHOA 3VHRA 2X29A 4ZXKA 4OULA 3PTYA 4OHWA 5FZLA 2EIDA 4MG2A 1LNSA 4K1ZA 4Q0SA 2VCCA 4QT6A 1ASJ3 1XYNA 3HN3A 4NN0A 1COV2 2OUHA 3WNOA 4R4ZA 4DIQA 2A71A 3LA2A 3PUHA 1ZBE1 1AR91 2VNRA 4L97A 3EBRA 3KSCA 3SH5A 2XJVA 1R64A 1PGSA 3BUCA 3SCHA 5J3UA 2RDSA 1CAXB 5DUXA 1UIJA 4UW6A 4XF3A 5L7OC 2RDQA 2VZ3A 5FLHA 5A3UA 1V6KA 1JOJA 3SC7X 2A3XA 3CO2A 1H1IA 4YG3A 2D6NA 3TEWA 3O7OA 2XMLA 2CDPA 5DUWA 1RUC2 5JI9A 1DIWA 3AZWA 4OUMA 1Y9GA 2OT7A 1CAVB 1Y3TA 2MHFA 2ZJCA 3MGUA 4X6RB 1NCQC 2E32A 2UY9A 3HPNA 5G04L 5BNNB 4FP3A 1LGBA 5CVRA 1SLAA 3OD4A 4QQPA 3DUIA 5ABJC 3T2OA 1XSQA 2D40A 5EJ3A 5IK5A 5CADA 5BV6A 3DPRC 1X9TA 1GUIA 5IHRA 1AL21 5FLJA 5CA6A 2WS92 1PZ8A 2BGOA 1PX3A 1AZDA 1S0EA 3B9IA 1O5LA 2VXRA 1W05A 2DFCA 3CJIB 1VBB1 4GXLA 1JBCA 2WL1A 5C5TA 1GWKA 1ALYA 1ULFA 4YM1A 4AGRA 3WCRA 2P5BA 1YEWA 2QQNA 3QH6A 3D8CA 1WD4A 4W65A 2OS2A 1ZZCA 1XJAA 2ZS6B 1YLLA 2Y6JA 1UOBA 3FZ3A 2QZ2A 3VBRB 3WW4A 5J09A 2QQWA 1RJ8A 3LCPA 4CVUA 5FZIA 4OMDA 3HR9A 4LIVA 5FZFA 4B4PA 2VBPA 3I3DA 1BBT2 4QGNA 5FRAA 4E8DA 4YZ5A 1RUI2 5AC92 1J3QA 2CGNA 3U37A 1XNKA 2FD8A 3T4HB 4URAA 5DZEA 5I0RA 2Q0AA 1K3IA 3HNYM 4JX0A 3M8LA 3R4SA 1V70A 1VB4A 4KU8A 3HOBA 4XZUG 3RGBA 4XF1A 5E16A 3E5QA 3WQBA 3RQ0A 3ZXDA 4AI0A 1N47A 1QGLA 4Z1VA 1N3OA 1RUH3 1A34A 5LBFA 5IYYA 3LFIA 2YHJA 2JG9A 3IM0A 4D8MA 2KM2A 4FTSA 2WKKA 3ENRA 1CWPA 1C8M3 2D98A 3DYOA 1MEC2 3UNPA 4C0BA 1OQ1A 2W87A 1FAYA 1WCUA 2XJPA 1ZA7A 1TME1 1Z7S3 2KR2A 2Y34A 4IGQA 1US3A 4LLOA 1C1FA 1O4ZA 2XR4A 3EYPA 3ECQA 3O14A 4YVSA 5A3MA 2QQPA 4Q2FA 4ZPIA 2EXHA 1JH5A 2HWB3 3KHBA 1W9FA 4CP2A 5FZ8A 4BK5A 1EV11 1QH7A 3IIAA 1ZREA 2BBAA 2W0XA 3M3EA 4Y24A 5KXCA 3O0XA 1HX6A 2ES3A 5FIXA 1KEXA 1GQGA 2E31A 1XYOA 1MQTC 4HL0A 1VE0A 1ULPA 2WZR1 5FP4A 1SPPB 1AX0A 1NAEA 2LUWA 4P9IA 3VDBA 3AZXA 4P9XA 1SLIA 2JDUA 4I01A 4JGZB 1REFA 1JU4A 5FMCA 1PGL1 4I2OA 2B8MA 2GC2A 2OXBA 3OGSA 2VUAA 2O0OA 1QKQA 2W1UA 4Y26A 5FOJB 2ZGOA 1EYBA 2V73A 2IFRA 4EN6B 4NIGA 1ASJ2 1CZVA 1UXZA 4A3ZA 3LF7A 4AEDA 5AC91 4IEUA 2WNVC 5L9RA 1I3HA 3DEMA 2R6QA 3NV3A 3MFCA 1JYCA 3ELNA 4IESA 2DFBA 1UYXA 3ZIXA 4CDUA 1GZ9A 2DU1A 2DV9A 2RM21 1AYM3 3AKTA 1LECA 3BVCA 3N9MA 4N43B 5ACA1 1WLDA 3VZNA 4PT6A 1AJOA 5LCWL 3KVAA 2R072 5I91A 3BU0A 3D6EA 1JUHA 4R8HA 2Y8KA 3J7NA 3ZFEC 4QDSA 3CHXA 4MV2A 2ZGPA 1YI7A 3GZEA 2VZPA 1STMA 4LIUA 4FCAA 5EXOA 1V6OA 2XBO1 1XXNA 4ZKTB 1UX7A 4CPBD 1R1A1 4CDXC 2AC1A 3GNEA 4AL9A 1JZ6A 4QX7A 2O1QA 5DAVA 2YBPA 5K9YA 2YYOA 4XBNA 5FPLA 1S2KA 3SHRA 1FI2A 1PO13 2GALA 5FYVA 1H1AA 1W9YA 5FMOS 4BQ1A 3DF0A 3R4UA 1EAH3 1XC6A 2PLV1 2NN8A 2RR13 1ENXA 2A6XA 3WF4A 2WZ8A 3VDCA 3N3HA 4AF9A 3WP4A 2EXKA 3ZFGB 5E6HA 1XNAA 4LKSA 1O3SA 1H6XA 3MW4A 2BGPA 3I97A 4NR1A 3T30A 2WYFA 1QXPA 1EUUA 1XE0A 2CV6A 3I8TA 5FYIA 2WBKA 5LA1A 2VZOA 5I8SA 1DG6A 1RVF3 4K40A 4LHNA 4NHKA 4PI2A 4RD7A 3IZOA 3SEPA 3B02A 4H3WA 4PJYA 3KV6A 1W9WA 1WA6X 1PMHX 1AX2A 1G6NA 3CNAA 4XCAA 5FYYA 2AUYA 2YY1A 5DN2A 2DVFA 2Z4FA 3LIHA 4LLFA 4HVOA 4RN5A 4QX0A 4E4ZA 1XQNA 1HDKA 1YQ8A 1X36A 4CZSA 3Q9OA 3WQ0A 2JDZA 3M4FA 3HEIA 2SBAA 3Q8FA 3NAPC 4DB5A 4LKDA 4AEDB 1LOFA 4AI1A 3HQXA 3K51A 3V0AA 4ARYA 3NJZA 1S0FA 4N7UA 5B4XA 4N53C 4XAAA 3WNXA 3ILFA 3FX3A 3LPFA 1RXGA 1D4M3 2MNGA 1YIFA 5FY1A 5LBEA 1A8MA 1RUH2 1XNBA 2Q1ZB 4IQPA 4LR4A 2VCBA 5IK8A 1SBFA 5DDJ3 1H8TA 2Y26A 1C8M2 1CAWB 2VU9A 4MO3M 1Q56A 4XDQA 4BB3A 1NA1B 2D5FA 4KWLA 5FPXA 3R6SA 1VBE1 5GM0A 1WLTA 3M3IA 5IK4A 1GOFA 3NNGA 2YROA 2JG8A 2NM1A 4XUOA 4YARA 3SKVA 2ZABA 3WDTA 2HWB2 1HB4A 4UFMA 4QD2A 1OPOA 2PQSA 5LRSA 3ZYPA 1SG3A 3J26N 4JHZA 4JCKA 1L3JA 3JD71 3MO4A 3WV6A 1LENA 1UQXA 2D7FA 1OMIA 5CZKA 1ND3B 2DUQA 4OUSA 1OSGA 5FZKA 1YFUA 5FPUA 1JZ4A 1ZA4A 5HXVA 1CONA 1RUJ1 3VDDB 4M00A 4TLFA 1AR81 4L0PA 1FXZA 2Y6FA 2DU0A 2QQLA 2Y64A 4A2UA 1POV0 3V64A 2PHLA 5A1AA 2WABA 3BOPA 4Q4X1 4RQPB 4I3PA 4AEJA 1VALA 2K9ZA 1RC6A 4DO0A 3FFZA 3TNPB 1N1TA 1LHWA 5A1LA 1IS5A 1MZ5A 1RGSA 1BLZA 4R52A 4LITA 3O1RA 1POV1 4Y5Z0 1JZ5A 2ZA9A 2CHHA 5FZ0A 3VD3A 4LHLA 4KBBA 4A4AA 3VBUB 2XH6A 5APAA 4HKOA 4FBFA 3LDRA 2XLFA 1LRHA 4NHYA 2R061 4U36A 4K6BA 3TWIA 4Y22A 5D1IA 3WP6A 4IDZA 5K7PA 1JOBA 4Y33A 2E6VA 1FV3A 1VLNA 1SLLA 2HWF2 1IPKA 2J1VA 2WLQA 2XB6C 4HKLA 4YVWB 1UZZA 1DDLA 2C1FA 2RJ2A 2XJSA 5FUNA 2B39A 2P3KA 1WMDA 1W06A 4XC9A 2IWGB 1NUKA 2QQMA 3FL7A 5I0DA 2QUOA 4P9WA 3V0AB 3LSDA 4Q4Y3 2WNUB 1W2UA 2VOKA 2ZHNA 1VPHA 2BOIA 3FUQA 3VKNA 1O5UA 3OCPA 1AYN1 2W5FA 1UD1A 5BPXA 2VOWA 2PAEA 3IMNA 4NWVA 2XHNA 2WYSA 1YC61 1SACA 3HBZA 1H9WA 4LKEA 2XWBB 1EAH2 2RR12 4YGBA 5FYMA 4AVAA 4XUNA 1OKOA 4CCNA 5K4LA 2W08A 2RMU3 2X53S 4L9BA 2PHUA 2Y38A 2JG8B 3O12A 1B35A 1QOOA 5IAXA 3LA7A 3IWZA 4IEPA 1PHMA 2IXKA 5FZDA 2YMZA 4MUVA 4R9DA 3MPPG 4PF5A 1YFYA 4GMP0 1V6JA 1QJX1 2ZGUA 4QGMA 3AC0A 5B2GB 4QXKA 1BVVA 4XOGA 3KD4A 5JUVA 1J59A 1ULGA 2XVLA 5IFPA 5AFBA 4JRAA 1O8SA 4OI4A 4FPGA 2WDBA 2A6ZA 4AHWA 5LY1A 4NROA 2P37A 1S0DA 4YGCA 2HYKA 2MPFA 4R9CA 4P00B 3SEEA 5EYYA 1FNZA 5LEJA 3J8F1 3ES1A 1PGW1 1K5MA 4QPIC 3RMXA 2IZWA 3ZYJB 3ZKUA 4OCTA 4MHUA 2VO5A 1VRH3 2LM3A 2D43A 3WXPA 5FREA 4WM7C 3I3MA 1HXS2 4CUCA 1UKRA 4MH0E 3ACIA 4MGZE 3S0MA 3U4SA 4CCOA 2DDUA 3VB9A 1Q5OA 2VMGA 2BBVA 3DYMA 1KFXL 1CJDA 1QMJA 1RUG1 3IKWA 2EIGA 1T6BX 2ZACA 4UW3A 2D6LX 4W6XA 1VBA1 3SQOA 1VP6A 2YUEA 3RZJA 2GNDA 4PHZA 3BYWA 1CX1A 2XLGA 2WWUA 2OIIA 4LKFA 4XVHA 3BB6A 4RR3C 3QACA 1O6UA 1ND2A 1VBC3 5T5OA 4EQVA 3U4XA 4MX3A 3OYWB 3C2UA 4GH4C 4HZFA 1D7PM 1O8PA 1WA4A 4H7LA 4HT1T 3I3BA 1QNWA 1W6OA 3VBFC 2DTYA 4XFAA 4ES9A 2J7MA 2CU5A 3H9AA 1PIV1 3T3YA 2WT1A 3AFKA 2YGMA 4P14A 3UKTA 4CEYB 2R0FA 3B7MA 1DQ0A 4CUAA 1CVNA 5JDBA 1Q43A 2O8QA 2VTXJ 2W9XA 1KS5A 4OQ9A 5JPMB 4ORFA 3IDCB 4XTPA 2YG0A 3VBSA 1YNAA 1W8ZA 2LTNA 1MR5A 4Z07A 4A44A 5IVBA 3OTFA 1SEFA 2WZEA 4MGTA 4XQDA 3POGA 3UKVA 1S0BA 3AP7A 4AFBA 4BQ5A 4KH9A 3ZVXA 5BNPC 4HN1A 3OG2A 5GZCA 4BWOA 3EQEA 4DRRA 2Z5WA 1ZBA1 2I2SA 4NRPA 3VKMA 2IVJA 1WBFA 2VMEA 4N9IA 4Y20A 1ZVFA 3GJAA 1GZWA 4BXFA 5JXIA 4BM8A 1NE6A 1JOPA 2AEZA 1W6QB 1ZNPA 3UJOA 1GU3A 2E33A 1IS4A 4M0HA 4CDWC 5C8CC 3OPTA 4J25A 3FFQA 3CJIC 4ITCA 2C9AA 2QQVA 4IW3A 4Q4Y2 1NY71 1YXWA 1W99A 5EQUA 1ZRIA 3LE0A 3LEGA 2VULA 3TN91 3WQ7A 3ZSLA 2NP0A 1H2LA 2ERFA 3M2MA 4PDWA 5D21A 3H3UA 2FMYA 4AEMA 5KC5A 4NUBA 4JGYC 2B45X 4S2FA 4Y4YA 4KGQA 4LBQD 5ERLA 2P17A 1JZ3A 3WINE 2G9GA 3I3QA 4LBOA 2WFF3 2XJQA 4LHSA 4A6OA 2RMU2 1DGRA 2X05A 2ZTNA 2HWE1 2CYFA 4MGSA 3ZXKA 1RL3A 3LDBA 3M3OA 1ND2B 1HB3A 4Q4V2 4XF9A 3KZ4C 2VUDA 4ZU4A 3ZXFA 1CD3G 1RUE3 4UI9L 5A3PA 4FQ4A 1XSRA 4BHPA 5BNOA 4IGOA 1PVC1 4LXLA 2WNOA 2SLIA 4CCJA 4YGEA 4CCKA 1QQP3 4LTAA 4M3CA 3THCA 3ES4A 1OA2A 1I6XA 1Q3EA 2RS53 1W28A 5DG1A 3AX4A 2VMDA 4FFHA 2HWC3 2UYBA 1U5ZA 3WG2A 1BHGA 2ZAAA 1SZBA 5FP8A 3WLUA 3FLRA 1FMD3 4AVSA 3FWEA 3RNSA 5EJZB 5I0UA 1T2XA 2WWSA 1S0JA 4FVVA 4PBPA 4QM9A 5BXXA 3KT7A 1HJGA 1OLME 4IV3A 4RGGA 5A1FA 1H2NA 1VRH2 5IVJA 2VW1A 1VMFA 4MXWB 2WQZC 2ET7A 1QJU2 5F2SA 3TNQA 2W92A 2TNFA 4E4HA 4GZ9A 1W3XA 5GLZA 5HV4A 3UETA 3PIGA 3BALA 5FTTC 1R081 4RS5A 5FYTA 5F39A 4BIOA 5A3TA 4EN8B 5FZOB 2H0VA 2YPDA 3OPZA 5FP9A 4ZZ5A 3VN4A 2XDVA 2D3RA 2R7EB 3WD5A 3OBAA 2JECA 2JWPA 2CY6A 4LHKA 4QPGB 4WVZA 4OYUA 2BFUS 5AVPA 2VG9A 1XPWA 3DV8A 4WM8A 1UZ0A 4PDWB 4WBBA 1GR3A 2ZGNA 4ZU7A 4OHXA 1J3RA 4CEWB 3AP5A 1IPJA 1DQ6A 1NXMA 2Z2SB 3AZVA 5IT6A 3UK9A 1JHNA 1LU1A 4NIIA 2QFEA 2DTWA 2G4IA 2VVEA 5IW0A 2PFWA 4TXWA 4CDQB 4DUWA 4QU2A 1RHI3 2CL2A 1QJEA 2K0GA 5JPNB 1OI6A 2DVBA 2GMPA 2QE3A 2WWJA 1JUIA 2IXLA 4XJWA
chains in the Genus database with same CATH topology
1NCRA 3AYAA 1O3TA 5JCTA 1HRV2 4M3CE 4HANA 1I9RA 2X5IB 4M3CB 3WZ1A 1PZ9A 4TYSA 1SLTA 1C1LA 1OOPA 3VBOC 2JG9C 3H7YA 4E9KA 4E4SA 1ZBE3 1O3QA 1AR93 2XKOA 3ZXGA 5JI7A 3MICA 3MIHA 3B3QE 1GANA 4DMIA 4YW1A 1UU6A 4YVSC 4LT5A 5FMOL 4YG0A 4YYOA 1KITA 2ZX0A 1BMV2 1O4TA 2R041 5KHJA 1FX5A 1A6CA 1N1YA 3AKPA 3MIBA 2GH2A 4LO4B 4YW4A 3VKMA 1UU5A 1TMF1 1ULDA 2GSYA 3BU7A 3A0NA 4HN0A 4OVEA 1CAVA 1JW6A 4Q27A 5GALA 2YPJA 1V9U2 1UPIA 5BNNA 3GZUC 2UYAA 4KG0A 1DFQA 2PAKA 3AMNA 1AL23 1RMU3 2D44A 2WA3A 3POYA 3W9AA 2RHPA 2MEV1 1KDMA 3IDEA 2OZJA 3N7MA 5J96B 2R1DA 4D7TA 4X8PA 1QQP2 3M7AA 4XMIA 3TAYA 1MS3A 2CTVA 2RS52 4CDUC 1DQ1A 4YZ3A 1XRUA 3M3QA 4GA9A 3FBYA 4LO8A 4AQSA 4HBNA 4S2GA 5A3LA 1COV1 4FXKB 3FC0A 4I09A 3H50A 3AJYA 3UV9A 1BVP1 1C57A 2BW8A 2BVVA 3TOJA 2AR6A 4MGIE 4COVA 4G4FA 1XNCA 3ZSKA 2WT0A 2A3YA 4MGKE 4HLTA 1FNYA 1ENSA 4R4XA 1RUC1 2GNMA 4YW5A 2ETEA 3USSA 2RS12 5JSPA 4XZPA 4GB31 3HMYA 2PQQA 1WUVA 2JJ6A 4JDOA 2OA2A 4QHBA 2R16A 1FT9A 1TME3 1URXA 1VBD3 2RJKA 5H9SA 4OHYA 3U11A 5D8AB 1IHMA 3NWKA 2B9UA 4U2AA 1EV13 4SBVA 1U0AA 2EAAA 2WS91 3D0SA 4AFMA 1HQLA 2UURA 4FAHA 2X8KA 2HWD2 3M70A 1QY4A 2WZR3 3GZTB 3UKNA 2HKXA 1APNA 1FPN2 1G9FA 1TQ5A 4XFIA 1C8NA 4L2NA 4XQ4A 1LOFC 2QZ3A 3ST7A 5GJ6A 3ZFFB 3AB0A 3X29B 3S30A 4JGZA 5GLWA 3WP3A 3H7JA 1MZEA 2AENA 1AR73 1BBT1 5AC91 4RSUA 2G9FA 1RUI1 1H8TC 4Q8KA 3WUCA 5JOZA 5JZGB 2IXHA 4DRVA 1YI9A 5F5QA 4EN9B 2RM23 4B29A 4WVVA 5GZEA 4XJZA 2FBEA 3APBA 5ACA3 2I74A 4IETA 4A3XA 3G7DA 4N43A 5C6CA 3HD8B 3VV1A 2GN7A 1CN1A 4Q0QA 2XBO3 1SLBA 1MEC1 5IK7A 1AL0G 1R1A3 1DLLA 1BEV1 5HCBA 4XBQA 4RHV3 3WHTA 3OD0A 4AQ6A 3WW1A 1EY2A 1DZTA 2PLV3 4IXLA 1RMU2 5EWSA 1UZYA 5CFCB 2BPA2 4HSJA 4ZU5A 3T2TA 3UJQA 3NKTA 1NG0A 4JRLA 4FT8A 2ZGKA 3ZFGA 3LB9A 1S0IA 5TSWA 1QOSA 3RYKA 1FYUA 1Q8OA 3ACLA 4PIYA 3JBG3 1ASJ1 3BODA 3FLPA 1UKGA 3JB4C 3QLQA 3S7IA 3B01A 2JX9A 4F8AA 4F83A 1I1EA 3TBDA 1DZRA 1MS9A 2A5ZA 5JOWA 4Y1YA 4BZ4A 2Q30A 3ZSEA 1U5IA 2R071 4GULA 5FQ0B 1IKQA 3JQXA 2GN3A 4NWWA 1S2BA 4YZ2A 1IQAA 3RS6A 1UN1A 1SCSA 1VJ2A 2GNBA 2QJVA 4Y1VA 1B35C 5K0UC 2QDNA 2YC0A 1VBE3 1TME2 1VBD2 1UIKA 1CAWA 4K21A 4X6QB 1NA1A 2P3IA 3LOIA 3ZYRA 4GWMA 2KXLA 4E4DX 3JD73 3W59A 3LOBA 4PLMA 3GBGA 4QQHA 1H8VA 1RUJ3 2XHKA 1SQ4A 2D3PA 1OQEA 1CIWA 3OY8B 1ND3A 5KHHA 4JTNA 2ZGLA 4JQRA 5AVAA 1K5MC 5CFDA 3WUDA 4F3JA 1MS5A 1AX1A 2A6VA 2VOVA 3I54A 4NOTA 1LOGA 4Q4X3 3VDDA 4AI8A 4DS0A 5JOXA 4FXGB 5T5LA 1A78A 3O0WA 4PQ9A 3BTAA 4EV0A 3VUOA 2CGOA 1U5XA 2P3JA 4XJ9A 4RQPA 1AR72 2Y0OA 4XMAA 1POV3 3WDXA 3WR0A 5H9QA 4KWJA 3POSA 2RM22 1C5HA 4AHYA 1D2QA 2R063 5C4WB 4LE3A 5ACA2 3V65A 1UW8A 3RZZA 3VBUA 4META 2E51A 2D6OX 4S2HA 4LUKA 4Y1UA 1RUH1 2GC1A 4YVWA 2LALA 1R093 1C8M1 1PO23 5H9RA 3AKSA 2ZKNA 1R1A2 2NQYA 4BPZA 3GZAA 1W6NB 3ZSJA 1AYN3 4HSLA 1LULA 5L7OA 2VUJA 4RHV2 1GZCA 2WNUA 3VBSC 1LU2A 2HWB1 1WW4A 3B69A 3WY6A 4WVWA 1GFF2 2VW0A 2XL7A 4FOWA 4D3WA 4I3GA 5CG8A 4YZ4A 4JDNA 5JLVA 3SMHA 1OKQA 1TNFA 4D94A 3S7EA 2I07B 4XIKA 1BYHA 4JVAA 4WZCA 3QOPA 1BQPA 3S6PA 1Z7S2 4PIXA 4AW7A 2I45A 1RUF1 1ZRFA 1QJX3 3JU9A 4MLOA 3KQRA 1IZ3A 1RB8G 1DYKA 4DFSA 3B9CA 3JBG2 3QH7A 1AR61 1ZRRA 1LGNA 3ZPYA 1UX6A 5C9AB 2BWAA 2E7TA 4GMP3 1YYNA 5CFDB 2H6BA 2ENRA 5K8SA 1SBEA 2WIIB 4FPHA 3TYJA 5SV5A 5DUVA 3H1WA 1MACA 1YIPA 4LNVA 3MF6A 3RJRA 2HWF1 2ZHKA 4C91A 1JXNA 1YHFA 2BFUL 2ZPXA 1QXJA 4DNYA 2NYYA 2ZGMA 3CEWA 4H14A 3N7LA 4IV1C 3OBRA 1A3KA 4J6GA 1UU4A 1RUG3 1H4HA 4BMEA 1AYM2 5A33A 1VBA3 2EVXA 1X7NA 3J9SA 5BNOC 3AXDA 3MFAA 4FSJA 4ISQA 1G9CA 3JD72 3OGGA 1WCKA 4XBLA 4XFHA 1GYKA 1J58A 3WQ1A 1RINA 5L7OB 1PIV3 3OYWA 3RPQA 4KNCA 5DG2A 4KU7A 4DPNA 2WT2A 2TEPA 3ME2A 4EWDA 3VLBB 1VR3A 1PO12 2E63A 1NCQB 4FOVA 2R1BA 4XETA 4CEYA 1QH6A 4IV3C 3VZJA 3VHNA 3I59A 2XVGA 3E5XA 1ZZBA 5ABJB 1QF3A 4IEOA 4K7JA 2VPVA 1QWRA 3DPRB 4HVRA 5T5JA 2VQ0A 2ZGRA 3L9JT 4INDA 4P5HA 4RS5C 5J98B 3WX5A 2E53A 4JTOA 4J1XA 4AVVA 2XJRA 5J7MA 4Q4W3 4LBKA 2TUNA 1RUD3 5GZDA 1RVF2 2VW2A 1MS1A 4JDMA 3VBHC 4PLOA 4AVCA 3PNAA 1OHFA 2DWRA 3NKGA 4KG8A 4NVPA 1HXS1 1W0PA 1AF9A 4WM8C 1W6QA 4MGYE 3O0VA 1R092 4FPEA 2GMMA 1PO22 4B8EA 1FATA 3HIFA 3TN93 4LA3A 5KHKA 1F2NA 3KT4A 1LHVA 1D4M2 3ZFEA 3MDPA 5CB7A 3PHMA 4LBLA 5A33B 2VNGA 4P9LA 5DDJ2 5T52A 3E97A 3DKWA 1NCRC 2BVBA 2DCJA 1AXYA 4NHLA 2WSUA 4M01A 5KXEA 4YM2A 2A3WA 2R49A 2DVAA 5L73A 3RWNA 2PAMA 2OW4A 1PK6C 4YG6A 3ZMOA 3TB0A 1SLCA 1OOPC 1PVC3 4NPRA 1W39A 3HWJA 4AFCA 4FPYA 2VVDA 3ZIWA 2PHRA 4FTEA 5BY5A 2KA3A 5L19A 3SITA 3E6BA 4YRDA 3I59B 3BIWE 4XFGA 1PGW2 1NXD1 4LO7A 5E1RA 4YW3A 3SH3A 4FTBA 2PHWA 3E6CC 3NO8A 4GIQA 1MQTB 2H6CA 4NO4A 2DF7A 3IBMA 1C28A 4XQWA 1OD5A 4LO6B 3RI8A 1RUG2 4DXZA 4COZA 5BNNC 5GZGA 1D0HA 2EAKA 4MXWA 1R083 5GLTA 2YDEA 4AE2A 2RS33 4PCRA 3R4DB 2WNVB 1W6PB 2HJIA 3OBTA 4B4RA 1UL9A 4AI2A 2UY8A 5E88A 1X8EA 1NQDA 2AREA 3P3NA 1HRI1 4MVTA 2RMU1 1AHSA 2XJUA 4QPGA 4Q4V1 3AP6A 3ZFEB 1J1LA 2VQAA 4WVMA 3D4KA 1R1ZA 4CEWA 2GNTA 3JUUA 1QDCA 2BWCA 2B42B 5F1RA 1RIRA 1QJY3 1GQHA 4IEQA 3MPBA 2D5HA 5T54A 1KJRA 3VBRC 1YCIA 2GC0A 4CDXB 4CDQA 2ZMKA 4B3NA 1CPNA 2VVFA 4Q1RA 1GBGA 2N7GA 1OA4A 3WHUA 1ULCA 1DQ2A 4X8NA 3LZZA 4Z92B 4R9AA 4ATEA 3ZN5A 3NV2A 1MS8A 1AUYA 1O3RA 4Q4W2 1VAKA 2ZMLA 4D7SA 3LAGA 4RL7A 5A32B 1RUD2 1DGWA 1ZX5A 3DN7A 3WCSA 4DOUA 4RFT0 2X5IA 2O8OA 2WINB 1VRH1 1LGCA 5JMCA 3DL3A 3CF6E 1QJU1 2XG3A 2CAUA 5I8TA 4FAGA 2CAVA 3RMYA 5DXDA 1H2MA 4QX5A 2PYTA 2Z79A 4YZ1A 1EPZA 3MI8A 4AQTA 3N7JA 3NAPB 1S0CA 3NSTA 5T55A 2JXAA 5JVVA 3LSEA 3D82A 3NL1A 1AVBA 1CQ9A 4N53B 3T1LA 3ZO0B 3WG1A 3MIFA 4BYYA 1SCRA 4JGZC 3IPVB 4AHXA 5CG9A 1W6MA 3VZKA 1HQWA 4BIFA 1VBC2 5EV7A 2ZKLA 3L2HA 3HAGA 1J1TA 1WLCA 2IC1A 3MW3A 4WVMB 1N1VA 5J48A 5F6KA 5F9TA 1FOD1 4XPVA 3THTA 1ZZ6A 1WW5A 2BNNA 2ZOEB 1HRV1 1AXKA 4Y1XA 5GKAC 1COV3 5KXDA 5T5PA 4N43C 4Q0PA 3LWCA 2ZBJA 2ILMA 4GQ7A 4TZDA 3DGTA 1MZFA 5T50A 4UBHA 4HPKA 2CGPA 4N9HA 1XE8A 4O9EA 1Q8PA 4JV4A 4XYXA 3ZDSA 3J4UH 4PIZA 4GKYA 2RS32 1RUC3 2EF6A 1DQ4A 4BLJA 3IN9A 4ES8A 4WV8A 4GB33 4DY5A 4WM7A 2UWAA 5KHGA 3RG0A 1MS4A 3PJQA 4SLIA 1SBDA 1V9U1 1XU2A 3ZFGC 1UF2C 1DGRN 4ASMB 4CP1A 4Q8LA 1IOAA 3AYDA 5FO8B 2H0BA 1HKDA 5D8AA 1QJY2 4RR3A 4JC1A 1F5FA 4Z2WA 3U0ZA 3LGRA 1QQP1 2WFF2 2XUMA 2R32A 4AQ2A 2A73B 2TBVA 2RS51 1VIWB 3VBFA 4YFZA 4OI0A 1W6MB 1H1MA 2ZZJA 4OLLA 2Q8OA 2ZZQA 1RUE2 4K9SA 4WZFA 3ZXLA 4KGGA 2Q4SA 1C3HA 1AXZA 4AEDC 3AMQA 1UPSA 5BNQA 2BGCA 3ZFFA 1VBB3 4YM3A 2WSVA 2JICA 1RUI3 1D0GA 1F31A 4IL7A 3JB8A 4AWDA 4D69A 2DCTA 3FLTA 5I0TA 3KLSA 2DVGA 1OQDA 2PHXA 2HWC2 5BNPA 3EJKA 3WDWA 4I0WB 5JZGA 1OA3A 1NA1C 1FMD2 2A7AA 1G9DA 4LBNA 4P9JA 4CRQA 3H8UA 4B7EA 3SLIA 5I8YA 5FFOC 4HPKB 2RS11 4GKXA 4CDWA 1MEC3 1VAVA 1BEV3 2D3SA 5L36A 3B5LB 4QPIB 1ND3C 3V56A 3B93A 3PMEA 4IERA 4QPYA 5I0SA 4QQLA 1HIXA 5EYXA 3KGLA 1WGPA 2ZCWA 1JTZX 3PVNA 3MIEA 3VDDC 3AK0A 4WM7B 4P9GA 4LBMA 4XF4A 3AKRA 4AI3A 5FOBB 1H0BA 5F6LB 4RQPC 3GYDA 3WG3A 4LO5B 4EWEA 2HWD1 1QJZA 3ZX7A 1HV0A 1LHUA 4Z8BA 2D97A 3LKJA 1EPWA 2IFWA 2R30A 3I7DA 3JCIA 5CIRA 5CFCA 5I93A 1FPN1 3BPZA 4FPFA 2E7AA 3MLKA 1F8VA 3MEPA 3NV1A 1V6MA 4RR3B 2ZHLA 4K1YA 1SFYA 2JEMA 3OJBA 1ENRA 3QCWA 1ZREA 1J3PA 4GH4B 3VBUC 3E5UA 1QNYA 3H3ZA 3AM2A 1V6IA 1RHI2 3AZZA 3NV4A 2Z42A 4AGGA 3R0RA 3VBFB 4AVTA 3GF6A 1YO8A 4YVWC 4ISRA 3ZXEA 4AEKA 3ALQA 4M3CF 4AHZA 4L99A 1C4RA 2AGSA 2PHDA 3JQWA 2DYCA 3D5OA 4FP2A 1MZ6A 1DQ5A 2WNUC 3KS7A 3AZYA 1CAUB 2R073 4YW2A 2WJSA 2FQPA 2XWJB 3AYEA 1RITA 4E2GA 1S1AA 2DURA 2XKPA 5CNAA 3MIGA 1ZBE2 2OVUA 1AR92 2V5YA 4E2SA 5BNPB 1X82A 4GB32 1CPMA 4B4QA 3ROUA 1CR7A 5FQ0A 5SV8A 1N1SA 5FAXA 2VMHA 4ASLA 2A75A 2PHTA 1YFXA 2JG8C 4W6WA 4HETA 2OZ6A 2ZAHA 5FCCA 4CDWB 4RGAA 1RMU1 2PHFA 4LULA 5DZFA 5C8CB 2ZX4A 2BNMA 4CTEA 3AMHA 2AYHA 5FLIA 4HK9A 5FPZA 4FPLA 3USUA 3U07A 2JKBA 4JGYB 1KXGA 4IEZA 4OHZA 1AL22 4IEXA 3NVCA 2FZ2A 3OY8A 4AVBA 4YM0A 4DY3A 4AFDA 1VBB2 5JOYA 5AFEA 1BKZA 5KBFA 3L2YA 3UL2A 3GBFA 1NOVA 3N4MA 3ZN6A 2VNOA 3RDIA 2VOXA 4BLIA 2GH8A 5C4WA 3VBOA 1DF0A 1H2KA 4EN0A 2RE9A 2XPJA 4LE4A 1LOAA 1Z78A 4TSVA 1H9PA 1BEV2 2UU8A 1VBD1 2UWCA 2CNAA 1ZZ7A 1WMFA 4CEYC 1W6NA 1Y7BA 4E27A 1OFNA 1CJPA 4EJRA 3ZSMA 1UMZA 1NZCA 3RYRA 4DZGA 1OFSA 3PVOA 3H1YA 4XHBA 4AXOA 2FZ1A 2V09A 3AKQA 4OFGA 4Q1PA 4LBQA 1H30A 4A7KA 1RUF3 1LOBA 3OF1A 2QKDA 4GWNA 1Z0HA 1EV12 2PN5A 1AR63 5LK5A 4I0AA 3USUB 3WP5A 1WBLA 1AR71 1V6NA 1OPMA 1Y43B 5DUUA 1PVXA 3C3VA 4L8QA 1TE1B 2WZR2 4NHMA 1AR83 3GBWA 5C9AA 1PGL2 5JIAA 3U10A 1KD7A 4H55A 3WOGA 3EO6A 2HWF3 1SMVA 1I5ZA 1WW7A 1WW6A 4GALA 1HLCA 2HEVF 3KMHA 1QOTA 3ZN6B 1QDOA 4URTA 3VKOA 5GZFA 3TRSB 3VZOA 2JE9A 1UCXA 3ZYGA 3VBOB 1YJLA 3WVJA 3AMMA 1M06G 3GHMA 4RHV1 2JG9B 2ARBA 4QGLA 1ND2C 2WZPP 3VL9A 4XEZA 4ATFA 1YJKA 3INAA 4F7ZA 3P3PA 3I4IA 1G7YA 3WDUA 1WMEA 1AJKA 2PTMA 2XBO2 4YVSB 1ZZ9A 4XILA 2P2KA 3WG4A 5JWPA 1KRIA 4MYEA 2Y0IA 3MF9A 4QMAA 2ZGTA 1Z7S1 3AFGA 3OGJA 4KWKA 1SFNA 1TNRA 4HVQA 3KT1A 2CWSA 2PLV2 4J1WA 1O7FA 2ATFA 2W68A 4IEVA 5HBAA 4Q0UA 1BZWA 1F5JA 3JBG1 1ZYBA 4L11A 2B5HA 3FMGA 4LBQB 4RA0A 2OYZA 3N7KA 1NCQA 4PBOA 4P9YA 1NLRA 3M3CA 4XXPA 3ZMNA 3ILRA 4UXAA 1U12A 4FPJA 5ABJA 3AP9A 4Q29A 4S2DA 3KCCA 2C0ZA 3CU7A 5HCFA 3DPRA 2QVSB 4LBJA 4IEWA 4XJUA 1WCSA 1S55A 3PMSA 2WA4A 3SH4A 2P34A 4O9GA 4CDUB 1HXS3 1D2SA 2D93A 2DCYA 1YUDA 2WQ4A 3MIDA 2NMNA 4I0BA 4YFWA 4MXVA 2JENA 2W52A 4QPGC 1JN2P 1AYM1 4BH9A 3J8F3 4PDWC 2GAUA 1H4GA 1QXRA 4CEWC 4BA6A 2F6BA 3AXEA 4LEJA 3POWA 1IKPA 1G86A 2XLAA 2IXIA 2HEYF 4CDQC 2OPKA 4XFCA 1GLHA 2E7QA 3N36A 5J36A 3MLLA 1VBE2 3IT8A 4K20A 2AH2A 1XE7A 1U5YA 3HN1A 1RUF2 2Q5TA 5KXBA 4COYA 1PO11 4C90A 1EAH1 2RR11 2X5IC 4YSFA 1AR62 5FDBA 4DINB 1SDWA 2A6WA 4UW4A 1YRZA 1NLSA 1RUJ2 2GC3A 3BOWA 1AR82 4FPOB 3PJYA 5JSRA 1PNFA 4YLZA 1NYWA 2PELA 3FE5A 4Q26A 4Q4X2 3GALA 1W0OA 1RVF1 1OLRA 1KDKA 3PLQA 3WT3A 3ATGA 3T1MA 1LOCA 2ZX3A 4JAAA 1LOEA 3ZXAC 3SNMA 2W39A 1XNDA 4Y1ZA 1Q8VA 1MQTA 2ZX1A 1R091 4OZXA 1PO21 1ZBA3 3I2DA 4N90A 4BMBA 2D6MA 4COUA 1REEA 2R062 1WLWA 1YWKA 2OUJA 3VKFC 1NE4A 5FO7B 4CYDA 5E89A 2B7YA 3RYPA 3EHKA 4KL1A 1H8TB 3FBMA 4C1WA 1D4M1 2JD4A 4A7YA 1VAMA 3MLJA 3SISA 1S0GA 2WNVA 1W6PA 5JAXA 1HRI3 2A6YA 1OLQA 3O5SA 5DDJ1 3MW2A 1PZ7A 1CGPA 3HT1A 3KCXA 3PVEA 5K0UA 2QDRA 4Q4V3 4XIOA 4COWA 1AYN2 1RJ7A 1GNHA 4K3UA 3SCFA 3CL1A 1MVQA 3A0KA 2VMIA 1C5IA 3D0JA 3ZXJA 2AZ5A 1IS3A 4B7KA 1N3QA 1NQJA 1X33A 1LTEA 4E2QA 2HWE3 2DVDA 4GMP1 1LEDA 2GDFA 2VECA 5KC6A 4CDXA 1QU0A 3VGIA 3LA3A 1QJX2 1XU1A 2WFPA 1B09A 1G8WA 2ARXA 4G9SB 3B94A 1YFWA 1LKNA 1ZZ8A 2XL9A 1QJU3 1VB2A 4C1XA 2EALA 5A32A 5JIUA 1UAIA 5CBLA 1D4VB 4Y22B 2FMDA 4XF0A 4MZUA 1M4WA 5T3NA 3J8F2 5JSOA 2JE7A 1V6LA 4I30A 3THPA 1Q8QA 5D8AC 1LHOA 4H7MA 1RUOA 4G3YC 2WLPA 3N35A 5HCAA 4XHXA 5FO9B 3AJZA 3E6DA 4FO9A 4Q4Y1 3KCYA 4BE3A 2CWMA 4HKWA 3NAPA 4XTMA 1VBA2 1HV1A 1REDA 1XYPA 4A7ZA 2Q1MA 4OI2A 3RI9A 3BCWA 4N53A 1Q8SA 3ZFFC 3CJXA 1ONAA 2VY0A 1B35B 1KFUL 5K0UB 1TEIA 1IGOA 1DYPA 3IPVA 4ONUA 4R9BA 1O91A 3ILNA 5E8AA 3NW4A 1FOD3 1PIV2 2ZHMA 4XFFA 4EROA 5JZGC 5KHIA 1HRV3 1ENQA 4FQZA 4HK8A 1MS0A 2DUPA 4Q4W1 3VZLA 2C5DA 2HEWF 4BOWA 1RUD1 1ULEA 1DGWX 3IDBB 4TWTA 4CP0A 1WCDJ 1GNZA 4FPKA 1K5MB 3CLPA 1GKBA 2XJTA 1ZBA2 1DBNA 2QCSB 2YGLA 1ZRCA 3RSJA 3R05A 1V00A 1GSLA 2R0HA 3FHIB 1BXHA 3AP4A 3VL8A 2NPIA 2PA7A 3JZVA 1FV2A 3M1HA 4IEYA 2QNKA 4XW3A 1HRI2 1A8DA 1LB2A 4BCUA 4IV1A 5CFCC 1V9U3 1NY72 2BUKA 4AK3A 2NLRA 3FJSA 3TN92 3ASIA 1HQNA 3WDVA 2NMOA 1WD3A 2R043 1PNGA 4PLNA 4LA2A 3VZMA 2BEOA 2IXCA 2XVKA 1W6OB 2WC2A 1TMF3 2A70A 1VBC1 1LODA 4XJAA 2BYVE 4EWAA 1BCXA 3AMPA 2HWE2 3VHPA 1LCLA 5FBZA 3SCGA 4FOYA 4OI1A 3VBSB 2D6PA 2DUOA 4FOQA 2EA7A 2MEV3 4I02A 5DZGA 1PVC2 3H0OA 1BK1A 3ZYIB 2BQPA 2ZMNA 3GHNA 1ZM1A 4Y20B 4QM8A 1GZWB 1LHNA 1JYIA 2E9QA 1GICA 3A4UA 4Z82A 4L92A 1F9KA 3ETQA 5CU1A 1PMIA 2RS31 3KM5A 3MYXA 2FHRA 5J37A 5JR7B 3VBHA 2RS13 2UWBA 2XGXA 2ZGQA 4D7YA 4MSVA 3WW3A 2YXSA 3KB5A 1E57A 1R082 2EXIA 3HT2A 1BMV1 3QD6A 4YNIA 4Q0VA 4QPIA 1G9AA 5C8WA 2BTVC 5EFUA 4KQ7A 4IV1B 1QJY1 1IS6A 4LUMA 2WFF1 4HFSA 2HWD3 1LESA 2BNOA 3V0BA 3B00A 1LJ7A 5CAZA 2EXJA 2ZX2A 2IXJA 5H9PA 1FPN3 4UW5A 2ET1A 5BNOB 1FOD2 2GMEA 4AFAA 4OHVA 3G6JB 3RJ2X 4M0NA 2D6KA 1RUE1 1PK6A 2WS93 5C33A 1KQRA 3ZN4A 5C4WC 3WW2A 1RTVA 4GH4A 3SXWA 1KJLA 1X8MA 2VH9A 1GV9A 2DCKA 2VGDA 1LR5A 2GU9A 2HWC1 4AYUA 4UBGA 3QBQA 4XE9A 3W58A 4IV3B 4XFBA 4HMZA 4V1PA 1FMD1 1BJQA 4C0HA 2YV8A 1CAXA 1QHDA 1BBT3 5AC93 3WDYA 4XXAA 1CAUA 1CESA 2Z69A 4AG4A 1KS4A 1Y9QA 4RS5B 1LEMA 5LEKA 1X50A 4EN7B 5EZWA 5GLUA 1DHKB 5LRRA 1EP0A 5IUQA 5HI0A 3VBHB 1N3PA 1O4YA 4DQAA 2R042 5KWRA 1RUNA 4N7IA 4WM8B 5GLVA 3VKLA 1TMF2 2F4PA 1PM7A 2B46X 3EXUA 5C8CA 3RRDA 1MVEA 1ZRDA 3K48A 5C9AC 3CJIA 4FPCA 1DZQA 5CFDC 2NZ9A 1DGLA 2K2SA 4XJ8A 3V0BB 2MEV2 4QQ2A 5BUVA 4JGYA 1RHI1 1HW5A 2DCZA 2ZGSA 1NCRB 4YGDA 1T6GC 3AYCA 2WNEA 3FUOA 4K8FA 3VBRA 1G9BA 2GZWA 3H1MA 3KGZA 4AGVA 2NP0A 4QQOA 1PK6B 3URFA 5BYNA 1CX4A 3PVBB 2RJLA 1OOPB 4W6YA 1DU3D 2YZ4A 3VHOA 3VHRA 2X29A 4ZXKA 4OULA 3PTYA 4OHWA 4Q0SA 4K1ZA 4QT6A 1ASJ3 1XYNA 4NN0A 1COV2 2OUHA 4R4ZA 2A71A 3LA2A 1ZBE1 1AR91 2VNRA 4L97A 3EBRA 3KSCA 3SH5A 2XJVA 1PGSA 3SCHA 5J3UA 1CAXB 5DUXA 1UIJA 4UW6A 4XF3A 5L7OC 5FLHA 1V6KA 1JOJA 2A3XA 3CO2A 1H1IA </