2D9PA

Solution structure of rna binding domain 4 in polyadenylation binding protein 3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
103
structure length
103
Chain Sequence
GSSGSSGDRITRYQVVNLYVKNLDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyadenylate-binding protein 3
publication title Solution structure of RNA binding domain 4 in Polyadenylation binding protein 3
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 8
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2d9pA01
5D77A 2AYBA 1HL6A 2KYXA 1WI8A 2J76E 2CPDA 4P6QA 2SXLA 2LEAA 1U1PA 3UCZP 1X4BA 2DGSA 2DHSA 1DZ5A 2MGZA 3U1MA 1ZZNA 4IUFA 2DGWA 3R1LA 2MZRA 2ADCA 2OJ3A 2MKHA 2DO4A 4C4WA 2DK2A 2FC9A 2QFJA 2CQIA 1NJIT 2J8AA 2E44A 3CD6S 4IO9Q 2ZJPQ 5EN1A 3CCMS 1H2TZ 3VAIA 1VQ8S 4ED5A 2MHNA 1YTYA 3ZZYA 4ZKAA 2OTLS 2DGTA 2MYFA 5DM7Q 4FXVA 2YH1A 4WFNQ 1M5VC 2I2YA 5GAHU 3G6ES 3UE2A 1UAWA 2DISA 1ZZFA 2CQHA 1WTBA 1HD0A 3VALA 3G8TA 1WG1A 2KRBA 4J5OA 2DHGA 3CMES 3G9CA 2DNHA 1S72S 3DXBA 2LA6A 4OZ0A 2M8DB 2RNEA 3UD3P 1X4FA 2MSTA 1VQOS 5H1SV 1L3KA 1YITS 3VAFA 1KC8T 1P27B 1VBXA 3B4DA 5LSOA 1JJ4A 1M90T 2MKIA 2CPEA 1VQ6S 3NNHA 2DNQA 1FO1A 2B0GA 1PGZA 2CQPA 1WG5A 2L08A 1U1RA 2JVRA 2CPHA 2MMYA 5IQQA 3JB9k 3NS6A 1RKJA 2DGQA 4QPTA 1A9NB 3CTRA 4F02A 1NU4A 3H2UB 3NMRA 2MXYA 5DM6Q 1X5TA 2M4MA 5HO4A 3VAMA 3HI9A 2PE8A 3MD1A 1YJWS 1N88A 3SMZA 4U67Q 1QM9A 2HYIB 1VQ9S 1P1TA 2LXIA 5CA5A 1U1LA 4WIIA 2MZTA 2Q79A 4WCEQ 3CCJS 2KFYA 5DDOC 4ERDA 3OW2R 2RUGA 4PKDB 2MQLA 1K73T 1X4CA 2DNRA 1H2UX 2KI2A 2CQCA 1JMTA 2FPHX 5LXYA 2LEBA 2QEXS 2DH8A 1K9MT 2DGOA 2MKCA 2MZQA 3CCRS 3DLLQ 2ERRA 2HGLA 1VC6A 2CQGA 2LCWA 2X1BA 3RW6A 1X4AA 1AUDA 2M70A 2CPXA 1U1QA 3CF5Q 3TO8A 1VQKS 3CC7S 2MQQA 3FEYB 1X5SA 1SJ3P 2LXUA 4LMZA 3CC4S 5LJ5Y 1X4GA 3VAJA 3P6YC 1R8HA 4W92B 5CXTA 1JJ2R 2RT3A 2DGXA 3UWTA 3UCUP 1X4EA 1D9AA 4RU2A 4IOAQ 3MURP 2L41A 3MUVP 2MPUA 3BS9A 1X0FA 3HHNB 2DNGA 3EX7B 1M5PC 1KOOA 3THTA 3L3CA 4TU8A 3MUTP 1N8RT 1OO0B 2CPZA 3S01A 3CXCR 1FJCA 1HA1A 3H2VE 2LMIA 3CCES 3CCQS 2LECA 2XSFA 3V4MA 1H2VZ 3CMAS 2RU3A 2CQ0A 1VQMS 2FY1A 5IM0B 2G1DA 2XS7A 1DRZA 2J0SD 3Q2SC 2U2FA 4FXWA 2XNRA 3SDEA 2DHAA 1H6KX 2DIUA 4W90B 2G4BA 1WF1A 2LQ5A 3S6EA 4F26A 2AYEA 3S7RA 2DGUA 1WEZA 5LSLA 1U6BA 2KN4A 3UD4P 2EK1A 3THPA 1Q86T 1YI2S 2LA4A 2E5IA 1DBDA 2VODA 2GHPA 1VQ4S 3MXHP 5GMKa 2LYVA 2KG1A 1B7FA 2XB2D 3CULA 3BO2A 1G2EA 2F3JA 2AD9A 1U2FA 1WHWA 4TU7A 3S8SA 4Y00A 2XNQA 2M0GB 3ULHA 2DNLA 3BEGB 4UY8T 5GADU 3NS5A 4CQ1A 5IFMA 4YOEA 2KM8C 2RRAA 1OPIA 2KRRA 2UP1A 1FJEB 1WHVA 5D78A 5BJRA 2OSQA 1UP1A 1HD1A 1A7GE 3FEXB 5HL7Q 3G96A 5GVQA 2JWNA 4YB1P 2M7SA 1X5OA 3NNAA 2YH0A 3G4SS 1SXLA 2A3JA 2VOPA 1WEXA 1X4DA 3CUNA 2WBRA 1U1KA 3G8SA 2FC8A 1S79A 1WEYA 3UCGA 4EGLA 2QA4S 2JVOA 2ZJQQ 1K8AT 4A8XA 2AYMA 5DDPC 2DH9A 4C7QA 3J7YU 5JVGQ 2FHOB 1R8PA 2CPJA 1Q82T 1WWHA 1KQSR 3SXLA 2YKAA 4UQTA 4WKRA 2RQCA 2I38A 3N9UC 2GO9A 4Y0FA 4CIOA 2F9JA 2CPFA 1WELA 2G0CA 4CH1A 2EK6A 2M9KA 2N3OA 3I56S 1VC5A 2M2BA 2D9OA 2CQBA 2MQMA 2MY8A 2K3KA 2DNYA 2KM8B 2BOPA 2VOOA 3LQVA 2YTCA 2DH7A 2D3OR 1F9FA 2MZ1A 1U1OA 1VQLS 2E5GA 4LIRA 2RRBA 2L9WA 1WI6A 3BO4A 4TLQA 3P49B 5DDQC 1QVGR 3MD3A 3Q2TC 2MZJA 3MUMP 5FJ4A 1PO6A 1N54B 2CQ3A 1W2BR 1ZH5A 3EGNA 4OZ1A 1SJQA 1OWXA 2U1AA 2M52A 3IRWP 2F9DA 2E5HA 5IM0A 1YIJS 2MJNA 1VC0A 1QVFR 1WG4A 1N52B 2KU7A 2X1FA 1M1KT 2X1GA 2MSSA 3CC2S 2MKKA 2CJKA 2N3LA 2MQPA 2DITA 4V19X 4Z2XA 3BO3A 1URNA 2MGZB 2DO0A 4CH0S 2M8HA 3TYTA 3NNCA 2OIHA 1NO8A 2CQ1A 2D9PA 2OSRA 1VQ5S 3PIPQ 1VBYA 1UW4A 4PRFA 2J0QD 2KXNB 3MOJB 5JVHQ 3K0JA 1OIAA 2XS2A 3U1LA 1RK8A 4TU9A 3B4MA 4M5DB 2CQDA 2N7CA 1DHMA 3LPYA 1FT8A 1D8ZA 2DNMA 1SJRA 2DNZA 2KG0A 1JJHA 1FHTA 1WHXA 2YWKA 3VF0B 1UFWA 4BS2A 1YHQS 2VONA 2HVZA 1M5OC 2RQ4A 1U1NA 2LKZA 2MY7A 4F25A 2DNKA 4QQBA 2RS2A 3SDEB 3CCVS 1SJFA 2KH9A 2JX2A 2MB0B 3ZZZA 2KXHA 2M88A 2DNOA 2KVIA 1Q7YT 1U6FA 1YWXA 2DHXA 2JRSA 2HGNA 3VAHA 2V94A 2BZ2A 2DB1A 3R27A 1KOHA 4WF9Q 3MDFA 3R1HA 2DNPA 2KT5A 2KHCA 2MZSA 1X5PA 2MQOA 1U1MA 1VQ7S 4WFBQ 1YJNS 3VAGA 3CCUS 5DETA 2HZCA 3G71S 5GAGU 3IWNC 1WHYA 3I55S 4QU6A 1VQPS 2MQNA 2DGVA 3D2WA 1FJ7A 1VQNS 3P5TL 1KD1T 3RW7A 5CYJA 2CQ4A 3VAKA 3CCSS 3J7ZT 1WF2A 3P3DA 2EVZA 2MJUA 2RVJA 2ADBA 2E5JA 4C0OC 1IQTA 3US5A 5LXRA 3MI7X 2O3DA 2N82B 5DDRC 4PR6A 2DNNA 2CQ2A 1WF0A 1Q81T 4YUDA 4QU7A 3CPWR 2XS5A 2MKJA 2MKSA 2K8GA 2OTJS 1YJ9S 5MLCV 2PEHA 1VBZA 1FNXH 4LJMA 1SJ4P 3EGZA 3CCLS 1M5KC 1XN9A 2NZ4A 2CPIA 2AYGA 4WFAQ 2RS8A 5LJ3Y 1O0PA 1X4HA 2ZJRQ 4IOCQ 2NLWA 2X1AA 1CVJA 2CPYA 3TP2A 5ITHA 2DIVA 2KXFA 5GAEU 1FXLA 2HGMA 3PIOQ 1BY9A
chains in the Genus database with same CATH superfamily
1RE1B 3UDVA 1HYSB 4RBUA 3LAMA 1Z4UA 4KPCA 5I3QA 3U1MA 2QYGA 1ZZNA 5HAOA 4MKYA 1FJGF 2QFJA 1RU1A 2JFKA 4HL9A 5HROA 3MCMA 3FMBA 1TTHB 4IG0A 1YTYA 5B0GA 4YFUA 1L5UA 3NGTA 2CJ9A 4HR2A 1UMJA 5D0EA 5F0WA 1NPPA 1PYSB 1T9TA 3DDKA 5F41A 4JI0J 5HQMA 1S72S 4P71A 2M8DB 1TQLA 4PQAA 4IDKA 4DCJB 1GTEA 3FVYA 5LSOA 2XBPA 4ZMMA 3QZ8A 4JYAF 2BRKA 4NA2A 2IVFB 3PJXA 4UOCA 4URSA 4O3OA 3TUJC 2UXCF 4X2BA 2IDLA 2W7AA 4F3MA 1TMJA 3PXGa 4RPFA 1MROA 1NJXA 1VK8A 1PG5B 3IRXB 1SUQB 5HQ8A 1JMTA 4K59A 1ZBTA 5K5MA 3DLLQ 4OYIA 3D6FB 2XMKA 2FJBB 1MG7A 1NKEA 4USUA 5GMEA 2FZGB 2WOMB 2HHTA 3C16A 1XC9A 4JOUA 1JJ2R 1X4EA 1Q16B 2V4QA 2EFVA 1VJWA 2J9CA 3EX7B 1FESA 4QR2A 4MTPA 2B8QA 2XHWA 2Y0BB 2CVIA 3CCQS 4JV5F 1GEHA 1KFDA 1GMWD 2QJ3A 1G6BA 1KEKA 1I1GA 4F26A 2IA0A 2AYEA 4OJ3A 5B0BA 5BR8J 5HROB 3PYEA 1YZ7A 4E8UA 1V3ZA 1FD2A 3M4XA 2AGPA 3JTPA 3FMWA 3AA8A 3OXGA 2OUGA 3V6DA 2Y1LB 2COLA 3NS5A 3KLFA 4IDKB 1HD1A 4RZRA 4LSLB 3DRSA 5KFGA 2WBRA 2R7WA 3NKYA 4RW8B 1UA0A 4IO1A 2QA4S 2ZJQQ 3H98A 3H5YA 1HPZB 1HI1A 4C7QA 3I0SB 4KTQA 3IWXA 1S1UB 1FF2A 4CIOA 2VF3A 1Y3KA 2G0CA 2JHEA 1EZZB 3KHHA 5DO2A 2IYIA 4YQWA 3LP2A 1GT8A 2DTJA 1BXNA 3R7SB 1N5TA 2JJ4D 2VQEF 2R8GA 3KJNB 1MW7A 4LIWA 4LVNP 1WI6A 4KSEB 2QC3A 5FJ4A 4ZLLA 3ADAC 1B0PA 2E5HA 2AZ1A 3PEJA 4MJKA 4OZNA 3O44A 1YJRA 2MSSA 3CC2S 3QO9B 2N3LA 2QV6A 2MQPA 4NLVA 3C16B 3EDQB 4IH5A 4DPWA 2WCXA 4LSNA 3W5XA 2CQ1A 4DX6A 4RW9A 3NXZA 8ATCB 4OJHA 4GC6A 1REVA 3Q8YA 2DPJA 4HTJA 3IC1A 1SJRA 4DPTA 4K4YA 1Y10A 4B3OA 1EJ7L 4L3NA 1YHQS 1S12A 4CLUA 4J9OA 1AT1B 1U6FA 3JSMA 1B4SA 1RAAB 2DEJA 3CCTA 1VDHA 1F5CA 1RUSA 3PRBA 1EAYC 2HZCA 3G71S 4E98A 3LAKA 2BOAA 3V6DB 1EKRA 3KLFB 3J7ZT 3P3DA 1NAQA 2FHJA 3T1AA 1BWEA 4C0OC 4J9SA 2J0XA 1ZPWX 3DRSB 4QU7A 3EXCX 1VHFA 2QO3A 2DBBA 4D3GA 4I2PA 5KT2A 4Q0BA 2PSZA 2XO7A 1T94A 5C7PA 1CC7A 4DR1J 3D0IE 5L1KA 4DCPB 5ITHA 4ZLJA 3IAM9 2AJFE 2SXLA 4YB7A 4U7CA 4DQQA 2DGWA 4LRDA 3LP2B 1E6YA 3DDIA 1YX2A 3VHQA 2OMLA 1UEKA 3WX4A 4KKOB 4MIWA 5HVHA 1VOMA 1ZTTA 4UOGA 2ROPA 4X66F 1TVRA 2G0IA 1NSAA 1M1HA 4G1PA 4NLTA 4OZ0A 1RACB 3HJFA 3FJ2A 1P27B 3G6VA 3ILIA 4RW9B 3A8KA 4LF8J 1REVB 3TUZC 3NWRA 5F8GA 4USIA 4M95A 1RKJA 2V4RA 1S0MA 3Q8VA 2RAQA 2ZH6A 3D1QA 1JJCB 4B3OB 3H5UA 3ENWA 4I6YA 4X4PA 2JEJA 2VUGA 1DAXA 2BVZA 2FY8A 2PDAA 3SSQA 3JSMB 4CO1A 3V2UC 2DNRA 1QAXA 3VGVA 3DHWC 3SIPB 4A4JA 2MKCA 3OL6A 1NH8A 3MMAA 2DVIA 1I94J 2GIFA 5K8OA 1UETA 3IGNA 1SQFA 3MM8A 4DFMA 3Q8UA 1X5SA 4FP9A 3SCKE 3CC4S 4DV1J 1RAGB 1OY6A 2V2KA 2HWHA 3MFHA 4I2PB 2VB6A 1AUSL 2GJIA 3KUHA 4M5DA 3MUTP 1R0AA 3X1LB 4NWBA 1K47A 4FS2A 3PACA 1NM2A 3ITHA 3NWGA 3KLVA 2PGCA 2QTWA 4LFBF 1TAQA 4E2FB 2GMJA 4DZDA 4FF1A 5F3TA 3OL7A 1E6YB 4ZPBA 4FNIA 2HURA 3THPA 4ECVA 2XB2D 1LFWA 2FLOA 2FVCA 1TVRB 2XO6A 1S6OA 3AJ1A 3MEEA 2XNQA 3T1HJ 1HMVA 4M5HA 1RA6A 4ZA1A 3RAQA 3KK2B 2W8KA 4QIWD 1CULA 3PJWA 4ZP6A 3MAAA 2E1CA 4PG6A 4A8KA 5KT4A 1HHQA 3FEXB 1FERA 1B64A 2K06A 1PBUA 3MGJA 2XSJA 4LQ9A 2DR7A 3QFHA 3CUNA 4I56A 4DX8H 1WEYA 2BYCA 2MLZA 4K4WA 3FBFA 4KIAA 2A2DA 4OHYA 3I4HX 3AFGA 2I38A 1OY9A 2HFOA 4DJBA 5HATA 3MAHA 1AW0A 1FFWB 2JC1A 4B9SA 5L39A 1YJTA 3OV7A 1U1OA 2OO4A 4LIRA 5IV4A 3OL8A 3HSZA 4DUZJ 3ZZOA 4KJIA 4LR8A 2GFFA 3MMAB 2KTQA 1PO6A 1YLXA 2M52A 3H7HB 3D0GE 3I82A 1Q95G 3FQKA 5IM0A 1LWEA 2MJNA 3MM8B 4U8VA 1H72C 4NZ0A 4NXNJ 2BKNA 3R5CA 2KU7A 3ICLA 1FX4A 2Q43A 1DQAA 4Z2XA 3GR1A 4CLKA 3GSDA 4K5RA 1LWXA 1B70B 8AT1B 1VBYA 3L7UA 4Q43A 2L48A 2GQCA 4M5DB 1DHMA 2R7UA 4PABA 2GO8A 5KG5A 1R0AB 1VR6A 3NBPA 1YBTA 3WHIA 2AKWB 4EZ6A 3ITHB 2OPSA 3H59A 3L09A 2MY7A 4F25A 4U9RA 2D3O1 2M88A 1HI0P 1Q7YT 1RT1B 4I6WA 2H5IB 3G8QA 4JI5J 2BACA 1C2PA 2HG4A 1GK8A 3QT7A 3IWNC 4GKJF 3MEEB 1IJFB 3VAKA 3CCSS 1YVFA 1LWFA 2MJUA 4QR1A 1YBUA 2FVQA 2P5VA 4PR6A 7AT1B 3D1OA 4K4ZA 4B3MF 1RBLA 1A6LA 2W9AA 3MEGA 2EBGA 2MKJA 3HX9A 4ZVUB 4WE1A 1H98A 1TK5A 2W9CA 3CO0P 4DR7J 4IOCQ 4OYAA 2BABA 4B9NA 3QRRA 4G65A 2KXFA 1ITPA 3TZYA 4ETXA 2BR0A 3X3UA 3NLCA 5CCLA 3W65A 1FTCA 5GADI 4IUFA 3Q86A 2MKHA 3FZBA 4R0EA 2DYAA 2UXDJ 5JUMA 2HZAA 3LOUA 4CDIA 4NRUA 4YB5A 2BEFA 2AT1B 2QGFB 5D4OA 4OLPA 3G8TA 3DXBA 1GX5A 2GMLA 2IBKA 2MKIA 1VQ6S 1PJ5A 2PMWA 4TXSA 4MAKA 1PGZA 3NBPB 3H2UB 3OQ2A 2OPSB 1GAOA 2ASLA 1RCXB 3LPEA 2HW3A 3CJ3A 2QMUB 4G6VB 1QM9A 3K57A 2QN6B 2UV8G 3LP0A 3IWLA 2AHOB 1KRPA 4AXIA 4QCLA 5LXYA 2FPHX 3LF0A 4YN3B 4QWAA 3M6XA 4DV7F 3LUYA 3DMJA 2HKEA 3ZO7A 1ZM9A 3BGUA 4ZVOB 1LWFB 2P9CA 1VQKS 1RSCA 4QR0A 2HHQA 3R97A 2H5EA 4JI4J 3CMQA 9ATCB 1TKTA 3MEGB 2IRYA 3UCUP 3HHDA 4WE1B 3GV7B 2ZZNA 3AXKA 5F8LA 1XIQA 4PG7A 2CPZA 2FIUA 3AOCA 3QATA 5LMNJ 4XIUA 2YWFA 2XSFA 3IAS9 2V9KA 3O1LA 4RJVA 1DRZA 2U2FA 5KFOA 2XNRA 4LF9J 1WOSA 2W24A 2LQ5A 5F8JA 1PJ6A 3P5BP 4AE5A 1TKDA 1U6BA 3FCHA 3G86A 3ELHA 3CJKB 4BBYA 1S0VA 1NXIA 3SI8A 1OQ6A 1BD6A 2NS1B 2VPWB 4X64J 3MR2A 2NZCA 2NXCA 4ZOSA 2CADA 2RHSB 3BEGB 5GADU 1WC1A 3QT6A 2FQQB 5D0GA 3IO1A 1WC3A 4JI2F 2D69A 2OSQA 1UP1A 3I9ZA 3BN4A 5I42A 3MPVA 4NA1A 2ALYB 7FD1A 1JNZB 3JQKA 4UF4A 1S6PA 5E41A 4K5SA 1HWLA 2DH9A 3FCVA 3MEKA 3OVBA 1N32F 1BUXA 5E3AA 1AZSB 2ZZMA 4ZPVR 1PIEA 2VG6A 3W2WA 2C3UA 3LP0B 3NGDA 1VC5A 4ZJOA 4IH6A 2K3KA 4NLPA 4FF4A 1XJWB 2BQUA 3HMJG 2ZH5A 2UV8A 2V6AA 2NXUA 2E9RX 3QQCD 2DPIA 5L1LA 3BO4A 5C5JA 3MZIA 1ZH5A 3QJPA 4P2XA 1PSDA 4NZ7A 4B3SJ 4P2SA 2RRNA 3AHPA 3W1YC 3E2EA 1TKTB 2CJXB 4ECZA 3BM7A 4DL2A 4G1IA 3RZAA 1VQ5S 1V5VA 4HDHA 2BE9B 3HCXA 2AJ0A 3RUBL 1JJHA 4LFAJ 2E9TA 4LRCA 4JV0A 2RQ4A 2RS2A 4P7VA 2DNOA 2R8JA 1SL0A 3OJSA 5GMDA 3ZNUA 1RBOB 3P8BB 4ED0A 4OX9J 4ECWA 4PXDA 4Y2MA 4JBCA 2HWTA 2GJFA 1S0NA 2V8DA 3P5TL 4OZ3A 4RNFA 2GIRA 2B9WA 3LGNA 2OELA 4H4MB 3GB0A 4O3QA 3US5A 4YMEA 1TL3B 2UUCF 3GWCA 5I42B 3RB6A 3Q22A 1MU2B 3CPWR 2NSCA 4FPRA 4ZIWA 1VBZA 1S6PB 3EMTA 3TUIC 1XMOJ 5IWAF 3NGKA 3VVUA 4Z7CA 2OD4A 2C3OA 2DIVA 2EXUA 2VG6B 2RD5C 1RZMA 2AZ3A 2CAJA 4DOZA 1R0BG 5F9LA 3UCZP 1MNEA 2RUSA 4JP8A 4Y6IA 3L4BC 2FD2A 1A0OB 3HPOA 3BSNA 5EN1A 3CCMS 1H2TZ 3B8HA 1XR6A 2B4VA 3T19A 2ZWPA 2MYFA 1S77D 4RX6A 5C2CA 2APOA 5CABA 3QT8A 4DPXA 5L1IA 1QY7A 1SC3B 5EUHA 3PHTA 2MLXA 2K1RA 2VFRA 4DR1F 2PFDA 3HF5A 2L9DA 4RNNA 4OV1A 3F41A 5A8RB 5DLFA 2YNGB 3QGGA 4F02A 4C3MA 2CFXA 3FCWA 2C2DA 2VBWA 2M4MA 2HHVA 4IOBA 1B0TA 2R7VA 4YY3J 2HNYB 1RWNB 4EZ9A 5D8HB 1O8BA 3KKFA 3MR6A 3CCZA 1C0TB 1VISA 2FB0A 1XERA 3GV8B 4F2SA 5HMYA 3RRHA 4TYAA 3LWLA 3ZNJ1 2FDNA 4B9MA 2HLUA 2CQCA 3QSYB 2ZEJA 5DZ7A 5HVGA 3H5XA 3CCRS 1Q7LB 2HGLA 1SL2A 1NDCA 2WBMA 1NK0A 3DGPA 1OPZA 4LF8F 1KVIA 4F0MA 4DUYJ 1KBRA 1P1LA 2DKOB 2HIQA 4NCBA 3DYAB 2Y1JA 5E2QA 2DGXA 4O3RA 2NPFA 1I5OB 4RU2A 4KC5A 2UUBJ 2DNGA 1T7PA 2IBOA 3L3CA 2XY5A 1I3OB 1TFYA 3H2VE 5ETTA 3RU0A 2ZM6J 1HBOA 2RH3A 3R5GA 4LF4F 2ZOMA 3J81j 2CNLB 3W8GA 5LSLA 4ES2A 1M1GA 1YBAA 1CJUB 2LA4A 5D0HA 2KG1A 4JI3J 4DSKA 4DL7A 2BUNA 3PRDA 4X62F 5DJBA 1TELA 4DV1F 5EWFA 1N36J 3R7BB 1UFLA 4CLSA 4F4AA 4KV8A 2AGOA 2K1RB 2BKOA 3DNCA 1YSJA 4TYBA 1A7GE 4Q2LA 2PMHA 2GGPA 3ENQA 5G4DA 1UPPA 4OMFG 4LREA 5L46A 1CEZA 2CVEA 2AYMA 4XPCA 3M7VA 3C6TB 1FVSA 1R27B 3HHLC 2O67A 2WW8A 2AQ4A 2D9OA 1S1TB 3I5CA 3QAEA 1N56A 3T1HF 3VVTA 3K59A 1SC4B 2VU5A 1T9WA 2E5GA 4PG5A 3CJSA 3K5NA 1ZPVA 2KO1A 3PTWA 4DV0F 3MUMP 2J6UA 2EI5A 4C97A 2HAIA 3LA0A 4QIGA 1R0CB 1UL3A 5KFDA 4USWA 5LL6d 2HBZB 2HS4A 2HQFA 1PYTA 4WFZA 1WSVA 3V81A 2PA3A 4CH0S 2ZBCA 2E29A 5C42A 1RABB 2OIHA 3PIPQ 2VG5A 4RW7A 2XCPA 3OTOJ 4DS5A 1U2RA 1VCTA 1CS4B 2YPZA 3HZEA 1GMWA 2FJAB 2DNZA 2C2KB 4C8NA 5T14A 4FPIA 1X9WA 1HBOB 3RTVA 2G13A 3L7PA 2OEJA 1SJFA 2KH9A 3DU5A 2IVMA 3R6GB 1S9GB 2OFHX 4WF9Q 5E3CA 2DNPA 3KHLA 3VZHA 1FEHA 2DR6A 4YHHJ 2KT5A 1O6XA 4DX7A 4NXNF 5AXMA 1W26A 1QUPA 3CJ4A 3H8YA 5T7LA 3ILOA 4I4BA 1PKUA 3H5SA 2YKQA 3T9NA 3D2WA 3RW7A 1RWMB 3O5TB 1LW2B 5M2RA 4KV8B 2ZH9A 2R8HA 2GHWA 2XLIA 1FRHA 2QT7A 4GMKA 4WK3A 3M2VA 4GVBA 2GGPB 1UVKA 4ZCMA 2W8LA 2EFNA 3BGLA 2EEYA 1KLMA 3CCLS 1WD6A 4WFAQ 3IR5B 4DWIA 1O0PA 4JI5F 2NLWA 2VG7A 4F3OA 2UXBJ 3PFEA 4L76A 1K0VA 3RB0A 1V9OA 4I6AA 1Q1KA 3D28A 1VRUB 1NJYA 3KUGA 5AJ3J 4I67A 1NJIT 3CD6S 1U09A 3HVTB 4X65F 4C8KA 1FK9A 1N4LA 2DGTA 4DR4F 3MAQA 2I2YA 2QMXA 9RUBA 4FYVB 5F8NA 1T95A 1VFJA 3MMBB 1WKLA 4Z7YA 3OFEA 1S1VA 3E01A 5JXSA 5J1NA 3UR3C 4DV4J 3KMQA 5KFUA 2VG5B 3DCAA 4OQJA 4ZITA 4RW7B 1FRMA 2QLXA 3T5HA 3N6NA 1E6VA 4JI6F 3SBMA 1J5EJ 1BC6A 4PG4A 3CIZA 4K2JA 3M9NB 5EWGA 4LF6F 1N88A 1KKHA 4NYPA 3SMZA 5CA5A 1SVDA 1KVKA 4MT1A 1VLYA 5SZTA 2KFYA 1IKVA 5DDOC 4ER8A 4WXWA 2WK4A 2FHJD 1H2UX 2KI2A 5B7WA 3PO5A 3K5LA 1QE1A 4RW6A 1XNQJ 2RKIA 5B09A 4J9KA 2P9EA 5T7LB 5KFZA 2VHGA 1T9YA 4MYTA 4PCQA 3V5RA 1AUDA 5CYQA 4F04B 2RJZA 2XC9A 3MR5A 3POTA 4DF8A 2J6TA 3M2VB 3NOCA 1S5ZA 4YS2A 2ZE2A 1D9AA 1H74A 3J7A1 1NK4A 3PW5A 2PIIA 1JLCB 3Q89A 4I0WA 2ASDA 5KFRA 3R2DJ 5DGBA 3CXCR 2ZH4A 4C3KA 3CCES 2VG7B 2E1AA 3UN3A 2JZ5A 1UEVA 2IJRA 1H6KX 1H7XA 5M2UA 4KY3A 2V8HA 3M8PA 4Q44A 2GMHA 1IM6A 1WEZA 4J9QA 1NPRA 1P9QC 1IQZA 1K44A 4C0HA 5L9XA 5CD4A 1UCNA 1F9HA 1C0UA 2BJ9A 3R5DA 1FK9B 3HP6A 1Y4ZB 1NSPA 4DR3F 4TU7A 5I3UB 1Q8BA 5HSPA 5CYMA 1S1VB 3E01B 4TQSA 2HS3A 3AB2B 1NZAA 2QA2A 3A3NB 2JWNA 3AD9C 3D66A 1UZHA 2YH0A 1SKUB 3TR5A 2E1RA 2LU1A 1TMMA 6FD1A 4C0BA 4LF9F 3CDAA 1FJGJ 2PEBA 5KFAA 1R8PA 2AJ2A 3OLAA 3R3TA 3WBZA 1WDTA 4WKRA 2HS0A 2YXLA 2OAUA 4RL1A 2M9KA 1IKVB 2F4VJ 2CQBA 4X64F 2ATLA 3GMGA 3M2UB 2DH7A 4QPXA 2HRUA 4RW6B 4KR0B 4CWBA 1RCOB 1RTHB 1QVGR 3MD3A 1N54B 1VS3A 5CYQB 5MAOA 2G1HA 3POTB 4ANDA 1JLQA 5JJBA 1YIJS 1GXTA 3N28A 4ZP7A 4ZN3A 2XCAA 3UDCA 3VQTA 2EFPA 2DITA 3QLHA 3LH2S 4ED4A 1S6QA 2ZE2B 2HQDA 3NNCA 1HKAA 3PCOB 4U7UD 3ZZPA 1BQXA 1BMQB 4DL5A 2E5LJ 1UW4A 4J9RA 3SSRA 4NXMF 3BF4A 2VZ9A 2YBVA 3TAQA 3TZZA 1D8ZA 2XMAA 1RT3A 4ILLA 1FKPA 1FHTA 3DN9A 1U0HB 3PW2A 1UJ6A 4UT4A 3OXFA 2AF6A 3J7Z5 3HKZD 1B3TA 3K5OA 2KXHA 1WC5A 5KFEA 3M8PB 3HFZB 1LOUA 3Q8SB 3R27A 4F67A 4KO0B 1RTDA 2Q1LA 2IAJB 3M8QB 1C0UB 1AA1B 1DJ0A 4B3SF 3KLIA 2Y1IA 1JLGA 5DETA 1UJ4A 3N0VA 2MQNA 2HK2A 5CYMB 3I32A 4ELTA 3S1TA 1TUWA 3HSJA 1OJ4A 2G0JA 3M32A 4UW2A 1Q81T 1S59A 5A6PA 2YWGA 1VRQC 3OR2A 5E33A 2HNZA 2V0NA 3DI6B 1B0VA 3UQSA 2ZVIA 1X4HA 1XMBA 3W64A 3F73A 2Z57B 4OX9F 1HL6A 4KHPF 4USTA 2GAGC 1G7CB 1N5SA 2DHSA 2MGZA 4RKUC 3Q8PB 4KH0B 1JXLA 2OGUA 4FYXB 4G1QA 1U24A 1ZETA 4IO9Q 2EFQA 5HQLA 1VQ8S 2MHNA 4CO3A 1T05A 2IRUA 5DM7Q 5ETOA 1YQHA 4A8QA 3SEOA 1JLQB 2G2YA 4NYOA 1WG1A 3EYZA 1VGYA 3J7YI 2YNIB 3QLHB 1IM4A 1VJQA 1RADB 4IQXA 5H1SV 1S6QB 3IN5A 4MIAA 1F3VA 5K8NA 2OPPA 2XG8A 1S7IA 1YK9A 2VFUA 4IR9A 5LT5A 2HMIA 1KQFB 3DGVA 5J1PA 4PWUA 1FXRA 1RT3B 2HLTA 5FDLB 1FKPB 4OYPA 1F2GA 4KHRA 2LFVA 3HI9A 4M5GA 1Q5VA 2N4DA 1CQMA 2DR5A 2Q6CA 4LRBA 2P6SA 3EPGA 1PAEX 2KZMA 3Q0AA 4OYMA 4F4KA 3HZGA 4PKDB 5BXIA 5J1EA 4MMOA 3KXDA 2BQRA 4DBQA 1JLGB 2IMWP 3CEDA 2KKHA 5HK4A 1SC6A 2HFUA 3KHGA 5KFJA 3NRBA 4DZ6A 2A6MA 2V8VA 2VL1A 2RDIA 2D74B 4YY3F 2DCUB 2JEGA 2Y3YA 4IOAQ 2IYGA 3OR2B 1T9VA 2MEWA 2CJBA 3BS9A 1X0FA 2XZDB 3N01A 5KFFA 4MK8A 2RQMA 4H4OA 5KFMA 1PC4A 1UFKA 1VQMS 4JI7F 1T3NA 4C2MA 4CO4A 1QTMA 2MHEA 3QIPB 5KFBA 2H3EB 3S7RA 5KG2A 2ZBRA 4G1QB 4B3RJ 4E0DA 4H54A 4AQYJ 3D54A 2F3JA 1NK8A 4L72B 4ED7A 2VFVA 1RAEB 3L9ZA 4NZ6A 1ZM2A 5IT9U 2IC3A 1AXQA 3ZZTA 2UUBF 3PNIA 4R8UA 3IFEA 5D6GA 3OJUA 2OPPB 2FGOA 2D41A 1NLKL 3WDOA 2ZM6F 1U0SA 5AT1B 3KLGA 2E66A 1L3SA 1VI7A 3BH7B 4J91A 2JVOA 1K8AT 2CIMA 3I6PA 5DRKA 2A18A 3J7YU 4ZLNA 2HHXA 2YKAA 1GNKA 2RQCA 1MWYA 3W9IA 4JI3F 2EG1A 2ZC3A 1WORA 4QZVB 2HQGA 3UN5A 4TY8A 1DTTA 4X66J 2LLZA 4GVLA 3TNVA 5L1JA 2BANB 4F8RA 2DNYA 2BX6A 3LQVA 1LXJA 2YTCA 1W25A 4IKAA 4RU9A 4IG3A 5KT6A 1Q8IA 3KNGA 2RDDA 3T9ZA 2WVBA 5FLXU 3ZTOA 4OYXA 2H48B 3QJLA 3C6UB 2QL5B 6AT1B 5IQ6A 3MM6B 4DG1B 1URNA 2IM2A 2C2RA 5ETQA 2QG9B 2VFSA 1NHKL 1IBKF 4H4OB 4PWDB 4QYZK 3GIMA 3OSNA 2BXJA 3GIJA 4O0IA 5EGYA 3VGTA 1YWXA 2NCKL 2KL8A 1ZAWA 4DN0A 2J9EA 3CCUS 5HJXA 1HR0J 3AA9A 2KFNA 3G2XA 2IC3B 3JAMY 5KFNA 4DQPA 2I1RA 1ZM3A 2EVZA 4R8UB 2H5JB 1HW8A 5HJYA 4OZ5A 2I5JA 4HH1A 5CZXA 4Y3CA 4NOHA 1RKIA 3K8WA 4YUDA 2CWXA 3UI3A 3EVWA 3F44A 5IS2A 1R43A 3ZZ0A 3SQOP 2HVIA 4WTYA 1DTTB 1FDNA 1R6VA 4NLWA 5KT3A 4GO7X 2V2ZA 3DOKA 4NLXA 3NOGA 2BBEA 2UVWA 2V2VA 4B17A 4X84A 1OS5A 4Q7AA 1H73A 3TI0A 2QLFB 1RT2A 3G6ES 3UE2A 1WTBA 4OI2A 3CMES 4KFBA 3D7SB 5E3PA 4F36A 3J81U 3CO9A 1V6HA 2VQFJ 3DLEA 1NKCA 4NA3A 1YRUA 3HLUA 3MM9A 4NCAA 4CO5A 2HHPA 4DSEA 5HLFA 2BV3A 7FDRA 4DCOB 3B78A 4FVCA 4OI1A 1Z2ZA 2CQPA 4J9UE 1U1RA 5RUBA 1CJVA 1X5TA 2PE8A 5FD1A 4AYBD 1FDAA 1SB6A 1P6TA 2R2SA 4ZVRB 4USHA 3DOMA 3C8YA 4CM0A 2EBEA 3V6JA 3RGIA 1KTVA 3CCWA 4DL4A 4B3TJ 3EJMA 4BHQA 2KDOA 2M70A 5IC6B 1HYSA 2MQQA 5KFYA 3RR8A 3TJ9A 3H20A 2XM3A 4FYWB 4XK8C 4ZVFA 1D09B 2I5JB 3CT9A 1L3VA 3W9HA 4ED6A 2KJVA 4A8OA 2RT3A 2GZOA 1APSA 3JSYA 2Q3PA 1NDPA 1YJ7A 5ETKA 3KLEA 3TA2A 1KOOA 3PZPA 1FJCA 2MQ8A 3LWMA 3EDRB 1NK6A 4NLSA 3ISZA 4LSZB 3OLBA 1N6QB 2XS7A 4EWTA 4GKJJ 1D9FA 2RF2B 3AQPA 4KGZB 5GMKa 3BO2A 2J8SA 1RWXB 4WU2A 1RT2B 2Q66A 3DRYA 1CSJA 3CDEA 3KG4A 2E7VA 4YEAA 1UA1A 2XMJA 4KFBB 4MK7A 3DLEB 3IM8A 2UUAJ 3OSPA 3MM9B 1MN7A 3J80Y 5HLFB 1SUQA 1LWCA 4ID5B 3H42A 1RT4B 1X4DA 3M8ZA 4NMXA 4ECQA 3BKFA 2FHKA 2VJVA 2XQCA 4AUKA 2KHDA 1ACMB 4ATNA 1ZM4A 4N8OA 4FF3A 2HRYA 1FRIA 2AEMA 2QLJB 5DZ6A 3J80U 3N9UC 2FUG9 2UZAA 2ILZA 2EK6A 3DOMB 2HQIA 3LGMA 2MY8A 2D7SA 2JNJA 4A47A 2A10A 2MZ1A 4PWWA 2DRDA 1S6UA 3V6HA 2MZJA 4OZ1A 4TY9A 2ZNZA 2F9DA 3MECB 1FXDA 1M1KT 3PYGA 2YNHA 2Z56B 4CO2A 4CLYA 3RBDA 2A1BA 2OPQB 2Z58B 1SV5B 3K0JA 2XS2A 3KLEB 2N7CA 3EZUA 2F4VF 3LTOA 4MKVA 1X9SA 4DV7J 2NYHA 1Q8LA 1FKOB 4FNHA 1N5YA 3JYTB 3ISNC 3CCVS 3DM2B 4AL6A 1HBMA 1ZYQA 2DHXA 2IIHA 4LSLA 3UVJB 1IJEB 3R1HA 4TVAB 2FGCA 4RW8A 2B7CB 1HPZA 1QSYA 3I0SA 1FRXA 4O3NA 2XYHB 1WHYA 3TAMB 1VQNS 1S1UA 4LQ3A 4ZCLA 3W2VB 2E5LF 5ETPA 1NSQA 2YVSA 1RYRA 1GMVA 2XLJA 1IQTA 3MI7X 5L38A 4ZPAA 4JI8J 3GONA 2DNNA 2B4OA 1LWCB 1WDDA 2V68A 4DV3J 2ZWOA 2K8GA 3W63A 5MLCV 2FVRA 2QSFA 1M5KC 3KG0A 3TJAA 5EDWA 3ZC4A 2JOQA 2X1AA 1CVJA 4NI2A 2PFFB 4N41A 5D77A 2QL9B 2QSWA 3QO9A 1RGVA 1S1WA 1XMQF 2L9NA 4HHHA 1G1XA 2XY7A 2HEKA 4USJC 4DV2F 2WTFA 4JI2J 5LOQA 4ZJQA 2HRTA 4O4GB 1RAOA 3FK4A 2LXFA 1HD0A 3NAIA 4OFZA 3BQ1A 4J5OA 4ILRA 4L3KA 2YNHB 1RT6A 1N32J 1VLOA 1YITS 3QSIA 2CXEA 2GC8A 3FBCA 2GHVC 3D0HE 5KFQA 2MDAA 2CWKA 2POKA 3KYLA 5A76A 2YY3A 2MMYA 4OX7A 3C19A 1TK8A 1IWGA 2HIYA 1NNDA 3THVA 2W1BA 1IKYA 2R7OA 1N5YB 1X8DA 5J2NA 2ABYA 1HBMB 2V69A 4Q8EA 3GFZA 1X60A 3VCDA 3PHEA 2X51A 4M5KA 3LP1A 1RQ0A 2ZBQA 4OI4A 2EG2A 4HVZA 3HM9A 2AGQA 1K9MT 4ANEA 3G6YA 3RW6A 2Q6BA 2Z30B 1D1UA 1C4AA 2QLWA 4AT1B 3NCQA 4FKYA 4JI1F 3QZ7A 5IOLA 2KJWA 1UEUA 4W92B 5CXTA 3W7BA 2VC1A 4K0KF 2ILYA 4HYKA 4ZVEA 3ZZUA 3KDOA 1FTRA 1RHMB 4KKOA 2L41A 4OZLA 5J2QA 3Q23A 1M5HA 5DS7A 3PVXA 4TU8A 2NUUG 4NI2B 3HO1A 5GAGI 1WJ9A 1S1WB 3AODA 4UUXA 2GAHC 1SL1A 1Y5LB 1WF1A 3S6EA 4WK1A 1RTZA 3OTBA 4ECYA 1DBDA 2GHPA 3MXHP 3EPIA 2UUCJ 2XMUA 2AD9A 1CQNA 3CDUA 3H90A 5H9FK 3BKTA 2WZ1A 3FBBA 1GXLA 3EVMA 5KAKA 3AT1B 2KM8C 3D6TB 1OPIA 2KRRA 1RT6B 5IWAJ 5J2PA 1LQ9A 3H2LA 4FZVA 4DR6J 2R4FA 4KQZA 3OFHA 1EQMA 4IH7A 5I4MA 3T5LA 4ITSA 2JL9A 3A8JA 4OYZA 3H4BA 2OHDA 5JVGQ 4B3RF 1RAHB 1IKYB 4NLGA 2F9JA 5J2NB 4AQYF 5EHHA 1WELA 4OYBA 1IBMJ 2M2BA 3B54A 2MQMA 3LP1B 3WIUA 4OI0A 1MWQA 2B51A 2RE1A 1VQLS 3SQGB 1QLNA 3MM5B 4LUBA 2B3TB 1TK0A 3C66A 1F3FA 1MLAA 2R3VA 1XQIA 2H4WB 1SH3A 2YQ1A 1RHRB 4ECRA 3DKDA 3EVOA 5LSRA 3CJ8A 3BR9A 1RLCL 3KG1A 3TYTA 1NO8A 3LANA 3MOJB 3GV5B 5EX3A 2IJNA 3VZIA 5J2QB 1S4FA 4ZP9A 3ZZRA 3C14A 3KK2A 3NGRA 5I3PA 3RJMB 4DUTA 3FKBA 3EM1A 3NL0A 3HHEA 2CG4A 2DXDA 1TKXA 1M5SA 5DG8A 4HLBA 3A1YG 3QWPA 2J5AA 2IM0A 4ZK7M 1HBNB 5GAGU 4YDXA 3I55S 2A0FB 4H4KA 3MEDB 3HD2A 5KG3A 2JLGA 4NLDA 1F1BB 3E8OA 1HIYA 3IGVA 4A8MP 3BBCA 5J2PB 5LXRA 4U96A 2KZZA 2W7PA 4CM2A 5KTQA 2YWHA 1UTAA 1F5AA 4DFJA 2IFXA 4LF4J 2XGPA 2ZNYA 1XBWA 1NMEB 2WB4A 2XMWA 3R5JB 1FXLA 1BY9A 2KYXA 4X62J 3ET6A 2CPDA 4P74A 1KLNA 2OPRB 1U1PA 2R8IA 4DI6A 2GV1A 4BLGA 5EWEA 1HR0F 3R1LA 1R8CA 2ADCA 2OJ3A 4N7TA 1GH8A 2V50A 1N33F 2J8AA 2E44A 2ZJPQ 3BR8A 4DR5J 1CJTB 2F1FA 2OTLS 4Y2IA 1RHUB 3GFYA 4CT9A 2YH1A 6FDRA 3KLHB 2WVFA 5ETSA 4LBHA 1B7YB 4P2FA 1H3DA 1VQSA 2ACMA 2WVCA 2H65B 2KT3A 4DU8A 1RT1A 2FJXA 5CCMA 1KWMA 2R2TA 2BE2B 1UJ5A 3M2RB 2D3ZA 1JJ4A 4R0JA 1RWUA 1DARA 3NNHA 1WG5A 3EWGA 3NS6A 2CJQA 3CWJA 3ISND 3C14B 1CC8A 2IM3A 2UVUA 1HNZF 3NMRA 3WC0A 3IR7B 2HBRB 3PRVA 4DV0J 1UW9A 2J7UA 4K4UA 1IBCB 3GYNA 4WKYA 1TKXB 4ERDA 2DRBA 4YDDB 3W60A 4X4UA 1URRA 1D9DA 1KP6A 5A2QY 2XYPB 4HI1A 5CAAA 1KDNA 3BKUA 2BKPA 2MZQA 2VQFF 4NEZA 5B0DA 4B9TA 1LK5A 1B99A 2NYIA 2FTRA 1ZTWA 2HSEB 2LDIA 5F8MA 3U27A 2LXUA 4LMZA 2B56A 2ZH8A 3SFGA 2GVZB 4X4SA 3W61A 2P6TA 1QUVA 2GIQA 2J9DA 1LEOA 5IC4B 1YRTA 1D0EA 4CYUA 4U6PA 2B6AA 1FNOA 5KG6A 1HA1A 1JWWA 3PW0A 4J9MA 3ET6B 3CMAS 3QRQA 3C15A 2VBZA 2DIUA 4B3TF 3O3LA 3UD4P 4OV6A 2UU9F 3IR6B 2BM0A 1G3OA 1HWUA 4C8OA 4YR2A 1TKZB 2R2RA 1AFIA 4ZLPA 3FEZA 2AV5A 4OIXA 4OX8A 5BJRA 3TW0A 1RAIB 4FXDA 5GVQA 2ZH3A 1H0HB 1SXLA 1OSCA 5IT0A 4J9NA 4QBUA 1SPBP 3TA1A 4DL0C 4EGLA 2YKMA 2RHQB 3MPWA 1AFJA 1Q82T 4KHMA 3EXYA 4X65J 5KFTA 2CPFA 3TEGA 4DR4J 1NB2A 2N3OA 3EZOA 2BJ8A 4J9VA 2C2MB 2E7XA 2QMWA 4LF5F 4TLQA 2G9OA 2B9YA 4NPOA 5AXLA 4ILMA 2UUAF 1OWXA 1OYEA 4ED1A 3CGIA 5HMXA 4IFVA 3IRWP 3GTYX 2C22A 1D8YA 4JI6J 3HHLB 2R8KA 4V19X 4X4RA 4K4TA 2CZVC 2OH2A 3CJKA 2XI2A 4LF6J 2M8HA 2QIFA 2DXEA 1OIAA 2RIJA 4TU9A 3UD5A 1NH7A 4CYUB 3FSIA 2B6AB 3R7NB 2VPXB 3AOBA 3BQ0A 4JV1A 3TQ1A 5D0RA 5KG1A 3C15B 4IRDA 5H9EK 4I2QA 3MCNA 2PA8D 3W66A 3ZZZA 1WKJA 3MR7A 2KVIA 4IQMA 3F56A 2WONB 3MDFA 4CH7A 5A8KA 1FA0A 2FZKB 2MQOA 4ZCKA 3VAGA 3FZ2A 2B4PA 3HVAA 1AZSA 4EEYA 1KD1T 2CQ4A 2NREA 1U4BA 3PY8A 3D3CJ 4KGMA 1RT5A 2RVJA 1U49A 4BWMA 2LDYA 4CI0B 4LBIA 2CQ2A 4FDFA 1WF0A 3ZTSA 2YNFA 2FLLA 2YKMB 2HVEA 3PG9A 1JNRB 2AYGA 1U25A 1FDBA 2GQ2A 5LJ3Y 3HULA 2IDEA 2Z8QA 1QTNB 4QW8A 2V4JB 3QGIA 2LVWA 4RNHA 2AYBA 3N6MA 5F3ZA 4DR2F 4DR3J 1F5BA 1LFPA 3RAXA 1DZ5A 4ID8A 3JSBA 3ONQA 4RWWA 4F4WA 2OKQA 2MZRA 2DO4A 2X3DA 2EWHA 1KVJA 5K20B 3TX0A 3DU6A 1UWBA 2GA7A 2W2PP 3CB4A 3VR1A 4JI8F 4IFVB 2ZHOA 4DV3F 4ES3A 3VALA 2KRBA 2DHGA 3RYLA 3D4JA 2RNEA 4YR0A 2BJ3A 3D3BJ 1VQOS 4I68A 5B0EA 4UQGA 1KC8T 2CNNB 1M90T 2DNQA 2OEMA 2A2CA 2CPHA 2NUHA 4Y2AA 3CTRA 1XR5A 3ZTQA 2BW2A 1TL7A 4H4MA 1VYAA 4I2QB 5G0RB 4U67Q 4KT0C 2I6WA 1TL3A 4F0HA 5DG9A 3GSIA 2J9DE 4K4XA 1UPMB 4YP3A 1KFSA 3R6LB 2RUGA 1TL1B 1MU2A 5A8KB 4CLZA 3T5KA 5AXNA 3HVRA 2LEBA 4OHVA 5HI7A 3QT5A 4O0NA 4HH0A 5DQHA 3AY0A 3CD0A 1VC6A 3CJQA 2M3DA 2HQCA 1BQMA 3MCOA 4NXMJ 1RT5B 5F9NA 3CC7S 4X4TA 3FEYB 3EGWB 2AIRB 2CJYB 4ECUA 1X4GA 4ZDNA 3NCRA 1SJ1A 2YNFB 4RR5A 1RWOB 3UWTA 1IVZA 2XMMA 4CNYA 1C4CA 2Z2ZA 2J6SA 4NCGA 4L74A 4CO0A 2PC6A 3H40A 3FNNA 4B9UA 3CNQP 4UUWA 3D6MB 4A48A 4CLPA 1NK5A 1IKXA 1LNQA 1MN9A 2HAFA 1J2VA 4PAAA 1XTZA 1IR2A 2KN4A 3NGUA 3OVSA 1YI2S 2WAQD 2XGQA 1UWBB 5A8RA 1ZA2B 4WYLA 2YNGA 2ROGA 3K89A 4Y00A 3GG0A 2EPIA 2M0GB 2HNYA 2CRLA 3W5YA 4N77A 4CQ1A 5IFMA 2W4CA 1C0TA 3NCPA 3EE3A 2RRAA 3UO0A 4XTTA 5GAEI 3JTOA 5HL7Q 3G96A 5E3QA 4KHPJ 1OMSA 4NE9C 3LW5C 4WJBA 3A3OB 2DRAA 2ZDOA 4KB7A 2A6OA 1TL7B 1S0OA 2WVEA 2EKYA 4WU3A 3PM9A 3VWSA 4KGXB 2F5GA 3DYAA 2HHHF 2BOPA 4L73A 3PEHA 1RA7A 4ZVPB 3T1YJ 3H25A 3GQCA 3ZTRA 3HT3A 4IRKA 2CZ4A 4OLOA 1H7WA 1RHKB 3OTDA 1W2BR 4RUBA 4DR6F 1BQMB 2ASYA 4B08A 3CE8A 2J0WA 4DLEA 4NEYA 1KS2A 1LXNA 1N5QA 4N47A 4DV5F 2HFVA 5KFIA 5HP1A 3P45B 2QYCA 1ULRA 1CJUA 2XMTA 1JB0C 8RUCA 2J0QD 1K0TA 2KB2A 4NCGB 1TP7A 1SC1B 4N76A 4IG0B 1IBMF 3LPYA 5KFHA 2OLWA 2DEIA 4RO0A 4LRAA 2ZOGA 1WHXA 1IKXB 4ECXA 3UW1A 2LKZA 4KGKA 1WACA 1HNVA 2BJEA 2CKWA 3BGOP 3M6WA 1S76D 1YJNS 2YQ0A 3MPDA 4QU6A 3C6TA 1XNRJ 3AJ2A 1FJ7A 2ZKUA 3BSOA 1X0PA 3KOAA 1WF2A 3R9LA 4CP5A 1AYEA 1S9EA 1QD1A 1GXUA 1FFGB 2JH3A 1S1TA 1F60B 1TL5A 4EO8A 3TUPA 1MROB 2FJWA 1IXKA 2XS5A 4JI7J 3D5MA 3CD5A 3TVYA 5THWA 2RILA 2WW4A 4EUVA 4EBEA 5KG7A 4ZP8A 5GAEU 3MTJA 1R8BA 4QYRA 2J76E 4M1KA 1FI4A 1UZDA 2ZUAA 4F3QA 2J7KA 2CDRB 2DGSA 3I5AA 2VC0A 1LK7A 3M8RA 1AB8A 1CS4A 2W2OP 2LQBA 2UVRA 1I51B 4ZKAA 1W7WA 3FBEA 4WFNQ 4OL8A 2UVVA 1ZZFA 4QWEA 3G9CA 4WIQA 4WPAA 4V19J 1S9GA 2LA6A 5HP1B 2AX0A 1X4FA 3VAFA 1VBXA 3G82A 3B4DA 3FFIA 4OHWA 1FFSB 3IS9A 1SQGA 3TWZA 2IRXA 4CNZA 3T5JA 1LW2A 5ETVA 3P96A 1FKAF 5KG0A 4DR5F 4DSFA 2P2CB 1DURA 3BZQA 3A12A 4WIIA 1HNVB 2Q79A 1M0SA 2AU0A 3K2YA 1N0VC 1MMDA 3TRGA 1UWAA 2CYYA 4LRFA 3SSSA 2UUTA 3T41A 4ZVSB 3AD7C 1RXOB 1YJUA 3KFWX 3QGHA 1S9EB 1IBKJ 1VRUA 1Y0HA 1Q78A 2B5JA 3FRZA 4EO6A 4C11A 4ICLA 5K8MA 2HQ3A 3HVTA 2NR0A 1Q79A 4DHVA 2C2OB 1X31C 4ZVTB 1K1SA 3ZFVA 3MMBA 2LECA 2RU3A 2Z2YB 3CJ2A 2J0SD 3M30A 1QSSA 4FXWA 2G4BA 3A8IA 2DT9A 4LSNB 5KOXA 2H51B 2OFGX 4OYWA 4FVMA 1VIOA 1U45A 4DPYA 1Y5IB 1HHTP 2H9ZA 3M9MB 3RB4A 1ZOTA 3ZTPA 4B9LA 5D4PA 3RBZA 2F40A 3GJSB 1DQ9A 4CLWA 1OY8A 2DY9A 5C2GA 3G82B 3NNAA 1TUVA 2A3JA 3FFIB 2ZVSA 1BWVA 2RMLA 5CH7B 3IS9B 4DV6J 4PYDA 1YRXA 4FBTA 2ZBIA 4KRWA 3AD8C 1WWHA 2ZH1A 1KQSR 3FRYA 4GKKF 1Q4RA 1FEEA 1EX8A 3O8WA 4CH1A 5IZHA 3VGUA 3ENVA 3PDNA 1WUUA 2B7BB 3GIIA 1JLCA 3MR3A 1CG2A 4CCHA 1DFDA 1S49A 5LMUF 1LV5A 4Q0BB 4CRJA 4AL7A 1VIXA 4KPYA 4RUAA 1NEEA 2C1EB 3BPSP 2V34A 1Y5NB 2F8MA 4O4RA 2PO4A 2B5JB 4C11B 4ICLB 2B9XA 4DL6A 1RWKB 5JVHQ 5K9FA 2DJWA 4MKAA 3NG8A 3HFVA 1RI7A 5I3UA 4O3SA 3GYGA 1FT8A 1Y3JA 1ZAVA 4DXLA 1SBRA 2HVZA 3M30B 4CT8A 1Q0NA 4M5NA 2MB0B 3DRRA 2V94A 3BGRA 4PXBA 3GFHA 2HBQB 1DLOA 3K5PA 1NDLA 2NXEA 2W4PA 3IA0A 4IFYA 5B08A 2ZHBA 4EK2A 3D67A 3TOQA 4PQUA 2JLEA 5B0FA 4J9PA 4LBPA 3KTQA 3A4TA 2ADBA 2E5JA 5L8RC 3M2UA 2N82B 2C3YA 1WOPA 2GQQA 2P8IA 1FWKA 4DDFA 3BDPA 2OTJS 1RTHA 1WC4A 2PEHA 2AW0A 1FNXH 2YKOA 1XWLA 2JEIA 1VQYA 2RDJA 4CTAA 3GJRB 1R6YA 3GYXB 3PIOQ 1O5JA 4Y65A 3LGHA 4KGVB 2LEAA 1PJ7A 1WC6A 1X4BA 5K14A 3BBFA 3CJTA 1FCAA 2ZKTA 1R3NA 2VA2A 2FYXA 5EX0A 3QGPA 5ADZA 4FYYB 2EFGA 3PR4A 4FYDA 1EKSA 1U0HA 4WXOA 2HHUA 5KG4A 2JFDA 5LM7E 3N6LA 3BPDA 3UD3P 4KO0A 3D68A 4LVOP 2IAJA 3M8QA 2AMCB 1WOOA 1NUEA 3JSRA 4DF4A 4WYWA 4PYAA 3BREA 2B0GA 1A9NB 4NX9A 3E3XA 3TVKA 4FS1A 5F0UA 3MD1A 1HMVB 3VQSA 1BLUA 2D3UA 4ZN1A 2LXIA 1VBKA 1CULB 3I96A 3MAAB 2MZTA 1IR0A 3VGSA 3DRRB 3RR7A 3BGRB 3GU0A 5KFVA 1DLOB 3TEHB 3F0NA 1T11A 2XSJB 4IFYB 1AROP 3JS9A 3DI6A 4RUCA 4S0MA 1MWZA 2OD6A 1C1CA 3NGSA 1VK3A 1IKWA 4PQUB 1PILA 3QRPA 4RNOA 3CF5Q 4EYIB 3TO8A 3HHKA 1IUJA 4OZJA 2E7WA 2CUYA 1TL4A 5HBMA 1IBLF 2HFSA 5HN0A 1RDRA 3P6YC 1R8HA 2CA9A 3TQEA 3TANA 1NCLA 4ED3A 2JLFA 3LALA 1NB7A 4CTAB 1DY3A 5M2PA 5D4LA 4U95A 3OD2A 2QA4G 4YB6A 2ZD1A 4LF1A 3V4MA 2CQ0A 2YNIA 5IM0B 1LWEB 2DR8A 1YZ6A 5K14B 2XWXA 3N79A 2EC0A 2ZDPA 3SZ2A 1VQ4S 2LYVA 1ZS6A 1YDLA 3UN2A 2Z2LA 5FDLA 4IRCA 3S8SA 4QWDA 1EQ0A 3PX6A 4ED8A 4Y2KA 2ZH2A 4UY8T 1TUGB 1UVNA 3KJVA 1LKZA 2UP1A 2HBYB 3WX8A 2PD1A 4DSIA 1IWAA 2IPOB 2HVDA 2R42A 3QNWB 2X3GA 3B82A 4CLLA 1XMQJ 3UCGA 3HD1A 4JI0F 3FGVA 4A8XA 5DDPC 2FHOB 2WSCC 3SCJE 2L3MA 4DQRA 4WP3A 3EZ5A 3SXLA 3GCXP 4DV2J 2QFIA 3WZ0A 2GO9A 4DU7A 1HW9A 4K4VA 4I64A 3I56S 4QYZJ 3G87A 1F9FA 3HHLD 1T9UA 1QJHA 3A13A 1RU2A 1C1CB 4ETZA 2V8PA 2C2ZB 1IKWB 2CQ3A 2W9CB 4PXCA 2U1AA 1HNIA 3KK3A 4X4QA 1QVFR 1WG4A 5HBMB 2QL7B 2CJKA 3QIPA 1JX4A 3GP9A 1BE4A 2XEXA 2DO0A 3OTCA 2D9PA 4FKXA 2C3MA 3CJ0A 1W2IA 1Y7PA 1FE0A 1R8AA 2I0XA 2ZD1B 4C9DA 2WSFC 3D6HB 5HMWA 1UVLA 3T1YF 2XULA 4A8WA 3OBIA 3MF5A 5CQGA 3CDWA 2BZ2A 1KOHA 3RB3A 4M5IA 2W01A 4LF7J 2BRLA 2BA9A 5SUHA 2XZWA 4JI1J 3BGFA 2WRMA 3SYZA 2V2QA 4K8RA 4K0KJ 1VQPS 2F8EX 1JXEA 4DX5A 3RRGA 1YJVA 5BR8F 3UDLA 3WQPA 3KJVB 2BANA 4URGA 3I87A 4HTIA 3OVAA 4X4NA 2UUWA 3WIVA 1HHSA 1GMUA 1TFWA 4LJMA 1SJ4P 2NZ4A 2RS8A 3DMJB 3C6UA 2ZJRQ 5DQIA 2HGMA 1YKWA 4ES1A 3PO4A 2YQ3A 1YG0A 2LP4A 3MM6A 4DG1A 1SIWB 4DSJA 4BCAA 4LF2A 3I0RA 1XNRF 1Y9OA 2FC9A 3W5ZA 2IM1A 2DR9A 1FRKA 3K5MA 2EC2A 4W98A 2XY6A 2H4YB 3QYYA 1S97A 4PWDA 1HNIB 4P10A 3BYPA 2CQHA 3KK3B 3C2PA 4G3IA 1SKWA 2EFOA 1CJKA 1MMLA 3GE9A 1N34J 3NP5A 1R31A 2MSTA 4OI6A 1RTIA 4BWJA 2XI3A 4ZCIA 1T0TV 3K58A 4HT7A 5IQQA 3JB9k 2DGQA 1R89A 2OMOA 3HFKA 1EETA 1NHUA 4A8YA 2MXYA 4R25A 3AH6A 3EUNA 3U7JA 1P1TA 1U1LA 3V4IA 2KFZA 3W9JA 3AOAA 1U02A 4C98A 4W4MA 2BQ3A 1RWVB 1RTJA 2QEXS 4UZCA 3FDSA 2BJDA 4C8LA 1FRJA 2X1BA 2NXNA 2CPXA 1JIHA 3FQLA 5A6WA 4Q2MA 4NLOA 4NMLA 1HARA 4K7QA 3U02A 3W2WB 3V6KA 3TARA 5LJ5Y 1JKHA 3OT9A 2K7KA 5F8HA 4RBTA 1NJZA 2Y8WA 4ZPWR 2BDPA 3ILLA 1HWIA 1RB0A 1EHWA 4F2RA 2FY1A 1NBEB 1P8GA 3I0RB 3M8WA 5IT4A 5B0CA 2CG8A 5C24A 1Q86T 3UNGC 1Y11A 2E5IA 4RWXA 2VODA 3QJJA 1BQNA 1B7FA 3MOZA 1G2EA 4K50A 2CJAA 1U47A 4H4KC 2V5HG 1L3UA 3GILA 3MMCA 1CJKB 4AD6A 2DXFA 2YX4A 1RAFB 5ETMA 3W8PA 3GZ7A 1F0XA 4OJGA 3O2IA 1QAYA 1WHVA 4HKQA 1NPKA 1RTIB 4A8SA 2VOPA 1WEXA 4HDGA 4DQSA 2FC8A 1FDDA 3C46A 3UDEA 4Q45A 3RBXA 1EETB 1N33J 1N0UA 1T9XA 4UQTA 2R9LA 1RBAA 4PXEA 2ALZA 4XAKA 3V4IB 4B9VA 1HNWJ 2VFTA 2KM8B 3JAMU 4MFBA 4HHJA 3N4WA 1RTJB 3OXLA 2CNOB 4WP8A 1S4EA 3MCSA 4C8MA 3P49B 1RLDA 1NKBA 2XTJP 2AJQA 2ASJA 3QIDA 4KE5A 3MMJA 2QX0A 3EGNA 4LFCJ 3IBFB 4IYQA 2DD8S 1I6JA 1N6QA 5HMZA 4I69A 2B9EA 4DV6F 2VICA 4DQIA 1Z2LA 3BSCA 1HNZJ 2GNKA 3T3FA 1JKHB 2Y8YA 2RF2A 3MFIA 2LU2A 1C1BA 4J7CA 2OSRA 3Q8RB 2RQKA 1I94F 1DQ8A 2KYZA 1LW0A 5KFLA 3KNAA 4N5SA 3DXSX 3U1LA 2PT0A 2CQDA 4UTGA 3TAPA 4WWSA 3J7AN 3IMQJ 2W2QP 3A3PB 3QPIA 2YWKA 1UFWA 2LQJA 3HSGA 4KBIA 1QAIA 4EYHB 3VV2B 4JUZA 2VKRA 3R8YA 3KJQB 4MH8A 5C24B 4ID5A 3OL9A 1RT4A 3FC9A 4DPOA 5KT5A 3IXQA 1BQNB 1SI9A 1U1MA 4Z37A 4YR3A 3KDNA 4KYZA 3NAHA 4FN5A 3MMCB 4OX6A 4AFFA 2DGVA 1U8SA 1HQUA 4MYUA 3K8VA 3GIRA 2F4FA 4A8FA 2V67A 4QW9A 4DFKA 4NLYA 3O6QA 4FBUA 2FJDB 3SFUA 2YX7A 3HSDA 4A46A 3EGZA 1JLAA 2UU9J 2BJ7A 2AEJA 3TP2A 3MECA 1N5VA 4Y28C 1WI8A 3DGPB 1FX2A 2F65A 4EI2A 3NS7B 2M5YA 1SCJB 4QWCA 1QSLA 4MFBB 2DK2A 2GJ2A 1T03A 2CQIA 2OPQA 4ECTA 1SV5A 3VAIA 2C42A 4O44A 3IBWA 2P9GA 3I4PA 1NK9A 2C2NA 3OHBA 4PPDA 1KONA 2R7SA 1FKOA 2I9SA 2DNHA 3JYTA 4LR7A 1RWWB 3DM2A 1FWLA 4GRSA 3UVJA 2LQ9A 1FWPA 4DUZF 5KFXA 3TJ8A 1C1BB 3HDSA 4F4XA 1LW0B 1U26A 3IP0A 4ZPTR 3TAMA 3I31A 5KOWA 3OPKA 3W2VA 1OYDA 5DM6Q 5HO4A 3VAMA 4LF5J 1HBUA 1YJWS 2N7YA 4C8ZA 2O66A 4XDDA 1VQ9S 1NJWA 4RNMA 1KQKA 4BDPA 3GIKA 3E51A 1K73T 1X4CA 4P7TA 2VJUA 4C3LA 1NRKA 1X7VA 2DH8A 3R2CJ 1ZAXA 2AJ4A 4K2XA 2ERRA 2CQGA 3H4DA 3DC2A 4RLEA 1N48A 1HQUB 1WNEA 2ZOFA 2KT2A 2FLNA 2VDIA 2XMVA 4XO0A 1S10A 5H9FJ 1VMBA 3BH6B 1WTFA 2ACYA 4DN9A 2PMZD 2GX8A 4C6AA 3DLJA 4X4OA 2V9WA 3MUVP 2MPUA 3M8SA 3KMSA 4HT5A 1JLAB 4O4GA 3THTA 2VPZB 4N56A 3S01A 3EGVA 2HK3A 5DG7A 4MK9A 1HFEL 1KR4A 1H2VZ 3HXMA 2QE5A 2G1DA 4DL3A 2VDHA 5A8WA 3SDEA 2DHAA 3I5BA 1U48A 5CHCB 4ENOA 1DTQA 1T03B 3V81B 1REGX 4DR7F 2HFZA 1T8EA 1UVIA 4BC7A 5C42B 5E0OA 3Q8QB 3K7RA 4O44B 2GS8A 3PKMA 3AJDA 3DHXA 4F4YA 3MPYA 2FJEB 1U2FA 1HNXJ 3G6XA 2DNLA 4ZPDA 3CDBA 2W9BA 5T41A 2UXDF 2X7IA 4NYZA 4USMA 1FJEB 4UOFA 2DY1A 1RT7A 2YWEA 2VD3A 4DR2J 2WB1D 1O51A 1IN0A 3G8SA 2NPIA 1S79A 5JMNA 5AE2A 1FD8A 1U7LA 3OFFA 4PUOA 1J27A 1HBUB 5DLGA 4J9LA 5CZVA 4L6V3 3ENAA 1EB0A 3RBEA 3I9V9 2F8HA 2NXJA 4R5PA 2IHR1 4GVBB 3AQOA 4GO5X 1GQEA 1G4CA 2L9WA 4P72A 1RHJB 1KLMB 3ETOA 4M5LA 5AE1A 1PBAA 2JDJA 3AB4B 2K3IA 2AP6A 1YGYA 4L75A 1VC0A 2ZC4A 2X1GA 2MKKA 1SKRA 3MWBA 2IA6A 3BN7A 1NDKA 4FF2A 5HVFA 1S57A 3QMQA 1P9YA 4QIFA 2ZH7A 1KQGB 4WFXA 1CPZA 2ZHAA 3GJQB 2Y9HA 2DNMA 4JI4F 2B43A 2FVSA 2QA1A 2VONA 1M5OC 5A8WB 3SDEB 2JX2A 1T02A 1DTQB 2HGNA 4DMZA 3VAHA 2DB1A 2HWIA 1Q8KA 1RP5A 2MZSA 2XZTB 4I7FA 2QRRA 5LMNF 1VQ7S 4K4SA 2OEKA 5KFWA 3B6BA 3CJ5A 5DQGA 3RAMA 1E6VB 4Y2CA 4ZHRA 2W9BB 2VPYB 5CYJA 3IBCB 3M1VA 4ZJLA 1RT7B 2ATCB 4OYOA 3JQJA 2JEFA 2VASA 3SQGA 3TZXA 3MM5A 3PFOA 2MKSA 3PYDA 3M6VA 1Z1ZA 1YJ9S 1QE1B 4DSLA 4PUOB 2B4UA 2RKIB 3JXOA 1OSDA 2QLBB 2PN6A 4M5JA 1J5OA 4TNOA 4F0KA 2W25A 2CPYA 2I8EA 4LF7F 3PW7A 2ZFHA 4EMDA 3AAWB 4JYAJ 4R5PB 2W4DA 2WVDA 4ELUA 4OZ2A 4C4WA 3TVZA 2UXCJ 2AWZA 1GFWB 2CZ9A 1HI8A 4ED5A 2E9ZA 2V63A 2VBXA 4KH1B 1S1XA 3KUEA 2CDQA 2ZZTA 3RG6A 3MTKA 4DFPA 5C25A 4ZPCA 4JV2A 3N5BA 2BW7A 1FE4A 4OHXA 1HBNA 2IJFA 2HHHJ 4TLRA 3M6UA 4PPZA 4UZBA 2L08A 2JVRA 2R7XA 4QPTA 2ZUGA 3MEDA 3OFGA 2FVPA 5ETLA 1SIZA 2HYIB 3TX8A 3LO3A 4WCEQ 1XR7A 3Q24A 2MQLA 2ZBPA 4GC7A 4I7FB 4JV5J 4USVA 4DV5J 5B0AA 4LFAF 1N34F 4P2MA 3BV8A 2VIHA 1RYSA 2JC0A 2GVDA 3UFCX 4ZHRB 2W2MP 2F63A 1KHVA 3BYRA 1U1QA 3K17A 2OPRA 3M1VB 2BMBA 1FNMA 2OP5A 3RRKA 3GCWP 2BJ1A 2J7WA 4MIBA 1SJ3P 1S99A 2C2EA 3BJYA 3SV4A 2O5DA 3CSKA 1CJTA 4USKA 4ZS6A 1TU0B 1MSWD 4OHZA 1M5PC 2V8GA 1JK9B 3UR0A 3DFEA 3KLHA 1J5OB 2YWWA 1OQ3A 2FLPA 1VRTA 2W7OA 1PAUB 3PW4A 3U1NA 2VH7A 2FZCB 3Q2SC 4J37A 2RU9A 1IR1A 5J2MA 2BE2A 1XMOF 3M2RA 2DGUA 4EFAC 2EK1A 2G2ZA 1NSKL 1UKUA 3KWMA 4P52A 2K7JA 4XPEA 2Z0GA 1KTQA 2VA3A 4BC9A 1WHWA 1S1XB 2F7VA 3VTIA 3IM9A 3ULHA 4LT6A 2QZ8A 1JLFA 4OJ1A 4EBCA 4I1TA 2VQEJ 5C25B 3IG1A 4F50A 5IXUA 2VKZG 3KHRA 4YOEA 5KT7A 4WTOB 1MMNA 3UNYA 2ZITA 3JTNA 1T3OA 3D9BA 3R5AA 3PV8A 5D3GA 2M7SA 1JQGA 2WSEC 2AEFA 3FUYA 1RTDB 1U1KA 3OR1A 4RW4A 3SV3A 1U8WA 1CLFA 1CBKA 3KLIB 3M9OB 1KNZA 3BB5A 1EP4A 4NL5A 4EU0A 3N5FA 3NEKA 5GAHI 5F8IA 1U2CA 3GR0A 4J90A 2GVZA 2VOOA 1Y00A 4U8YA 3M32B 5H9EJ 2D3OR 3ILJA 4QIVA 5U47A 2BE7D 4NLRA 5BYQA 2GVDB 1U6ZA 2HNZB 2YKPA 4P75A 1NHVA 1L3TA 2R7TA 1FVQA 3TZWA 3P4UB 3BSAA 3CVKA 1N52B 1Q5YA 4RUHA 2X1FA 2OI2A 3PX4A 1JLBA 3BO3A 2MGZB 4HHUA 4P9SA 1RAJA 4X4VA 5IT9Y 4ECSA 1PC5A 1ZA1B 4HEA9 1EIYB 4DUYF 1RK8A 4Q5VA 2B8PA 1HNWF 2HNDA 3MPUB 1TKZA 1RHQB 1T05B 1VRTB 2KG0A 3ETMA 5KFSA 2RSQA 3ZXWA 3L95X 4BS2A 4UOHA 2W2NP 1TAUA 2CNKB 4O3PA 1UVMA 2DNKA 4NRTA 1V3RA 5J2MB 2JRSA 4LFCF 5AXKA 3M8YA 3SCLE 4DS4A 2KHCA 5BYSA 5AE3A 1X5PA 4WFBQ 2HMIB 3HT0A 1RWPB 1F2HA 4Y34A 3EICA 4NLUA 2EW9A 1JLFB 5L9NA 5K8PA 2R7QA 3IG1B 1BGXT 4ZVGA 2N4CA 2VV5A 3CW2C 5FLXY 2PI5A 2VBYA 5D3GB 2DHHA 5DDRC 1KSPA 3QBCA 3PKYA 4ELVA 4ALZA 3OR1B 1N36F 5J1EB 4RW4B 1UVJA 4ZIVA 5E3RA 4EBDA 4CLTA 1EP4B 2CPIA 4CZCA 1RJJA 3NMAA 4NASA 1S7HA 4JB8B 2IVYA 5A2QU 5FIIA 4WFYA 4Q8FA 2K2PA 4HACA 4P6QA 3HHLA 2NSBA 3TA0A 1FRLA 4PG8A 1JLEA 1QAJA 1SH0A 3Q83A 5HANA 2H1YA 2HVHA 1V3SA 2DCLA 2ROEA 3DLKA 2AX1A 3ZZYA 1WKKA 2HPUA 5CD4H 3OUYA 2MLYA 3DRPA 4FXVA 1M5VC 5GAHU 2HZVA 5KFCA 1VHIA 1UAWA 2DISA 4TQRA 3D1HA 3SCIE 4F7VA 2PI4A 2GW8A 5ETNA 4QWBA 2FHMA 3BBBA 5ETRA 2O01C 1JLBB 4GKKJ 2WONA 3QWUA 1L3KA 1TV6A 1KN6A 1GTHA 2CPEA 3MM7A 1FO1A 4XDCA 2E1PA 3DLGA 2HNDB 4V1Ak 3PJ9A 1NU4A 3CD7A 3GG1A 3DLHA 5LMUJ 3HVWA 4AXJA 2HHWA 1H38A 3CCJS 3T6JA 3OW2R 3OTOF 5KFPA 1SQEA 2BM1A 3PYFA 5KFKA 3W3SA 4LFBJ 2XLKA 3C3LA 4LR9A 2DGOA 3KLGB 4M63A 2XHCA 4ED2A 4C48A 2LCWA 1X4AA 2V4JA 1D3WA 3R5BA 2YX1A 1Q53A 1HQEA 4ZVHA 4WBFA 4HI2A 2WHOA 4YHHF 2HHSA 4TY8B 5A0YA 2JSXA 3VAJA 5D4NA 2KVQE 1RISA 3HK2A 4IG3B 2LEPA 3MURP 3HHNB 4C8YA 1XK8A 3J81Y 1N8RT 1OO0B 4IR1A 4M5MA 2LMIA 1HQ2A 4TN2A 1ELOA 4HACB 1ROFA 4UY85 1JLEB 3CJRA 4W90B 4TKTA 3GFXA 2MTLA 4F4ZA 3QAUA 4QJVA 2FJVA 4KAIA 2R2UA 3KK1A 3KJFB 3DLKB 3CULA 4DPUA 3OUYB 4AL5A 3DRPB 2XYGB 2UXBF 3L7OA 1WC0A 3DOLA 2D1CA 4PZVA 2H54B 5G0RA 1HWJA 1SH2A 5AJ3F 1PCAA 5D78A 1TL1A 1EARA 1TV6B 3CIMA 4O23A 1XEZA 3GPAA 1WSRA 4YB1P 2EKNA 1X5OA 3G4SS 1NZ8A 4D3HA 3WC2A 3MM7B 2YKNA 1GX6A 5IV3A 5BYRA 3DLGB 1X9MA 1SKSA 1NK7A 4WP9A 1KHWA 2CPJA 2YPYA 1QDUB 3PR5B 1V5IB 3JQMA 2C3PA 3T6BA 3OTEA 4DV4F 3AXMA 4Y0FA 1PYOB 2Y0SD 4B02A 5E7OB 3MHYA 1HNXF 4CLFA 4OI3A 4M94A 3GJTB 2Z4PA 4N8NA 2AJ1A 1J5EF 2RRBA 1R7IA 1S48A 1HWKA 5DDQC 4PEOA 3Q2TC 3PX0A 2E1MC 2R7RA 1SJQA 2IMOA 3BDEA 4QIEA 2RB7A 4MKBA 3BQ2A 1HQEB 1F6TA 4RBVA 5A0YB 2G2OA 2C28A 1XNQF 3GLJA 3DOKB 4U7UK 3UPFA 1BHNA 4PRFA 2KXNB 3A8EA 1JXVA 3B4MA 1HLWA 2HFNA 3FSXA 4B3MJ 3DLBA 3VF0B 4ZVQB 1ICEB 4M8LA 1U1NA 3QFWA 4QQBA 2MKYA 3H0PA 4WZQA 2Z2MA 2XWYA 4DLGA 3HKWA 5D15A 2IY5B 1F9EB 3KK1B 3W62A 2Y1RI 3HJVA 4NLQA 3IRXA 2GCFA 1IBLJ 4URQU 3DOLB 1K1QA 5DGAA 1CJVB 4P73A 3DDNA 5E5NA 1TZ0A 3OHAA 2NQPA 2LQ8A 2O3DA 1S9FA 3DRXA 2WOMA 4QOTA 4ANCA 2YKNB 4DEZA 1TR0A 4WZMA 1XN9A 3M05A 2O1PA 3NY0A 3FSYA
chains in the Genus database with same CATH topology
2VG7A 4ES1A 2KYXA 3PO4A 2YQ3A 2CPDA 4F3OA 1HYSB 4RBUA 1YG0A 3LAMA 3PFEA 3MM6A 1KLNA 2OPRB 4DG1A 1Z4UA 1U1PA 2R8IA 1SIWB 2GV1A 5I3QA 5EWEA 1K0VA 1HR0F 3U1MA 1ZZNA 4DSJA 4BCAA 3RB0A 3R1LA 1R8CA 2ADCA 2OJ3A 1V9OA 3I0RA 4I6AA 4MKYA 1Y9OA 1XNRF 2FC9A 1Q1KA 3D28A 1VRUB 2QFJA 2IM1A 1NJYA 1FJGF 1GH8A 2DR9A 4I67A 1N33F 1NJIT 1FRKA 2J8AA 2JFKA 2E44A 4HL9A 5HROA 3CD6S 3FMBA 3K5MA 1U09A 2ZJPQ 3BR8A 3HVTB 4X65F 4IG0A 4C8KA 2F1FA 1FK9A 1YTYA 5B0GA 4YFUA 1N4LA 1L5UA 2XY6A 2CJ9A 2OTLS 4Y2IA 2DGTA 4DR4F 3GFYA 3QYYA 4CT9A 1UMJA 3MAQA 2YH1A 1S97A 6FDRA 2I2YA 2QMXA 4PWDA 1HNIB 3KLHB 2CQHA 3KK3B 5F0WA 3C2PA 4G3IA 1SKWA 5F8NA 2EFOA 3DDKA 1H3DA 1VQSA 5F41A 1T95A 1VFJA 1MMLA 3MMBB 3GE9A 1S72S 3OFEA 1S1VA 2KT3A 3E01A 5JXSA 2M8DB 3NP5A 1RT1A 2FJXA 1R31A 5J1NA 5CCMA 1TQLA 4PQAA 4IDKA 2MSTA 3UR3C 4OI6A 2R2TA 3KMQA 1RTIA 4BWJA 5KFUA 2BE2B 1GTEA 1UJ5A 2XI3A 2VG5B 3M2RB 4ZCIA 3DCAA 4OQJA 3FVYA 5LSOA 2D3ZA 1JJ4A 2XBPA 4R0JA 4RW7B 1FRMA 2QLXA 4ZMMA 1RWUA 3QZ8A 1DARA 3NNHA 1WG5A 3K58A 3T5HA 4HT7A 5IQQA 3JB9k 3NS6A 4JYAF 2BRKA 2CJQA 2DGQA 3CWJA 3ISND 3N6NA 1E6VA 4JI6F 4NA2A 1CC8A 1R89A 2IM3A 2IVFB 2OMOA 3PJXA 2UVUA 3HFKA 1HNZF 3NMRA 1EETA 1NHUA 4UOCA 3WC0A 2MXYA 4A8YA 4URSA 1BC6A 4PG4A 3CIZA 4O3OA 4R25A 3TUJC 3IR7B 3M9NB 2UXCF 4X2BA 3AH6A 3EUNA 5EWGA 2W7AA 1N88A 3U7JA 4LF6F 4NYPA 3SMZA 4F3MA 1P1TA 2J7UA 4K4UA 5CA5A 3PXGa 1U1LA 1VLYA 5SZTA 1MROA 3GYNA 1TKXB 4WKYA 2KFYA 1IKVA 5DDOC 3V4IA 4WXWA 1VK8A 1NJXA 2DRBA 4ERDA 2WK4A 2FHJD 4C98A 4YDDB 4X4UA 1H2UX 1URRA 1D9DA 2KI2A 3IRXB 5B7WA 1SUQB 5HQ8A 1JMTA 5A2QY 3K5LA 2BQ3A 3PO5A 1QE1A 4HI1A 2QEXS 1RTJA 4RW6A 2RKIA 5B09A 4J9KA 2P9EA 3FDSA 2MZQA 2BJDA 1ZBTA 4K59A 5K5MA 5T7LB 5KFZA 2VQFF 4C8LA 3DLLQ 1FRJA 4MYTA 5B0DA 4B9TA 2X1BA 4PCQA 3V5RA 1AUDA 5CYQA 1LK5A 2XMKA 2FJBB 2CPXA 2RJZA 2NYIA 2XC9A 2FTRA 1JIHA 3MR5A 1ZTWA 3POTA 1NKEA 3FQLA 5A6WA 2LDIA 4DF8A 4Q2MA 4NLOA 4NMLA 1HARA 2J6TA 3U02A 5F8MA 3U27A 3M2VB 3W2WB 2LXUA 3V6KA 3TARA 4LMZA 2B56A 5LJ5Y 2ZH8A 3SFGA 2WOMB 2HHTA 1JKHA 1XC9A 4X4SA 2ZE2A 4JOUA 1JJ2R 2K7KA 1X4EA 1D9AA 2P6TA 1Q16B 2V4QA 3J7A1 1NK4A 5F8HA 4RBTA 2EFVA 1NJZA 1VJWA 2J9CA 1QUVA 2GIQA 2J9DA 3PW5A 2PIIA 3EX7B 1JLCB 1FESA 1YRTA 1D0EA 4I0WA 2ASDA 5KFRA 4U6PA 4QR2A 5DGBA 2B6AA 4ZPWR 4MTPA 2BDPA 3CXCR 2ZH4A 1FNOA 2XHWA 5KG6A 4C3KA 1HA1A 1JWWA 3PW0A 1HWIA 3CCES 4J9MA 2VG7B 2CVIA 3CCQS 2E1AA 2JZ5A 4JV5F 3CMAS 4F2RA 2FY1A 1UEVA 1KFDA 1P8GA 2VBZA 1H6KX 1H7XA 2DIUA 1G6BA 5M2UA 1KEKA 1I1GA 3I0RB 4B3TF 2V8HA 4F26A 2IA0A 2AYEA 4OJ3A 3O3LA 5IT4A 3M8PA 5B0CA 4Q44A 2GMHA 5B0BA 1WEZA 5C24A 4J9QA 3UD4P 1P9QC 1IQZA 1Q86T 3UNGC 2UU9F 5HROB 2E5IA 4RWXA 4C0HA 5L9XA 2VODA 3QJJA 1BQNA 1C0UA 1B7FA 3MOZA 3R5DA 1FK9B 3IR6B 3HP6A 1G2EA 1Y4ZB 4K50A 4E8UA 2BM0A 1G3OA 1V3ZA 2CJAA 4DR3F 1FD2A 1U47A 1HWUA 4TU7A 3M4XA 4H4KC 2V5HG 1L3UA 1T7PA 3GILA 4C8OA 2AGPA 3JTPA 5I3UB 3MMCA 4YR2A 1TKZB 3FMWA 1Q8BA 3AA8A 4ZLPA 3OXGA 2R2RA 1AFIA 5CYMA 3V6DA 2YX4A 3FEZA 2AV5A 2COLA 3NS5A 3KLFA 3GZ7A 1S1VB 4OIXA 1F0XA 3E01B 4OJGA 4TQSA 3O2IA 4OX8A 1QAYA 4IDKB 2HS3A 3AB2B 1WHVA 5BJRA 2QA2A 1NZAA 4HKQA 3TW0A 1HD1A 1RTIB 4FXDA 5GVQA 2JWNA 4RZRA 2ZH3A 1H0HB 2YH0A 3TR5A 1SXLA 4LSLB 4A8SA 3DRSA 2VOPA 1WEXA 1OSCA 5KFGA 2E1RA 2LU1A 5IT0A 4J9NA 4HDGA 2WBRA 4DQSA 2R7WA 4QBUA 6FD1A 3NKYA 4RW8B 2FC8A 3TA1A 1UA0A 1FDDA 4IO1A 4DL0C 4C0BA 4EGLA 2YKMA 2QA4S 3C46A 2ZJQQ 3H98A 4Q45A 3H5YA 4LF9F 1HPZB 3CDAA 1HI1A 4C7QA 5KFAA 3MPWA 1EETB 1R8PA 3I0SB 1AFJA 1Q82T 3OLAA 3R3TA 3WBZA 1N0UA 4UQTA 4KHMA 4KTQA 2R9LA 4WKRA 2HS0A 3EXYA 3IWXA 1S1UB 5KFTA 1FF2A 2OAUA 4CIOA 2CPFA 1Y3KA 2G0CA 4PXEA 2JHEA 2ALZA 2M9KA 4XAKA 3KHHA 5DO2A 2N3OA 3V4IB 4B9VA 1IKVB 2VFTA 2CQBA 2KM8B 2IYIA 4X64F 2ATLA 3GMGA 3M2UB 4YQWA 2DH7A 3LP2A 1GT8A 2E7XA 4MFBA 4HHJA 2DTJA 1N5TA 2JJ4D 4QPXA 2VQEF 2R8GA 3N4WA 1RTJB 2HRUA 4RW6B 3OXLA 4KR0B 1MW7A 4LIWA 2QMWA 4LVNP 4LF5F 1WI6A 4TLQA 2G9OA 3MCSA 4C8MA 3P49B 1RTHB 2B9YA 3MD3A 4KSEB 1NKBA 1QVGR 4NPOA 5AXLA 4ILMA 2AJQA 2ASJA 2UUAF 5FJ4A 1N54B 3QIDA 4KE5A 1VS3A 3EGNA 3MMJA 5CYQB 1OWXA 5MAOA 4ED1A 3CGIA 5HMXA 4IYQA 4IFVA 3IRWP 1B0PA 2DD8S 3POTB 2E5HA 1I6JA 1JLQA 5JJBA 1N6QA 5HMZA 1YIJS 4I69A 1GXTA 3N28A 3PEJA 4ZP7A 4MJKA 4OZNA 4DV6F 2C22A 3O44A 1D8YA 1YJRA 4DQIA 1Z2LA 2XCAA 2MSSA 3BSCA 3UDCA 3QO9B 3VQTA 2N3LA 3CC2S 3HHLB 2QV6A 2GNKA 2MQPA 2EFPA 2R8KA 2DITA 3T3FA 3QLHA 3LH2S 1JKHB 4NLVA 4X4RA 4K4TA 4V19X 2RF2A 2CZVC 4IH5A 3MFIA 2OH2A 3CJKA 2XI2A 1S6QA 2WCXA 2ZE2B 2M8HA 4LSNA 3NNCA 2LU2A 1C1BA 2OSRA 2CQ1A 3Q8RB 2QIFA 3ZZPA 4RW9A 1BQXA 2RQKA 4DL5A 1I94F 1UW4A 4J9RA 1DQ8A 2KYZA 1LW0A 4OJHA 4GC6A 1REVA 5KFLA 3KNAA 1OIAA 4N5SA 3SSRA 4NXMF 3DXSX 3BF4A 3U1LA 2RIJA 2DPJA 4TU9A 2PT0A 1NH7A 2VZ9A 2CQDA 3FSIA 2B6AB 3TAQA 4HTJA 1D8ZA 3IC1A 3TAPA 1RT3A 4ILLA 1SJRA 1FKPA 4K4YA 2VPXB 1FHTA 3DN9A 3QPIA 4B3OA 2YWKA 3BQ0A 3PW2A