2D9PA

Solution structure of rna binding domain 4 in polyadenylation binding protein 3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
103
structure length
103
Chain Sequence
GSSGSSGDRITRYQVVNLYVKNLDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyadenylate-binding protein 3
publication title Solution structure of RNA binding domain 4 in Polyadenylation binding protein 3
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 8
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2d9pA01
3UCUP 3S6EA 2RS2A 1FXLA 1SJ3P 1SXLA 1WF2A 2LECA 2DNQA 4CH0S 2G4BA 2DNGA 2DH8A 2QA4S 3EGNA 3FEXB 1YJ9S 4F26A 4IOCQ 1M5VC 4W90B 2HGNA 2M70A 3PIOQ 2KFYA 2E5HA 2DNPA 2KU7A 1O0PA 1FJEB 2CQGA 2MQMA 2X1FA 2MGZB 1WG5A 2VOOA 3SMZA 1DHMA 4QU6A 2HZCA 2QFJA 1L3KA 2JWNA 2CJKA 3CMAS 3DLLQ 4PRFA 5JVGQ 1X4FA 1IQTA 5FJ4A 1VQKS 4LIRA 4WFBQ 2QEXS 1X5SA 4YUDA 2DNNA 1YIJS 4OZ0A 2CQIA 1X4AA 2LCWA 3TO8A 5DDQC 1NU4A 5LJ5Y 1RK8A 3H2VE 1VQ8S 1H6KX 1UFWA 1S72S 4YOEA 4CH1A 2AYMA 2GHPA 4P6QA 1M5KC 1WTBA 5LXYA 3CMES 2DGWA 4IO9Q 2DIUA 5ITHA 4C7QA 2YH1A 1OIAA 1KC8T 2I2YA 2DGOA 3G96A 2ZJRQ 3CCRS 5HO4A 2EK6A 2JX2A 3J7YU 3G8SA 2DO4A 1U1RA 3B4MA 2CPZA 3P5TL 3HHNB 1VBYA 2KRBA 2B0GA 1CVJA 2DGUA 2HGLA 2PE8A 2LEBA 2MQNA 2FY1A 3VAIA 1K73T 1Q86T 1AUDA 3IRWP 2M8DB 2MSTA 2KN4A 3BO2A 2L9WA 4WFAQ 1B7FA 3P6YC 1FT8A 1X4DA 1NO8A 2AYGA 2CQ2A 1YWXA 2RNEA 1ZH5A 3I56S 4YB1P 2DHAA 2VONA 3MD3A 5CYJA 2LYVA 2LA6A 2JRSA 4ED5A 3MD1A 4WCEQ 3BO3A 5IFMA 1WEYA 1YTYA 1N88A 1WEZA 1X4EA 1M90T 4WFNQ 3CF5Q 1U6FA 2CQCA 1WHXA 2DK2A 2E5JA 2KG0A 3JB9k 2K8GA 1VQLS 2O3DA 3CCMS 2DHGA 2RQCA 1JJ4A 2SXLA 2GO9A 1VQ7S 2ADCA 5DDRC 5D77A 2RT3A 3LPYA 1WG4A 1VQ9S 3MDFA 2N3LA 4W92B 3MXHP 4TLQA 3OW2R 2VOPA 4ERDA 1VQ6S 2E5GA 1WEXA 2XNRA 4C0OC 3G4SS 3ZZZA 2AYEA 3MUTP 2Q79A 3DXBA 2CPFA 5LXRA 3BO4A 5GAHU 2JVOA 2MYFA 2OSRA 2KXHA 1Q82T 2KM8B 5DDPC 1YHQS 3HI9A 1H2VZ 1W2BR 1QVGR 2MKSA 1KOHA 5MLCV 1YI2S 2KXFA 3P49B 4PR6A 3BS9A 3BEGB 4QQBA 5H1SV 4LMZA 1U1OA 1H2UX 1WG1A 5BJRA 1WELA 4M5DB 2MKHA 2J76E 2MQLA 3UWTA 4WF9Q 2M7SA 3NS5A 1A7GE 4FXWA 2MQQA 3THPA 3THTA 3UE2A 2MZQA 1WF1A 2RS8A 2KXNB 2CPHA 2MZ1A 5DM6Q 2RQ4A 3VAJA 5EN1A 2MPUA 3VF0B 3CXCR 1WI8A 2MHNA 1S79A 2MY7A 3VAKA 1M1KT 4WKRA 2ZJPQ 5GMKa 1SJQA 3P3DA 2YKAA 5GAGU 4EGLA 2DH9A 1DRZA 2YH0A 2D9OA 1YITS 4IOAQ 1VQPS 3UCGA 3SDEA 1SJFA 1PO6A 1JJHA 4Y0FA 3VAFA 4C4WA 5IQQA 2M9KA 1UAWA 2CQPA 2YWKA 1FO1A 2UP1A 2XS5A 2FC9A 2YTCA 5DM7Q 1UW4A 4QU7A 3CD6S 5IM0A 5DDOC 1X5OA 2F3JA 4UY8T 1FNXH 3V4MA 1G2EA 2LMIA 1DZ5A 2DGSA 3R27A 3G8TA 2EVZA 1HA1A 1R8HA 1X4BA 3ULHA 3K0JA 3MI7X 2N7CA 3N9UC 1VBXA 3UD4P 2MMYA 2DNZA 1OO0B 1VC5A 2RUGA 2WBRA 1KD1T 2RRAA 1D9AA 1DBDA 3CC7S 3SDEB 1VQ4S 2KYXA 4PKDB 4TU9A 1U1QA 1X4HA 3B4DA 2DNYA 3S01A 2OTJS 3CULA 2KI2A 1U1MA 3Q2SC 3PIPQ 1HD0A 2DB1A 1K9MT 1A9NB 2CQ3A 5IM0B 2PEHA 3CCLS 3CTRA 2XNQA 2M4MA 5LSLA 3G9CA 2DH7A 2FC8A 1X5TA 1M5OC 3EGZA 2DNMA 3L3CA 2DHXA 5HL7Q 2XB2D 1X4CA 2DIVA 1U1LA 3NNAA 2CPIA 2HVZA 2CPJA 1QVFR 2DNOA 2DISA 2VODA 4OZ1A 3VAGA 2AYBA 3D2WA 1BY9A 3MURP 1X0FA 1K8AT 2NZ4A 1SJ4P 3Q2TC 3U1LA 2MKCA 3EX7B 3CUNA 2KVIA 3NS6A 4J5OA 5CXTA 3CCQS 4BS2A 2LQ5A 2LKZA 4F25A 1VQMS 2DGQA 1FJCA 3VALA 1VQ5S 1WF0A 2M88A 5CA5A 1YJWS 1P27B 1WI6A 2MQOA 1JJ2R 2CPYA 3R1LA 4V19X 2LXIA 2LXUA 3H2UB 3NNCA 2OSQA 3CPWR 2OTLS 2X1AA 2MZTA 2MSSA 5JVHQ 2MKJA 5LSOA 2MJNA 2M52A 4ZKAA 2ZJQQ 1ZZNA 1WWHA 2KHCA 2DNRA 2RVJA 4LJMA 2D9PA 2KM8C 3NMRA 2FHOB 2N3OA 2N82B 3MUVP 2DNLA 2E44A 2MQPA 3LQVA 1U1KA 1VC6A 2OJ3A 2HYIB 5DETA 1F9FA 2G1DA 4UQTA 4F02A 3RW7A 1HL6A 2M0GB 3S7RA 3SXLA 3I55S 2F9DA 1OWXA 2DITA 2X1BA 2OIHA 5LJ3Y 1FJ7A 2LEAA 3CC2S 4Y00A 2MZSA 4FXVA 4CIOA 2DO0A 1D8ZA 1KOOA 3CCVS 1PGZA 3G71S 1SJRA 2E5IA 2MZRA 1WHVA 2LA4A 3U1MA 3CCUS 1R8PA 1URNA 2MKIA 2BOPA 3VAMA 1WHYA 2J0SD 2A3JA 3TP2A 3J7ZT 2NLWA 2U1AA 1Q81T 1UP1A 2M8HA 4WIIA 2G0CA 3ZZYA 1VQOS 1YJNS 2JVRA 2KG1A 2L08A 2J0QD 3CCES 2CQHA 5GVQA 2MB0B 2V94A 1RKJA 2XS2A 1X4GA 1VBZA 3MOJB 4TU8A 1Q7YT 2X1GA 2DGVA 1XN9A 2RU3A 1VQNS 4QPTA 2DGTA 2CQDA 1X5PA 2DHSA 2CPDA 2ERRA 2EK1A 4RU2A 2M2BA 4Z2XA 2DNKA 2RRBA 1H2TZ 4A8XA 1U1PA 2MJUA 3MUMP 4IUFA 1QM9A 3CCSS 1VC0A 2AD9A 4U67Q 2CPXA 1N52B 2CPEA 2DNHA 2MKKA 3VAHA 2K3KA 1NJIT 1M5PC 1FHTA 2MXYA 3CCJS 1ZZFA 3R1HA 2XS7A 1OPIA 2D3OR 5GADU 2CQBA 3S8SA 1U1NA 3NNHA 3CC4S 3RW6A 2MZJA 2F9JA 2CQ1A 4CQ1A 2J8AA 3G6ES 1N54B 2L41A 2BZ2A 2CQ0A 3IWNC 3UD3P 2I38A 1WHWA 2U2FA 5GAEU 2HGMA 2XSFA 1P1TA 2MGZA 2KH9A 5D78A 3FEYB 2FPHX 2MY8A 3TYTA 1U6BA 2KRRA 1N8RT 2DGXA 1KQSR 2ADBA 1JMTA 1U2FA 4TU7A 3US5A 1HD1A 3UCZP 2KT5A 2CQ4A
chains in the Genus database with same CATH superfamily
2OGUA 4MK9A 1N33F 1TL3B 2OELA 4B9MA 4PG5A 4O0IA 2DNGA 3PHEA 8AT1B 2EKYA 3FEXB 4ES2A 1G6BA 2GQQA 2Y1IA 4F8RA 5J2QB 1T94A 5G0RA 1TFYA 2CQGA 1WDTA 4ZVUB 5AE3A 2AT1B 1N5YB 2IRUA 4N41A 2CJKA 1FFWB 1NPRA 4LFAF 2FD2A 3VGTA 3FSXA 2ASJA 4ZPTR 4IR1A 3KJQB 1UFWA 2WB4A 2AYMA 4RW9B 4B02A 3ISZA 1F3VA 3RR7A 4WYWA 1N32J 3NGUA 3EVMA 1OMSA 4A46A 1MN7A 1KC8T 4D3HA 3OUYB 3R6GB 3MPYA 3EDQB 3VGSA 3G96A 4GKKF 4ECZA 2IBKA 4USJC 2JX2A 4UOGA 5HN0A 4ZPWR 1YKWA 2AHOB 3GB0A 2HNZB 3OL9A 2YPZA 2HEKA 3T9NA 4RL1A 4FDFA 4WFAQ 2C3OA 1QTNB 3B82A 2YWGA 4DR5J 2RNEA 5J1EB 3LGMA 1PKUA 4PCQA 1Q79A 4ED5A 2IJNA 1RCXB 5KFMA 1BQMA 4UZBA 1QE1A 4DPTA 1L5UA 2DK2A 4NLGA 2K8GA 4FYYB 3HKWA 4DOZA 4U7CA 2QL7B 2PI5A 2E1MC 1KP6A 1DAXA 4FZVA 4HDGA 1RWNB 2AEFA 2V2ZA 5LL6d 2OLWA 4UOCA 3H5UA 1N4LA 3MEKA 3BO4A 2CG4A 3MEDA 2VG5B 2BE2A 4DWIA 5DDPC 1KWMA 1W2BR 3BBBA 2QMUB 3RTVA 1SIZA 1RP5A 3BEGB 3J7Z5 4QIGA 1MW7A 1X9WA 3DYAB 3HD2A 4MK7A 3MM7A 3NS5A 4A48A 4UT4A 1CJTA 2I1RA 2MHNA 3HFKA 4IOAQ 2IBOA 3UCGA 1YG0A 2YNFB 1JJHA 4C9DA 3DRSA 1UAWA 2V8VA 1JXEA 2UP1A 1QDUB 3MCMA 2BE7D 2YBVA 3PY8A 2P2CB 4QOTA 2GQ2A 2JSXA 2EBEA 4FYWB 3TX8A 1NHUA 4NCBA 2MQ8A 4KR0B 1JLCB 1NJZA 3ZTSA 1RT7B 4DR3J 2X51A 3DI6B 4P73A 2HLUA 4HYKA 3CC7S 3CIZA 1NCLA 4TU9A 1OY8A 3KHHA 1HBNA 4IH5A 2K2PA 2YNGA 2LU1A 4ZK7M 2XNQA 4HACB 2DNMA 4B3MF 4NRTA 4JYAF 2WTFA 3H40A 1XNRF 3NAIA 1JLAB 3V6DA 5ETKA 1QVFR 1S9GA 1S7HA 2QLWA 1FTRA 2HIYA 5FD1A 3CCQS 3AXMA 1BE4A 4OQJA 5HATA 3DGVA 4V19X 5A8RA 1L3SA 5KG5A 2W4PA 3NCQA 2HWHA 2JEIA 4RW7A 3DOMB 3IBCB 4EMDA 2RF2A 2BQUA 3D4JA 4ED6A 1HFEL 5L9XA 3I55S 1N5VA 2F9DA 4DJBA 2H3EB 5ETTA 3RRHA 2B9YA 1MU2B 2GJIA 1PGZA 2UXBJ 1RWWB 2B5JA 2WSEC 4ZHRA 4H4KA 3W5XA 4LR8A 1DARA 2NLWA 3T5HA 5LMUJ 4EZ6A 3QJPA 1NPPA 2YX1A 4C8KA 4RU9A 3QGPA 5FLXY 1GT8A 2HNYB 2HS3A 5KFAA 1VBZA 2KTQA 1E6YA 2W2NP 1B0TA 2ERRA 5KOWA 5LMNF 4LF7J 4DF4A 4IO1A 1RISA 3NCPA 3CJKB 1RAHB 1W7WA 3S8SA 2W9BA 1T9VA 3PM9A 2EXUA 2DJWA 2BZ2A 2OEKA 1HKAA 1XC9A 4DR5F 3IWNC 4CTAB 3CJSA 2W7PA 1HQEA 4R25A 1PYSB 3S1TA 4JV2A 4PYAA 4X4NA 1O5JA 2B6AB 1P1TA 2GAGC 5LT5A 4KHMA 3HHLB 1TTHB 1C0TB 3QO9B 3T6JA 1JMTA 1HQUA 3A3NB 5F8IA 3UCUP 4K4WA 1K0TA 4B9VA 4ZVOB 4AQYF 4JI7F 4C3MA 3KG4A 3T3FA 1TKTB 3VQTA 1AXQA 2HGNA 1S6OA 3V6JA 1ZA1B 4EI2A 5L9NA 1TKXB 1NDPA 4X65J 1RBLA 1V3ZA 2QYGA 3EWGA 1IQTA 5D4NA 2CA9A 4WBFA 4M5MA 5E2QA 4NA1A 4A8FA 4LRAA 2J6SA 3LP2A 5F8MA 3PV8A 1T9WA 5IQ6A 1AZSA 3H5YA 2XHWA 2BJ9A 3DOLA 4LSLA 4F4KA 1S6UA 1U09A 5CZXA 4URQU 1IKWA 4I6WA 4DV5J 1U1RA 3B4MA 5HI7A 3HSJA 2YX4A 3Q0AA 4ETXA 4XPCA 4OMFG 1Q86T 3D0GE 4Y2AA 4DFKA 2L9WA 4LF4J 2LDIA 2CZ9A 2ZUGA 1R7IA 3HSZA 3W2VA 2I5JA 3QGGA 1N88A 2CJ9A 3JTPA 1CQMA 1SUQA 4FPIA 3TVZA 4LF2A 4NEYA 1QAXA 2JLEA 4LRBA 3TJ8A 5IZHA 4DR1J 4CT9A 2V34A 3MXHP 3OW2R 1KSPA 2RD5C 2FJDB 4LF6F 3MM9A 2HFVA 3BKFA 2AYEA 1V9OA 1RTHB 4LVOP 5IWAJ 2QTWA 3CJ4A 2VD3A 4AL7A 1PAUB 3HFZB 2ZOGA 1EZZB 2YQ1A 1QVGR 4BC9A 2XMKA 3MM5B 3AOCA 1RTIB 4YP3A 4DL4A 1V3RA 5BJRA 1Y00A 1U4BA 3V81B 3THTA 2CVIA 3C14B 4FYVB 3VAJA 1EKSA 1U2CA 4KSEB 1CULB 3VAKA 1RBAA 3D54A 2CNOB 2YKAA 2XZWA 4B9UA 3J7A1 2YKNB 4IFVB 4Y0FA 2YWKA 4ZIWA 1UVNA 3PXGa 3TWZA 5EX3A 2WRMA 1UPMB 2ASDA 4ILMA 2F65A 1R8HA 2IM1A 4F67A 4U6PA 1LWEA 3ULHA 5AXLA 4Q8FA 3DDKA 4RNHA 1FKOA 1HBUA 2AGPA 3SSRA 4WPAA 2G13A 4KTQA 1Q95G 5KG0A 3E8OA 2XO7A 2BJEA 1A9NB 1SQGA 1VLYA 3TARA 3PW2A 3EVWA 2OPQA 2Z57B 2J7UA 2C2RA 1T9TA 4OV1A 4B08A 1ACMB 1RXOB 4OZ1A 1F60B 4L75A 3Q2TC 4UOFA 4KIAA 1SBRA 3CCZA 1V5IB 1C0UA 5B0FA 2O67A 3OSNA 2V6AA 2RHSB 2E7WA 3UD5A 2NR0A 3DCAA 3OTEA 1SCJB 4AXIA 1MLAA 2E9TA 2M52A 4CLYA 4PQUB 1F2GA 2DY1A 1DQ9A 3DGPB 3Q86A 3VHQA 1N34J 2AWZA 3K5MA 4K0KF 1VLOA 3ZNUA 2BQ3A 1JKHB 3A3PB 4X65F 3A8JA 3JSYA 2LA4A 4NZ0A 3K8VA 3VAMA 1Y3KA 1S1TB 3DRPA 3TP2A 2M3DA 4G1QB 3VZIA 5B0AA 1IKYA 2R7UA 4V1Ak 1HNIA 2J0QD 3T5LA 5E3AA 4CDIA 1RKJA 1CC8A 1ZM2A 3I5BA 3MOJB 1Q7YT 2UXDJ 1VQNS 3OL6A 4C3KA 4K4YA 2B4VA 5AXMA 1D1UA 1ICEB 2W2QP 3I6PA 4DUZF 4IUFA 3D6TB 4DV5F 1EETA 2CPXA 5A0YB 3FQKA 4HH0A 3MMAB 5E41A 4DCJB 3RAQA 3NNHA 1IN0A 4IQMA 4O4GA 2RQKA 4CQ1A 3L7PA 2R2RA 3LP1B 4LF4F 3IR5B 2D74B 3ZXWA 3U02A 1KTVA 4OHXA 2UU9F 4RNNA 2BEFA 3KKFA 2BOAA 1HNXF 4ZVRB 4OHWA 4M5DA 2NSBA 4DR2J 4DR1F 2AX1A 4X4RA 3M8PA 2WVCA 2QSWA 1YJ9S 4DV1J 5H9FJ 2FDNA 3KYLA 4J37A 2XM3A 1T8EA 2MGZB 1WG5A 1DHMA 5IWAF 2QIFA 2K7JA 3CD5A 3CDWA 4OJ3A 1YJTA 1LWXA 2NREA 1S59A 1NHKL 2QC3A 1EAYC 3PJWA 3IAS9 1RK8A 3W60A 2FJVA 1S72S 4DL5A 1GK8A 3NG8A 4P2MA 4NRUA 4WP8A 3G6YA 1KS2A 1UCNA 2KRBA 4HTIA 4ZIVA 3DM2B 3IG1B 4JP8A 3WZ0A 1DTTA 2J7WA 3KLEB 2BRKA 4LSNA 2CJYB 2YKPA 3VR1A 5A8WB 5KFOA 3ENWA 2AYGA 4M5HA 4YB1P 1NK0A 3DC2A 2HURA 1WC5A 4DSJA 1M90T 2L9DA 2WB1D 1OYEA 4F50A 3R5BA 4PAAA 2DD8S 1KKHA 4C11B 5DLGA 5D77A 2DR8A 5KFQA 3TQ1A 4OI3A 3FMBA 4ERDA 4P7TA 1NSAA 2H5JB 3RZAA 1JNRB 4LQ3A 4MIBA 5ADZA 3W2WA 3J81j 3KLVA 3HCXA 2P9EA 1NKEA 1EKRA 2ZBPA 1X0PA 3M7VA 4I6AA 4ZVPB 3P49B 5H1SV 5D15A 2E1AA 5EUHA 1WG1A 3RRKA 2V2QA 2XQCA 3DLKA 4KC5A 2LDYA 1XQIA 2J9CA 5A2QY 4WKRA 2ZM6F 4QCLA 5ETSA 3MMJA 4I2PA 1NJWA 4KYZA 4JI1J 2CNNB 5KT6A 1FO1A 4DCOB 3MEEA 4QU7A 3CD6S 4CRJA 1FNXH 5ETQA 3MOZA 1KBRA 3UDVA 4J9UE 2OFHX 3GFHA 5DRKA 2MMYA 1OO0B 2WBRA 3O5TB 2GX8A 5U47A 4I68A 3DHXA 4ANEA 4LBIA 3HZEA 3CULA 3GILA 4AFFA 4FNIA 1R8AA 4DQSA 1RE1B 3BYRA 2G2YA 2XLJA 2EWHA 2HVZA 2CPJA 2HQFA 4UW2A 2VODA 1SKWA 3L7UA 2CJXB 4OYZA 4OFZA 4MIAA 2IHR1 1CS4B 2KVIA 3NS6A 4O3NA 2W25A 2AGOA 3JSMA 1TFWA 4ETZA 3JAMY 1YJWS 2ABYA 2CJQA 3H2UB 3EXYA 1UPPA 3FEZA 2R9LA 4J9KA 2QT7A 2J7KA 2XZDB 4LFBF 4DSFA 3PHTA 3NGTA 4OJHA 3CC2S 1DQAA 2MZSA 5F3TA 4FXVA 1S6PA 2DRBA 1PILA 2CADA 4ZA1A 4MYTA 5ETVA 1KDNA 1RJJA 1NH8A 3HFVA 3TOQA 3KMQA 3IS9A 3L95X 1HWUA 3FC9A 2L08A 3C15B 3IRXA 3CCES 2CQHA 3RGIA 2Y1JA 3U1NA 2XS2A 1GMVA 4PWWA 4DV6J 4K5SA 3CJ2A 2E9ZA 2VC0A 3M8QA 2PMZD 4WJBA 1S4FA 3W9JA 3JXOA 3R1HA 3ZZUA 2D3OR 2AJ0A 4P2XA 2HHQA 3VTIA 3DRRA 4NCGB 1XR6A 1IKVA 3H0PA 4O23A 3G6ES 3C6UA 4B3TJ 1S1UA 2LEPA 4LVNP 2IM3A 4RWXA 2KH9A 3RBDA 1U49A 5BR8F 4K5RA 1NPKA 3MMCA 5DQGA 2XMJA 2VBZA 1KLMB 4K4XA 3D1HA 1SXLA 4FKXA 2B9XA 4K2XA 4JOUA 1IUJA 3R6LB 1Y9OA 2F5GA 4K4TA 2KU7A 2C3MA 2HFSA 2Y0SD 2EFGA 5HMZA 3NMAA 1CG2A 2DXEA 1DLOA 2CWXA 4X66J 1FRXA 3QLHB 1RT5A 1RA6A 2ZH6A 4NOHA 2BM0A 4ELTA 4P6QA 3DLHA 1BWVA 1NZ8A 4RBTA 3QT6A 4YFUA 5FIIA 4K4ZA 1XTZA 4GVBB 2HMIA 4ZLLA 2UXCJ 2BACA 2UV8G 1FRKA 2GJFA 2CPZA 9RUBA 3HHNB 3J81Y 4Q5VA 4ZN1A 2E1CA 5I42A 1X31C 4F4AA 4NLWA 5J1NA 1IBMJ 2OHDA 3M4XA 3HMJG 2EBGA 2XMAA 1IXKA 4K8RA 3NEKA 5F8LA 1FRMA 1HWIA 2HHWA 2H5IB 1HI1A 1U6FA 4DV3J 2HBQB 3OXGA 1Q8BA 5L1IA 1OYDA 1TMMA 7FDRA 3MDFA 1D9FA 3GV7B 2ZKTA 2V8GA 3THVA 3CCTA 2W9CB 4DR4F 2UUCJ 4I67A 1O51A 4XO0A 3MUTP 2PEBA 3GR0A 5EX0A 2V63A 3PYEA 1QE1B 1CJUA 3U7JA 1XMOJ 2POKA 4EZ9A 4PR6A 1UA1A 3EZOA 1S0VA 3TUPA 2CAJA 2FJEB 4KE5A 4WF9Q 4LF1A 1A7GE 3THPA 1S9FA 4F0MA 1T02A 1Y5NB 2KXNB 4CLZA 3CNQP 5DM6Q 3MEDB 4RKUC 1S79A 5DJBA 1SJQA 5H9EK 4OZJA 5BXIA 5C42A 2D9OA 1L3UA 3GIRA 3BKUA 5KFZA 2HVHA 1O6XA 3LO3A 1I94J 2FUG9 3KG1A 2F40A 3R2DJ 5B09A 5AJ3J 5DDOC 3MM7B 4HTJA 2V2KA 1CJTB 2LMIA 3KK3A 3MPUB 2HQGA 3OTDA 4KPCA 2IA0A 3BN7A 4CO0A 2HFZA 1X4BA 3K0JA 2FZGB 1VMBA 5J1PA 4NE9C 3N9UC 5J2NA 3UW1A 5K14B 5KFVA 3ADAC 1S1VA 1UVJA 4L6V3 3W61A 3PIPQ 1K9MT 3IM8A 1P8GA 1NK4A 2CG8A 4JI3J 4YDXA 3BJYA 3H59A 1M5OC 1RHQB 4WU3A 4BBYA 2XB2D 1T03A 4E2FB 3CJ3A 5KT4A 1IBLJ 2DISA 1QTMA 3BGRB 5DZ6A 1X0FA 2NZ4A 4NLPA 1VRTB 3U1LA 2JC1A 3FBCA 4OYIA 1ZS6A 3G2XA 4J5OA 1HBNB 1SB6A 4DR6J 5M2PA 1Z2LA 1KN6A 2VHGA 2RILA 1N5YA 5KFBA 1DURA 1PYOB 2YNGB 5DO2A 4NXNF 1P27B 3M32A 1CJVB 2LXUA 2GMJA 3CPWR 2ZH1A 3HX9A 3TEHB 5DGBA 3V6DB 4LJMA 2D69A 2F4VJ 4DR7F 4GMKA 4JI6F 2Y1LB 4RW9A 2BANA 2XCAA 1RTDA 3A12A 1F9FA 1TL4A 2XHCA 4QIWD 2M0GB 1HWJA 1VRUB 3D28A 3NGSA 3KJFB 1KOOA 3CCVS 1T05A 4JUZA 2BOPA 4KBIA 4TNOA 3RRGA 4DN0A 2RF2B 1UP1A 5CYQA 1SJ1A 2D41A 3IN5A 2OMOA 2GV1A 5J1EA 2RSQA 1Q1KA 2V94A 3UDCA 1TV6B 2VKRA 2VFVA 3H5SA 3R5GA 3W9IA 1UL3A 3NP5A 1NMEB 3SZ2A 1YX2A 4ED8A 1FI4A 2UXCF 1S57A 4IDKB 3AOAA 1MMDA 4ALZA 3KOAA 3WX8A 4EFAC 1U1NA 2MZJA 4QR2A 3M8WA 2R7WA 2VG5A 4IRDA 3EZUA 2NQPA 4PG4A 2U2FA 2R8IA 4RUBA 2XSFA 2BJ7A 2ZH7A 1PC4A 3TYTA 4ES1A 2B51A 3WC0A 3DYAA 2E66A 2UUTA 2VQEJ 3AD8C 5IT0A 3I9ZA 3PW7A 1GTHA 1K47A 1WF2A 5D3GA 6AT1B 3DRYA 1M5VC 4OI4A 4EO6A 3MAQA 2UUCF 2XULA 4JI8J 2RIJA 2YNFA 4DV0F 3GJQB 4X4UA 1VIXA 2VG6A 1R0BG 3D3CJ 1PJ5A 2XLKA 1IJFB 4XK8C 4OX8A 5DDQC 1X9SA 3X1LB 3VGUA 1NBEB 1JLCA 2ZDOA 4J9LA 2CUYA 2F8MA 1M5KC 4USWA 2VL1A 3BSNA 3DI6A 5KT5A 2CRLA 1F3FA 4ES3A 3D7SB 4C7QA 1FDAA 5KOXA 1TL5A 4DUYF 2ZJRQ 2RKIB 4URSA 4OX9F 3CO0P 4EYIB 2GIRA 1VYAA 1VBYA 4HACA 3GIIA 4P72A 5AJ3F 1NKCA 2ZDPA 3LP2B 3PEHA 1LW0B 1GMWA 4M94A 4QYZJ 1XR7A 4NYOA 5CQGA 1AZSB 3UFCX 1KHVA 5KG7A 2GQCA 2HFOA 4YR0A 2VFUA 3DOLB 3MD1A 4I69A 4LRCA 1U48A 1X4EA 4F4ZA 1WHXA 2ZEJA 4Y2IA 3CJRA 1C4AA 2W01A 4NI2B 3OR1B 2VC1A 2ASYA 2OPRA 1U25A 3CVKA 2DYAA 2VDIA 1ITPA 1FFSB 2CPFA 2I5JB 3C46A 1N56A 5A6PA 1BD6A 1S76D 1J5EJ 1MU2A 2OPSB 2HG4A 4KPYA 3CDBA 3A8IA 1WELA 5E3PA 2MQLA 2ZWPA 1CQNA 1R8BA 5K8MA 2LQBA 1RAJA 3RR8A 4CO5A 4OZ3A 3QATA 2F4VF 4N7TA 4XDDA 2XY6A 2YNHB 2NCKL 3QFWA 4F04B 1TKZA 4ITSA 1KQGB 2LLZA 3HSGA 5DM7Q 4JV5J 2UVRA 2ZOFA 2YX7A 3CJKA 5IXUA 3R97A 4OZ5A 4N77A 2DNZA 1KD1T 1D9AA 2OPPA 2EFNA 4CTAA 1U1QA 1QSYA 1WSRA 1RU2A 2BQRA 1C0TA 3H90A 3QO9A 2DVIA 2IM2A 3QFHA 2W8LA 3PW5A 3G9CA 1FDNA 3T5KA 4USUA 1RADB 4ECYA 3SEOA 1SL1A 5F0UA 2XMUA 4MK8A 1LXNA 3WIVA 1FKOB 1HBUB 3MURP 1IR0A 2QJ3A 1UFKA 4F3OA 3VCDA 2H54B 5CXTA 4CNZA 5HMWA 1MWZA 3OT9A 3IM9A 1QAJA 3B78A 2M88A 3T1HJ 4HVZA 2HVDA 3ICLA 1ZYQA 2OPQB 1KVIA 5GAEI 1ZM9A 4CLFA 3AH6A 4Y6IA 3OTBA 2KHCA 4ZPAA 2FVSA 2VQEF 2E44A 1U1KA 3H4DA 2EFQA 4DQIA 4ECWA 1CSJA 1C0UB 1SKUB 2HZAA 2BBEA 2BXJA 2O1PA 3OQ2A 5LJ3Y 1NB7A 3T1YF 1D8ZA 5CAAA 4MKBA 1HR0J 3NXZA 3FK4A 2QL5B 4JI0F 4ED7A 3TZZA 4P74A 3BQ0A 5D4OA 2JOQA 4DV4J 3FZBA 1TKDA 1QUPA 4YMEA 3K2YA 2KG1A 4J9MA 2ACYA 2E7VA 4DLEA 3QYYA 2BR0A 2QZ8A 2GC8A 1IBCB 3BB5A 1YRTA 1VK3A 3Q8VA 2VPYB 2K3KA 1IKYB 3J7YI 1FDDA 4ZDNA 2J6TA 4NCAA 2WK4A 2I6WA 3HLUA 1KFSA 1B3TA 1FWKA 1Q8KA 1FD8A 2HHHJ 3GYNA 3AD9C 1UA0A 5GAEU 3D0HE 3MM5A 1EETB 3PR5B 4TU7A 4HHHA 3UCZP 4O4RA 3DMJA 4P2FA 2RQMA 3S6EA 3RAXA 3QJJA 4O4GB 4H54A 3OBIA 3C14A 5CH7B 3PVXA 3SCJE 1CULA 2R7QA 1Y0HA 2R7VA 4W90B 4WIQA 5HVHA 5E3RA 1B99A 2QV6A 3B8HA 4DSEA 1FJEB 2YKNA 1RAGB 5CD4A 2F63A 3DLLQ 1P9YA 2OD6A 3EXCX 4YHHJ 1LV5A 2MLXA 4M5LA 4RWWA 1AA1B 1X4AA 2WCXA 2F4FA 2Z2MA 5DZ7A 4YOEA 4EU0A 2GHPA 1BWEA 2EPIA 2CZVC 4RBVA 1HQ2A 2OD4A 2KKHA 5DLFA 2Y9HA 4MIWA 2DGOA 1TUWA 1S49A 4WTYA 3J7YU 2HHPA 4ANDA 2J0WA 2FJXA 2IRYA 1R27B 3TAQA 2HHSA 4DX8H 4JV5F 1V5VA 2KFZA 2XWXA 2MSTA 1TUGB 4KGZB 4EBCA 3P6YC 4M95A 3R2CJ 4IRCA 4RR5A 4WCEQ 3TUIC 1H7XA 1KFDA 2R3VA 3MZIA 3HJFA 3EPIA 1JJ4A 4PWDB 1DTTB 1BGXT 5D0HA 2OAUA 4LSNB 4PQUA 2AJ1A 2ZBCA 2EW9A 1VISA 4RNMA 5D0EA 5LOQA 1EP4B 1RKIA 4DS4A 2UVVA 1WDDA 2ZOMA 4ATNA 3IMQJ 1YHQS 3HI9A 1H2VZ 3SV4A 1NSPA 2MKSA 4U95A 1XNQJ 2KXFA 3H42A 4LMZA 5DQHA 2G2OA 2EC2A 1HLWA 1S1TA 2GIFA 4CO1A 1MSWD 2MQQA 1UW9A 3M2RA 4Y2KA 2W2MP 3W2WB 2C3YA 5EN1A 3D6MB 1R6VA 1MNEA 1DRZA 1IWGA 3DFEA 4PG8A 3HZGA 3AFGA 1NNDA 2ZVIA 3K89A 1WKJA 3O3LA 3PRBA 4XAKA 5IM0A 1FJGJ 3EZ5A 3GG0A 4ZVTB 4C8OA 4ICLB 4W4MA 2R8KA 3MMAA 3KNGA 2RDJA 3QMQA 4DV4F 4DDFA 4CO3A 2AIRB 3LP1A 2RRAA 2ZE2A 3R7BB 4ILRA 2K7KA 4Q2LA 1U1MA 3HVTB 3SCLE 3T9ZA 5IT4A 1FWPA 1Z2ZA 3EGZA 1UKUA 4DSIA 3KUHA 3BH6B 3IXQA 4L72B 3ET6B 3QRQA 1SC4B 3EX7B 3TRGA 1GAOA 5CD4H 2HHHF 2RMLA 2LXIA 4ECRA 4H4MB 1WUUA 3MTKA 4J9QA 4OHYA 4NXMJ 4R5PA 5A8KB 2CFXA 3QRPA 2V8HA 2D9PA 1HNWJ 3CE8A 4NA3A 5KFTA 3KWMA 3NWRA 4R8UB 2KT2A 1NSQA 2GNKA 3CDUA 5L1JA 3D5MA 4QYZK 2HVEA 2R8GA 4NYPA 4DL3A 2VASA 1D0EA 2VB6A 1VDHA 4YN3B 1URNA 1MMLA 3DM2A 4YHHF 1APSA 3UPFA 3KLEA 3MR5A 2G0CA 1F0XA 4LF5J 4DXLA 5A8WA 1YJNS 2R7SA 4EUVA 1CBKA 1N5SA 3HM9A 4USVA 4CLTA 3M6XA 4KY3A 2FHJA 3Q22A 1FERA 1X4GA 5KFLA 2DGVA 4ZCLA 3LOUA 1I3OB 4FVMA 1S6PB 3ZZ0A 3F0NA 4RW4B 3OD2A 2NSCA 4Z2XA 2RRBA 3CCSS 4C11A 4XTTA 2HIQA 1GMUA 3SQGA 3T6BA 1JLFA 4TQRA 3C19A 3RW6A 4U7UK 2CQ1A 2XBPA 2QMWA 3D6HB 3M8QB 4NL5A 4DG1A 1CEZA 1KQSR 3NKYA 2WONB 2Z0GA 1HD1A 4DPYA 4KAIA 3I0RA 3IC1A 2MKYA 3QRRA 1SJ3P 3C6UB 1PYTA 4JI2J 1S1UB 1ZM4A 2M70A 3WDOA 3K57A 5HQMA 4QZVB 3FRYA 3B54A 5LSRA 3OTOJ 2ZBIA 2JWNA 2Q6BA 3BKTA 3A8KA 1X4FA 5FJ4A 4LUBA 1R0AB 4FF1A 1LK7A 2N7YA 2Y3YA 2OH2A 1RT2A 1S6QA 4QWBA 1XWLA 2VJUA 2WW8A 1UJ4A 1GX5A 2NXNA 4DV2J 1N36J 3JQMA 4FBTA 3IR7B 5HROB 1YJUA 2V50A 1RT5B 4O44B 1W26A 1RCOB 4DPOA 1VJQA 2PN6A 1FJGF 3SIPB 1N0VC 1RWUA 1LWFB 5HBMB 3V2UC 1YWXA 3I56S 1J5OA 2LP4A 1R3NA 2LYVA 4RO0A 1CS4A 2HMIB 1W25A 2YY3A 2HQCA 3CD0A 1YTYA 3HVRA 1PAEX 3KUEA 2IDEA 2XYPB 4OI2A 1YBAA 4WFNQ 4J90A 4NLOA 3TQEA 2FIUA 3HVAA 2P5VA 3I9V9 3HXMA 3N79A 2SXLA 2BYCA 4UOHA 1QSSA 4WP3A 5DDRC 4O3QA 3KHGA 2LFVA 1UTAA 3GIMA 3M9MB 1NKBA 4IH7A 2KDOA 4I7FB 1HBOB 2MYFA 2J5AA 1YLXA 2ZD1B 5MLCV 3OL8A 2XGPA 4WFXA 2V9KA 3IWLA 4KB7A 3WX4A 4ZP7A 1K1SA 2MZQA 4F4XA 2MZ1A 1HNWF 3BGFA 1URRA 3BPSP 1X8DA 1P6TA 4F4WA 2YH0A 1YITS 1RYRA 2B8QA 2HWIA 3GTYX 4GO7X 4KGMA 2M9KA 1LNQA 1Q78A 1ZTWA 3F41A 4PWUA 3TAMB 1X5OA 2V68A 2F3JA 3MAHA 3M05A 4KGVB 5J2MB 3OVSA 3OFEA 4NCGA 4KGXB 2C2EA 3WHIA 1F5AA 4LF9J 4LF5F 3MAAB 2A2DA 4RW8B 2AX0A 4WXOA 2NUHA 3UN5A 4ECXA 3LF0A 4WKYA 1T9XA 3LUYA 2BW7A 5BYRA 1KLMA 2DIVA 1U1LA 2QO3A 5J2NB 1MMNA 1UZDA 1RAFB 1S1VB 2OEMA 4F36A 4F0KA 1C1CA 1VQMS 2AKWB 4TLRA 5I3PA 1U0HA 2WBMA 2OI2A 1IM4A 1T03B 1OY9A 2MKJA 3QLHA 3PYFA 2OJ3A 2X3DA 1LK5A 2G1DA 4JI2F 1OWXA 4GVBA 1FJ7A 4Y00A 2FJBB 3EM1A 3M32B 4Y34A 5SZTA 3KLGB 4IFYB 3OR2B 3CCUS 4Q8EA 2HK3A 2G1HA 3EUNA 2I9SA 2CKWA 3GYGA 3ZZYA 2BANB 4B9SA 2K3IA 2UUWA 1RTDB 2IVMA 1RA7A 1UWAA 1RAIB 3MECB 2KJVA 4QPTA 2H51B 1NDLA 3LGNA 1T05B 1F9EB 3R9LA 5KFKA 5CYQB 2F8HA 5KFCA 3UR3C 4U67Q 3EGWB 2DNHA 1N52B 1QSLA 4DV7F 3CCJS 3VVTA 1IM6A 2ZBQA 2IC3A 3IWXA 2W9CA 1PCAA 3LW5C 3HVWA 1N54B 4Z37A 3QZ7A 1FDBA 2Z2YB 1M0SA 3UD3P 4PXEA 3QAEA 3FEYB 1N8RT 2PO4A 4C8NA 1TVRB 1FKAF 2APOA 3UVJB 1FFGB 3VV2B 2N82B 3MPVA 4HH1A 3RG6A 2GGPB 4B3SJ 2HK2A 5C5JA 4IOCQ 1FCAA 1S97A 4OYMA 1GMWD 3PIOQ 2E5HA 2N4DA 3LPEA 2VQFJ 4DN9A 2R2TA 2YNIA 3CMAS 2Z8QA 5D0GA 5KG6A 1JLBA 1Q8LA 4OYAA 2QEXS 2DNNA 2YXLA 3W7BA 5D3GB 2HVIA 2W4CA 3R5DA 5K14A 4YB7A 1N0UA 4ZN3A 3TA2A 3O2IA 3I31A 2VG6B 2VH7A 2BDPA 2AEMA 3GLJA 3OHAA 4OLOA 1BLUA 4LBPA 4ECTA 2OO4A 1QD1A 4GO5X 3PO5A 3M2UA 2AMCB 1FD2A 5KFPA 3BGRA 4FPRA 3Q83A 4ZCIA 1VRTA 1UVMA 3I5AA 4ELUA 5CYJA 1RHMB 4LF8J 4O3RA 2ZVSA 2KHDA 4X62J 5ETLA 1WOPA 3CF5Q 4IRKA 1CJVA 4R0EA 5HJYA 4DF8A 3PDNA 2NXJA 1SIWB 2XYGB 3K5PA 2WOMB 3PZPA 1MG7A 4LR9A 3G4SS 3ZZZA 4GKJF 2Q79A 3Q24A 3OL7A 1M5HA 3JAMU 4N5SA 1U45A 1VRUA 4DBQA 1U0SA 1S48A 2MDAA 1HYSB 2ROEA 5B0CA 3BDPA 1H2UX 1NJYA 2OPRB 3R5JB 3PTWA 3HHLD 3DOKB 3UWTA 4M5KA 4FXWA 2XSJA 3UDLA 1NUEA 1REVB 1TV6A 1QJHA 2B4OA 4M5IA 5GMKa 4MKAA 2DH9A 2FYXA 2B4PA 2HBRB 3SDEA 5T7LB 1SH3A 3FZ2A 4LBHA 4ID8A 3GIKA 2AU0A 2VG7A 4IDKA 2GMHA 4YB6A 3Q8UA 2PA8D 2VJVA 3EGVA 2RUGA 4ZPBA 1N32F 3AQPA 1TKZB 1G7CB 4ECUA 4RZRA 4WZMA 3N6LA 2EFOA 3S01A 2BJ1A 1KTQA 5AE2A 2IAJA 2FGCA 3IR6B 5KT7A 5CZVA 3KJNB 4F7VA 5EDWA 5HL7Q 1X4CA 1FKPA 4PPDA 3L9ZA 3LP0B 1K0VA 5KFHA 2OPPB 3GFXA 4ZP6A 2UUBJ 3MMBB 1SJ4P 1HNVA 2D3UA 1I6JA 5M2RA 5C2GA 2LKZA 2DGQA 3N4WA 1G1XA 1T9UA 1RABB 4FF4A 5KFDA 2PFFB 3MM6B 2XEXA 2QX0A 3ILIA 5KG3A 2DBBA 3PJXA 2HPUA 3VZHA 2X1AA 2MSSA 3BZQA 5JVHQ 2HHXA 2H5EA 5GMEA 1HNZJ 3SI8A 4ZVQB 5BYQA 2D7SA 1VC6A 3FBBA 4DZDA 4JV0A 5C25B 1N5TA 2DITA 2X1BA 4MKYA 2NXCA 3DNCA 2GMLA 2RKIA 3DLEB 1YJ7A 4TVAB 3G71S 1BHNA 4I1TA 3OXLA 3C16A 1M1GA 2M8HA 1LW0A 2DRAA 1N48A 2IA6A 5GVQA 4X64J 1RTJA 2HNDB 2V9WA 2PGCA 4BWJA 4RW6B 4P2SA 2ZITA 1FESA 2DNKA 4NI2A 3OR1A 3TX0A 4L3KA 3VAHA 1Y4ZB 1M5PC 1S1WB 1OPIA 4DR3F 4TKTA 2XG8A 5HMYA 5KTQA 4L74A 2M5YA 2HQIA 4QIFA 2I38A 2OPSA 1PBUA 1SPBP 4O3OA 4LSZB 5CABA 4NX9A 3GSDA 3E01A 2UV8A 4X62F 2W9AA 2DXDA 4NMLA 3M8SA 1H7WA 3US5A 4LFCJ 1D9DA 4NA2A 3ILOA 2DNQA 4CH0S 2G9OA 5HP1B 4PXDA 2QSFA 2QFIA 3MFHA 3C2PA 3NGKA 2YNHA 1RGVA 2KFYA 3V5RA 4QU6A 4Q0BA 2JFKA 2QFJA 1S4EA 1L3KA 1TK0A 4DHVA 3DMJB 3TI0A 3BDEA 4V19J 4EK2A 4DX6A 3B6BA 1NU4A 3TVYA 4ZVGA 4ZP9A 1I1GA 2W2PP 1T3OA 4OZLA 3CT9A 2DR6A 2Y0BB 5KFYA 4J9VA 4C8YA 3HO1A 5DGAA 3N0VA 5D0RA 4F2SA 2IMWP 1EQ0A 2EK6A 2UXBF 2RH3A 1ELOA 2PE8A 1GNKA 4N76A 4TY8A 2YKMB 1F1BB 4RNFA 5LMUF 2XY7A 1N6QA 1KHWA 1PBAA 1NRKA 2ZZNA 2VV5A 4QR1A 4YEAA 1SQFA 1KONA 4EO8A 3BSCA 1O8BA 3DHWC 3SBMA 4FS1A 4LF7F 3W62A 1T7PA 2B43A 3HP6A 5I3UB 1U02A 1HIYA 2VOPA 3H8YA 4GRSA 2Z2LA 1WEXA 5B0DA 3BH7B 2HS0A 2VIHA 1RTZA 2DR9A 2IYIA 1ZAXA 2JVOA 2UUBF 4H4OA 2GO8A 4QPXA 3M6WA 2XMMA 4C48A 4RNOA 5F8JA 2J9DE 1KR4A 1ROFA 3GJTB 5I3QA 1XEZA 3UE2A 1SV5B 1HNZF 2Y8WA 3J80U 2Q43A 3CXCR 2MY7A 3NRBA 1M1HA 1H98A 1PIEA 3QWPA 3EJMA 1SJFA 3RBEA 4X4QA 1FE4A 3R7NB 1U2RA 2BABA 1PJ6A 4AUKA 5HVGA 2AJ4A 3KDNA 4UY8T 1ZPWX 2XI2A 2HWTA 2J8SA 3M2RB 5IV3A 1Y5LB 4C2MA 1REGX 4OL8A 3M30B 2HQ3A 3FSYA 4HT5A 2C2DA 3G82A 4X64F 3C8YA 1X4HA 4DL6A 2DNYA 3OVAA 2H65B 4QYRA 1HW9A 5IM0B 3C6TB 4DQRA 1VBKA 2GCFA 4J7CA 1CPZA 3JYTA 3KK2A 5B0GA 2FC8A 2IFXA 1IBKJ 2IDLA 3BM7A 4D3GA 1JLEA 4USMA 2CPIA 1N33J 1ZAWA 2UZAA 4J9RA 2ZE2B 1Q4RA 1K8AT 3PNIA 8RUCA 3CUNA 1ULRA 2FHJD 3AXKA 5HANA 2BKPA 2CXEA 2KZZA 3KK1B 4ZVFA 3GQCA 3R1LA 4LFAJ 2OSQA 6FDRA 2FGOA 1WNEA 1X7VA 2L3MA 2XWYA 3CW2C 4Y3CA 4LFCF 2V2VA 5IOLA 1I51B 1AW0A 4FS2A 1TZ0A 1HL6A 2Q6CA 4P75A 3CJQA 1HBMB 3D3BJ 3GG1A 4CIOA 4GKKJ 1SJRA 3I82A 1OQ3A 3P96A 4R5PB 3FCVA 5ETPA 1Q5VA 3NY0A 2ZH2A 2Z58B 1L3VA 2WVBA 4KKOA 1FX2A 2HHTA 3OFHA 4MJKA 3TA1A 3RBZA 2JNJA 3Q8YA 3RBXA 1D09B 2BJ8A 4BHQA 4PWDA 1QM9A 1BQXA 4L3NA 5D6GA 3CJTA 4ZS6A 3BQ2A 2UVUA 3KDOA 1SH0A 2WVEA 2ZWOA 3TUJC 1F9HA 1EP4A 3JTNA 4PABA 2BMBA 2HGMA 5EHHA 1AUSL 1RWKB 2DR5A 3BF4A 3P5BP 4GVLA 3SQGB 1JK9B 2Q66A 1JLFB 2GFFA 3POTB 3SSQA 4U8VA 1RI7A 2NXUA 5THWA 1YGYA 3ZC4A 1ZAVA 5L39A 1WJ9A 2NZCA 1XJWB 4DG1B 3F44A 4PRFA 1LOUA 5HVFA 2QLXA 4JB8B 4YUDA 2ZKUA 1UWBB 1YIJS 3I0RB 2PDAA 4ICLA 4MFBA 4YDDB 3PACA 2AEJA 3C66A 4PEOA 2HRTA 4OYWA 3BGLA 4IO9Q 1RAEB 1NDCA 1N34F 3HPOA 1YZ7A 4C8MA 4Q43A 2VPWB 2YH1A 3KLIB 4M8LA 1NAQA 2H48B 3HVTA 4P10A 1XR5A 2F7VA 2VFRA 4CLPA 3H25A 2FVQA 1RT2B 1S6QB 1RACB 4JYAJ 4KFBB 1XNRJ 2LQ8A 3FCHA 1IR2A 1MWYA 2CJBA 3ET6A 2CQ2A 9ATCB 1S0MA 3MD3A 3CMQA 3KUGA 3PJ9A 4Q2MA 3CEDA 2UXDF 4X4SA 4CCHA 4S0MA 4F2RA 1SKSA 3GONA 2AV5A 3N28A 4CM2A 2KG0A 1AROP 4H4MA 4PUOA 2RQCA 2ADCA 3RB6A 3LPYA 5A8KA 1WG4A 3A3OB 1FXDA 4R8UA 1J5OB 3BN4A 4OJ1A 2HBZB 3TZWA 2ZFHA 3RYLA 3N6NA 2FLPA 2AJQA 2HQDA 4WK3A 2FTRA 4DSKA 3UO0A 3Q89A 1IQZA 4XDCA 4DR2F 1H0HB 1VR6A 3UR0A 2B56A 5K8OA 4AYBD 5D4LA 2KT3A 3IP0A 3NL0A 1NM2A 1M1KT 2ROGA 4DV1F 3P3DA 3HK2A 1LKZA 2YWHA 4IQXA 1RT1A 5IQQA 4RW4A 2IY5B 5LMNJ 3O44A 2GIQA 1JJCB 3PFEA 2XS5A 2DCLA 3W66A 5L1KA 1LW2A 2N4CA 1YRXA 4WTOB 3R5CA 1FK9B 3JSBA 1NK6A 1ZM3A 5AE1A 2HAIA 3UDEA 4CO4A 1T9YA 3K5OA 3AAWB 4ZCKA 2CYYA 1JB0C 2CQ3A 1FF2A 4KV8B 4MMOA 3CTRA 4M63A 2WONA 3K58A 2FVPA 3ENVA 4DFMA 2DNOA 1U8SA 4AQYJ 2ZZTA 4JI7J 4F4YA 1WACA 3HHLC 3W1YC 4B3OB 1J27A 1EJ7L 1WF0A 5CA5A 4NZ7A 1OY6A 2VDHA 4CYUA 2XZTB 1JLQA 2B9EA 4OI1A 1R0AA 1NLKL 1P9QC 3NNCA 3PYDA 1ZZNA 2ZC3A 2DNRA 1EARA 3TR5A 4DFJA 3CGIA 7AT1B 3ETOA 4ED4A 3GV5B 2XMVA 3DDNA 4Q44A 4AXJA 1C1CB 2KJWA 3SXLA 5JMNA 1KQKA 1U0HB 5EWEA 5HROA 2MZRA 2H4WB 4O44A 2ROPA 1R8PA 2G2ZA 4FVCA 3EPGA 2RE1A 5A76A 1VQOS 4NLVA 1LWFA 5HBMA 1FE0A 1OPZA 2EFVA 1X5PA 2GVZB 4JI1F 2R7XA 3MCSA 5ETNA 2UVWA 2M2BA 3ZO7A 1H2TZ 4A8XA 1TP7A 3MUMP 3EMTA 1NJIT 1HHTP 4X4PA 3QWUA 2QLJB 1FEHA 4UF4A 1S0OA 4LF6J 5KAKA 4I7FA 4XIUA 2CDQA 1HBOA 1YK9A 3V4IB 4A8KA 3KJVA 1BUXA 2ZD1A 3ISND 4KGKA 2CIMA 2MY8A 4QIEA 2EG1A 4WWSA 2IVFB 4EBDA 1RZMA 3LALA 1LFPA 2IC3B 5F41A 4AL5A 5A6WA 1NK7A 2RS2A 1FXLA 4EEYA 1YSJA 3M2VB 3FSIA 4C0HA 2CZ4A 1VI7A 4YR2A 2O01C 4PYDA 1SC6A 5JVGQ 3HHEA 4LIRA 4WFYA 3TAMA 5KFEA 2IMOA 4HHUA 4OZ0A 2LCWA 1U24A 2C3UA 3TO8A 5J2MA 1H6KX 4KQZA 2GAHC 3LAMA 3MAAA 4K50A 4RW8A 2LXFA 3FMWA 4CH7A 2YNIB 4UUXA 2H9ZA 3FJ2A 1JLBB 4C0BA 5GAGI 3CCRS 5HO4A 5EWGA 2DO4A 2B0GA 2NPIA 2JJ4D 3K59A 3IFEA 5HJXA 4K7QA 4I2QA 2LA6A 3QPIA 1FTCA 5H9FK 2V8DA 3CJ8A 1TK8A 4DV6F 5IC6B 1VQLS 3M2UB 4M5JA 2DHGA 4FYXB 5F9LA 1CJKA 3QJLA 2QE5A 2QGFB 2RT3A 2N3LA 4A8OA 1Y10A 2E5GA 4WZQA 3ENAA 5LXRA 4B3TF 4JI5J 4K0KJ 4OLPA 2PMHA 2OFGX 4TXSA 1Q0NA 2FZCB 3CCWA 1TUVA 5RUBA 4ZOSA 1RT4B 1YI2S 3KLGA 2XMTA 4IFYA 4QQBA 2ZZMA 3OR2A 4DPXA 2NYIA 4NLUA 3RB0A 3ILJA 4B17A 2NXEA 2G0JA 3BYPA 1WF1A 2RS8A 3PW0A 2VPZB 2XY5A 5GAGU 4EGLA 3MECA 2CDRB 1VQPS 4G65A 4USIA 3GU0A 2H4YB 3AB2B 4C4WA 2CQPA 4DUZJ 4X66F 1QAIA 3V4MA 4QW9A 2XSJB 3R27A 3GIJA 2Z4PA 4OZ2A 4DX7A 1S7IA 2GJ2A 3R8YA 1VC5A 1R43A 2ACMA 3SDEB 1VQ4S 3WBZA 4ZLNA 4OYXA 1FNMA 4NLYA 2UU9J 3QZ8A 1N5QA 1AB8A 3GJSB 4WYLA 2VG7B 1HNXJ 3GPAA 3AY0A 1TVRA 1WC0A 5LSLA 3UVJA 1SVDA 3NNAA 4Y2MA 2GGPA 1IBMF 1FWLA 3MR7A 2AYBA 1BY9A 4A8QA 1Q7LB 3T19A 1RWPB 3JTOA 2V69A 2J6UA 2V8PA 3M8RA 3N5FA 1GXTA 2QRRA 1Q53A 2V4JB 1FJCA 4KO0B 2IAJB 1VQ5S 4DV3F 3K5NA 2A6OA 1MN9A 2MZTA 1FKPB 3AQOA 2Y8YA 5LSOA 2ZJQQ 1RQ0A 1WWHA 4C98A 2MHEA 3D1OA 2KM8C 1G4CA 1T95A 4B9LA 1HNVB 5E0OA 2V5HG 5L46A 2LVWA 4AL6A 2JFDA 4RPFA 5DETA 1RYSA 1VOMA 4UQTA 5IS2A 1YDLA 3PCOB 4DU8A 1R6YA 1XMOF 3TA0A 3KLFA 2C2OB 2WZ1A 4FYDA 4IG3A 1WHYA 3W65A 3H5XA 3MPDA 2HFUA 2CJAA 4P9SA 3RJMB 2F8EX 4CLLA 2JEGA 2HZVA 5DQIA 1HHQA 1GFWB 2MB0B 4WXWA 2KZMA 4TU8A 1WC6A 2JEFA 3C16B 1I94F 5KFXA 1U1PA 1JX4A 2MJUA 1CLFA 4KT0C 3I5CA 1F2HA 5CCLA 1I5OB 2MKKA 1C2PA 4OI0A 2WOMA 3BBFA 4ED1A 3DU6A 1RTJB 1GX6A 3CC4S 2P6TA 4I4BA 1OS5A 2J8AA 2L41A 3KG0A 2JLGA 4ID5A 4O3SA 4IOBA 1HYSA 2MEWA 1E6VA 2YVSA 4JI3F 2ADBA 2FJAB 3DOKA 3LWLA 2BJDA 4BDPA 1UMJA 2VICA 1P1LA 4CO2A 1IBLF 3GWCA 4USKA 3FFIB 3DDIA 2VBWA 2W8KA 1REVA 1UJ5A 3UNGC 1KEKA 2ZM6J 2ZNZA 3O8WA 4I56A 5LM7E 1O0PA 2MQMA 4DR6F 5T7LA 3SMZA 4JI5F 3E01B 2R8HA 5KFIA 5GAHI 3O1LA 1T11A 3IAM9 1TL7A 4PG7A 1JWWA 4P7VA 2HLTA 8ATCB 3AOBA 4DCPB 4RUAA 2ZH3A 4ZMMA 4CH1A 1XK8A 4ANCA 5M2UA 5LXYA 1VFJA 2BVZA 1DFDA 2QLFB 4Q0BB 4LQ9A 4C97A 2IPOB 4E98A 3DLBA 5IT9U 1CVJA 4MT1A 2DGUA 2MQNA 1UEVA 3LP0A 5K5MA 1TL1B 4M5GA 2JC0A 1EX8A 2AQ4A 2HSEB 3X3UA 2YKOA 1X4DA 2B4UA 2Z30B 3MMBA 5H9EJ 1QUVA 4IYQA 5GMDA 5IFMA 3CDAA 2QLBB 2GW8A 4OX7A 3MM6A 2J9DA 3P8BB 4OJGA 3MCNA 3VGVA 1RWOB 3TZXA 5HSPA 5L1LA 3E3XA 3CCMS 3K8WA 1J2VA 4TY8B 4FBUA 1IKXA 2VBYA 1N6QB 5KT3A 4A8WA 2QYCA 1WC4A 2NS1B 4DX5A 4ZVSB 4BCAA 3FVYA 4KJIA 3DXBA 5C25A 4LFBJ 5GAHU 1A6LA 1Q82T 2KM8B 1D8YA 3DLEA 1JIHA 1HMVB 2D1CA 1EHWA 2KVQE 2B7BB 3I0SA 4LRFA 4HR2A 2MKHA 2J76E 3ZTOA 2OEJA 2AZ3A 1RAOA 2RQ4A 4U8YA 2HNDA 4H4OB 3D1QA 2JZ5A 1VHFA 4ZJQA 2O66A 4JI8F 1LWCA 4DEZA 3H4BA 1PO6A 3CSKA 4RW6A 2PI4A 2CVEA 3L7OA 3ZZOA 2VA3A 1SH2A 4LRDA 3VWSA 5T41A 1UVIA 2BRLA 3BSAA 2FVCA 1KLNA 1G2EA 5KFFA 1SKRA 1S1WA 4E0DA 4ED2A 3MI7X 3MR2A 5KG4A 4YR3A 3PX6A 3UD4P 1JLGB 1RT6A 4I0WA 3RAMA 3MM8A 2EKNA 2JLFA 3FBEA 3M1VB 3R3TA 3CO9A 4FNHA 2OTJS 1HD0A 3D0IE 4CLUA 5BR8J 4LR7A 1HWKA 5E3QA 5FDLA 1MWQA 3CJ0A 1TAQA 1B0VA 1R89A 1S99A 2FHMA 1FRIA 4QW8A 4E8UA 5HP1A 4B3RJ 3G82B 1VHIA 1WOOA 2E9RX 5GADI 3Q23A 3QSYB 2LQ5A 1U26A 3JYTB 3TNVA 2MQOA 4RBUA 1C1BA 3KK2B 1ZETA 1JJ2R 3OFGA 2OTLS 2J9EA 1FRJA 5HLFB 2A10A 1JLEB 2MJNA 2ZH5A 1YRUA 2AW0A 3NMRA 3FDSA 2FLLA 2DNLA 3LQVA 1OQ6A 2HYIB 3GE9A 5B0EA 3EE3A 5E33A 3QIDA 1Q5YA 3AD7C 4OHVA 2J0XA 4RJVA 2OIHA 1J5EF 3HD1A 1GTEA 4IH6A 1YJRA 2AJ2A 2E5IA 1WHVA 1FNOA 2MKIA 3P45B 2R42A 2YKMA 4A8MP 4FP9A 1GEHA 2BW2A 4K4VA 2HAFA 2XGQA 3BQ1A 1D3WA 5D4PA 1GXLA 4A8YA 5HK4A 3CWJA 4ED0A 2X1GA 3V6HA 1XN9A 2RU3A 2GVDB 3AHPA 4R0JA 2DHSA 3LA0A 5JXSA 4DUTA 3PO4A 4F3MA 2EK1A 2AGQA 3TUZC 3MHYA 1NZAA 3AA8A 3ZTRA 2K1RB 4EYHB 4KKOB 4CWBA 3BPDA 2MXYA 5I3UA 5IC4B 2R7RA 4RUCA 5GADU 3H20A 5CYMA 5C24A 4DR4J 4HT7A 1HWLA 2CQ0A 3OHBA 1VQSA 2HKEA 1WHWA 2FPHX 4DQPA 2PT0A 4OYPA 1YBUA 1U2FA 1YQHA 5MAOA 3NBPB 2ZH4A 1SV5A 2EC0A 3PW4A 1RWXB 2LECA 4FKYA 4PZVA 2DH8A 3KLHA 1MROA 5L38A 1RHRB 3OJSA 3EICA 3M9NB 2QA4G 2VOOA 2HZCA 2V4RA 4G3IA 4UY85 3T1HF 3DLGB 4WFBQ 4IG0A 4X4TA 1TK5A 3UN3A 1U7LA 4N8OA 4O3PA 1VQ8S 3M30A 5F0WA 2YQ3A 4WE1B 3PFOA 3CJ5A 4CZCA 3CMES 3K5LA 5ITHA 1NDKA 2XI3A 3OXFA 2DT9A 3MEGB 2D3ZA 3BR9A 1R0CB 2VA2A 3FBFA 1YJVA 4CT8A 4DL2A 3C6TA 1WSVA 1HR0F 1BQNB 4MFBB 5FLXU 3GJRB 3J7AN 4IR9A 3PR4A 2EEYA 4C8LA 3ISNC 3BO2A 1WC3A 1FT8A 4DU7A 4N56A 3ITHA 2DHAA 1RT3B 5KFJA 5ETOA 2LQJA 2JRSA 3MTJA 2D3O1 3CD7A 2A1BA 5JUMA 1GQEA 2BUNA 2OMLA 3WQPA 4NXNJ 2ZUAA 3KK1A 2BX6A 3JB9k 1L3TA 2O3DA 4TYBA 1SI9A 4AT1B 2MLZA 2QN6B 2GO9A 4NLXA 1QY7A 1H73A 3M9OB 4DR7J 2A2CA 1DTQA 4JI6J 3T5JA 2PC6A 3T1AA 2W1BA 2CWKA 4W98A 2XNRA 1ZA2B 5HAOA 4NPOA 3SV3A 3LGHA 4B3RF 3GP9A 2OSRA 2KXHA 1F6TA 2IYGA 2YWFA 1HBMA 2V67A 2DKOB 2C2MB 1KOHA 4PUOB 4ILLA 3Q8QB 1IR1A 3GMGA 2ZBRA 2QG9B 1VQYA 3KMSA 5ETMA 3PG9A 1AT1B 2AZ1A 2CPHA 4A8SA 2BKNA 3PRVA 2ZJPQ 1RLCL 4BC7A 2ILYA 5G0RB 4ZCMA 4DLGA 4X2BA 3LANA 1PJ7A 1S9EA 4USHA 2W24A 3KHRA 1G3OA 3IO1A 2WW4A 3Q8SB 4M1KA 3DLJA 2DPIA 4H4KC 1RT1B 2KFNA 1YZ6A 3PYGA 1LW2B 4N47A 4DL0C 3DXSX 1F5BA 2DH7A 3QQCD 2P9GA 1EQMA 1R8CA 2A6MA 4PPZA 2C2ZB 3POTA 4QWAA 4EBEA 1S1XA 4WFZA 3EDRB 4XPEA 4X84A 4KHPJ 1BC6A 2LU2A 2GA7A 1F5CA 4G6VB 3R7SB 4ZVHA 2E5LJ 3L09A 2KYZA 3UQSA 1HPZA 3ELHA 2COLA 4BS2A 1BQMB 4DV0J 3VALA 3MCOA 3MGJA 2P6SA 1LFWA 3UNYA 4KRWA 1AFJA 2CPYA 2P8IA 1UWBA 3IBFB 2PIIA 5B08A 5J2PA 2FHOB 1HI0P 3A4TA 2E29A 5JJBA 5F9NA 4GC6A 4F02A 2Y1RI 1WKLA 3QIPA 1OSDA 3NOCA 4KH1B 4DQQA 3FKBA 3KLIA 2BE2B 4CYUB 3FRZA 1JLQB 4DUYJ 1XNQF 4OX9J 4LIWA 3GCWP 1IWAA 3W64A 2ASLA 4MKVA 4CM0A 3D6FB 4J9NA 4KFBA 4TY9A 3J7ZT 3IA0A 2B8PA 3Q8PB 1DJ0A 3BGOP 4KHRA 4C8ZA 3HT3A 5DG9A 1NB2A 3I4PA 2OUGA 3W63A 2NPFA 2DGTA 1KVJA 5K8PA 3DRSB 3MPWA 2E1PA 1B0PA 4NLTA 2WSFC 3W8GA 1UEKA 2AD9A 1VGYA 1Q16B 4HKQA 5B0BA 3ZZTA 2Z56B 1TL3A 5F3ZA 2XC9A 4KH0B 1EB0A 1JNZB 3HULA 5J2QA 1XMBA 2QA1A 4ZP8A 1VIOA 3ZFVA 5DG8A 2XLIA 3SFUA 2CQ4A 4HL9A 3O6QA 2JDJA 4ZITA 2IJFA 3GFZA 1S9GB 3FGVA 4RLEA 2QA4S 4L76A 3GYXB 1B70B 4F26A 5AXNA 3D67A 4BWMA 1OSCA 3KJVB 4PG6A 2R2SA 4CLSA 5C7PA 3D68A 1WOSA 1T3NA 4RUHA 3J80Y 2HRYA 4NZ6A 1B64A 3GSIA 3OUYA 3N5BA 4MH8A 4MYUA 3QT8A 5A8RB 2JEJA 3SFGA 2CQIA 4NXMF 3NCRA 2HFNA 2MTLA 2HNZA 2BKOA 3D66A 1FK9A 4RW7B 1KRPA 1FEEA 2R8JA 4YB5A 4DMZA 2DGWA 5HMXA 4K4UA 4J9PA 2VKZG 3FUYA 3PKYA 1OIAA 1LQ9A 2ZC4A 4QIVA 1AYEA 1VK8A 4KV8A 1RWMB 1BMQB 2BA9A 2B5JB 2LEBA 2EI5A 4ZHRB 2FHKA 1AUDA 4CNYA 2JHEA 1B7FA 1NO8A 1RU1A 1VRQC 3UI3A 2VONA 1KQFB 2F1FA 2JL9A 3A8EA 4B3OA 3PX0A 1T0TV 1E6YB 2HW3A 4ZLPA 2CQCA 2MLYA 4LT6A 1UJ6A 3F56A 3MFIA 2CNKB 4W92B 3K7RA 4PQAA 3TANA 1VQ6S 1WTFA 4QBUA 4I2QB 2IRXA 2W9BB 4K4SA 4KHPF 4DSLA 1Y7PA 1HQEB 2E5LF 2QL9B 3T1YJ 3BS9A 1CJKB 3PEJA 4ECQA 4JI0J 1HQUB 1HARA 1PSDA 3AJ1A 2R4FA 4ZJOA 5EWFA 4ZPCA 4N8NA 5DS7A 2ALZA 1S12A 1Z4UA 3SCKE 2MPUA 3VF0B 1WORA 1GH8A 1RSCA 1RT7A 3UN2A 4G1IA 3KFWX 1Y11A 2GVZA 3OTOF 1PC5A 4DL7A 1H74A 3BGUA 1TAUA 3U27A 2DEJA 2DGSA 3G8TA 5AXKA 3HKZD 3BR8A 4DS5A 2N7CA 4X4OA 2YPYA 1JLAA 1VBXA 3RB4A 1K1QA 4JV1A 5HQLA 3V4IA 4PKDB 3G6VA 4DV2F 4LSLB 2L9NA 3OTCA 1N36F 2DHHA 3QT5A 1IKWB 2IVYA 2RDDA 3QGHA 1A0OB 1X5TA 3MF5A 4OI6A 1TU0B 3M2VA 3DOMA 3D2WA 3NOGA 2AJFE 4U9RA 1YVFA 4ZJLA 3W2VB 5B7WA 4HI2A 1SUQB 2PSZA 2KB2A 2WVFA 4ZKAA 2RVJA 1NK9A 2FVRA 2N3OA 1XBWA 5KG1A 5C2CA 2WVDA 3MM9B 3GZ7A 3PX4A 3RW7A 4DFPA 2HNYA 2VUGA 4ECSA 1H38A 1AFIA 3N01A 5D8HB 1KVKA 5KFUA 3SSSA 1U47A 5A2QU 1SQEA 3ZZRA 2J0SD 2VBXA 2U1AA 5SUHA 3VQSA 4OV6A 2ATCB 2DY9A 4M5NA 4FN5A 3KLFB 3E51A 1LEOA 4Y65A 1S77D 1XIQA 4RU2A 2JH3A 4I6YA 2B6AA 4WK1A 4IG3B 3KXDA 3HHLA 2RJZA 2ZHAA 5K9FA 1FHTA 2XS7A 1RLDA 3ZZPA 1LWEB 2FY8A 3NGDA 2F9JA 4LF9F 2A18A 2X3GA 1HW8A 3HT0A 1TKTA 4ELVA 3I32A 1PG5B 4BLGA 2LQ9A 1TKXA 4NLRA 2ZH9A 1X9MA 1RT4A 1JXLA 5BYSA 2C42A 2RRNA 5EGYA 2KT5A 4Q7AA 6FD1A 2EG2A 3Q8RB 4C3LA 4O0NA 1TR0A 2X7IA 1RHUB 3I87A 2B9WA 4NASA 1C4CA 3EGNA 1YBTA 2XTJP 4ID5B 4ER8A 4Q45A 2BV3A 1TQLA 2DNPA 2XMWA 2X1FA 1E6VB 5ETRA 4DPUA 3G8QA 2E7XA 4B9NA 3DKDA 1VQKS 1X5SA 5LJ5Y 3OSPA 3W5ZA 2PMWA 2KO1A 2DIUA 2OKQA 1UFLA 2GS8A 3HSDA 1XMQJ 3CIMA 2W2OP 4Z7CA 3ONQA 3IGNA 4HEA9 2I2YA 3IBWA 1TL7B 3BREA 1OJ4A 5KG2A 2VF3A 4OX6A 2HGLA 2FY1A 2DPJA 3DRPB 1K73T 1CC7A 1RB0A 3IRWP 1NJXA 2KN4A 4WU2A 3RUBL 1HNIB 1FA0A 3PKMA 2HHVA 3JQJA 1NXIA 1NK5A 4A47A 2Q3PA 4AD6A 3BO3A 3QBCA 5L8RC 1RTHA 2RDIA 2V4JA 4CLKA 3OPKA 4KO0A 4X4VA 2XCPA 2I8EA 2RHQB 4U96A 3ZTQA 2E5JA 3EVOA 2QMXA 5K8NA 1RTIA 1VQ7S 2FJWA 3BSOA 4ENOA 3V81A 2FLOA 2RUSA 1S10A 1FRLA 5E5NA 3WC2A 2K06A 4IFVA 4A4JA 1XERA 3LTOA 1IKXB 4PXCA 2DEIA 3I4HX 4M5DB 2PA3A 4JBCA 1M5SA 4NWBA 3I96A 3M8PB 4B3SF 7FD1A 4USTA 1WI8A 3KTQA 1HI8A 3ZTPA 1DY3A 3FCWA 4MTPA 2VQFF 2FLNA 2C2KB 4JI4J 3H7HB 2FC9A 2YTCA 3I0SB 1R31A 2NUUG 1RDRA 4U7UD 1SC1B 1U6ZA 1DZ5A 4IKAA 3M6VA 3TAPA 2EVZA 2HRUA 2GZOA 4YQWA 4NLSA 5KFNA 1BXNA 1RAAB 3DU5A 3QSIA 1LWCB 3LAKA 1RHKB 3J81U 3SYZA 3B4DA 1UEUA 2PFDA 4CI0B 2FZKB 2CNLB 2M4MA 2HS4A 2P9CA 3E2EA 3L3CA 2YWEA 3GFYA 1Z1ZA 2ZHBA 3FFIA 1RT6B 4ZPVR 3VAGA 3MM8B 3DGPA 3HJVA 3ILLA 4LF8F 1K44A 2RU9A 2C28A 1Y5IB 3A13A 4HHJA 4DPWA 4OYOA 5FDLB 3AT1B 3CDEA 1DQ8A 4WP9A 1JKHA 3G86A 2A0FB 4Y28C 4C6AA 4L73A 2MQPA 1JQGA 4G1QA 1RUSA 3H98A 1WC1A 2KL8A 3ZNJ1 2LEAA 3BBCA 1C1BB 2AF6A 2DO0A 4MAKA 1SL0A 4ECVA 1FRHA 2A3JA 2XO6A 1QLNA 3DLKB 1Q81T 5KFGA 1TL1A 2Q1LA 4YY3J 5A0YA 2JVRA 4DI6A 1VCTA 4HLBA 3OJUA 4I2PB 2CQDA 1W2IA 5AT1B 4CP5A 1XMQF 4NYZA 2C1EB 2G0IA 2R2UA 2BM1A 3QNWB 3OLBA 3DN9A 3MEEB 1ZBTA 2W7OA 1VC0A 1TMJA 1VJWA 3HHKA 3EYZA 4TYAA 2C3PA 3RU0A 3AODA 1LXJA 2IIHA 3AB4B 3WIUA 2VZ9A 3T41A 3NWGA 4GC7A 3L4BC 1WKKA 1RHJB 2FQQB 2XYHB 4HI1A 2H1YA 2MGZA 1HMVA 1U6BA 1ZPVA 4AE5A 3JS9A 2DGXA 3KHLA 4P52A 3GV8B 3NS7B 3NGRA 1KNZA 4P71A 5CYMB 5C24B 5DG7A 2WSCC 4TN2A 1H3DA 4URGA 2G4BA 5E3CA 1Q8IA 1FX4A 3ENQA 3OFFA 3LH2S 3OV7A 1VS3A 1V6HA 4I64A 3HF5A 1NH7A 3P4UB 5KT2A 3JSMB 2C22A 4TQSA 2IJRA 3HDSA 1UVLA 1FVQA 4UUWA 3VVUA 1IVZA 5T14A 2HBYB 3H2VE 3RB3A 3IG1A 3KLHB 4FXDA 1MROB 3JSRA 1B4SA 3AJDA 1WTBA 3C3LA 2DXFA 3AA9A 1JLGA 1ZTTA 2Z2ZA 2HHUA 3HHDA 2OP5A 3M1VA 3NAHA 3TJ9A 4OIXA 2DR7A 4IG0B 1ZOTA 3CB4A 5F8HA 3G8SA 4JI4F 3QGIA 3P5TL 2B7CB 3V6KA 1UVKA 1SL2A 2VFSA 3TZYA 3VAIA 1HHSA 1V3SA 1FVSA 3JQKA 2M8DB 3IS9B 3FNNA 1NK8A 3M6UA 1NHVA 3IRXB 1ZH5A 1NSKL 3NLCA 2YQ0A 1WEYA 2UUAJ 5CHCB 1WEZA 2R7OA 3BV8A 5HLFA 4B9TA 3TW0A 2WHOA 3R5AA 1VQ9S 3MR3A 4TLQA 3ITHB 3DRRB 3W8PA 5KFSA 1UZHA 3LWMA 4FF3A 1IKVB 1H72C 4C0OC 1B7YB 5IV4A 4ZVEA 3OVBA 4ZPDA 2L48A 1U8WA 4OYBA 2FB0A 3N6MA 4ED3A 2YKQA 3G87A 4K59A 4NEZA 4OHZA 3G6XA 2GHWA 2DRDA 1SC3B 1U1OA 3W9HA 4G1PA 4QJVA 2E1RA 3MMCB 1DTQB 2ZNYA 2M7SA 2RB7A 3MWBA 3OLAA 3QT7A 2O5DA 4QWEA 1S5ZA 3QAUA 3M8ZA 2GVDA 2IM0A 4DZ6A 4YS2A 3VAFA 2GHVC 2BJ3A 1UW4A 3IGVA 1DLOB 1WD6A 2K1RA 4FF2A 2W7AA 3D9BA 4ZLJA 4DV7J 2ATLA 1HA1A 2V4QA 3TEGA 4YY3F 5HQ8A 1DBDA 4J9SA 4PXBA 2KYXA 4F0HA 1FXRA 2KI2A 3Q2SC 4QWDA 2DB1A 2EFPA 1S9EB 2PEHA 3CCLS 5F8NA 5CCMA 5I42B 2DHXA 1GXUA 1UETA 2C2NA 3NBPA 2VU5A 2YWWA 2NYHA 1NEEA 3TVKA 4Y2CA 2ZHOA 4Z7YA 3H2LA 2BE9B 2MKCA 3DRXA 3KNAA 2RAQA 2QA2A 4F25A 3GCXP 3FQLA 5F8GA 1WI6A 5G4DA 2V0NA 3DLGA 1S0NA 5KFRA 3PRDA 3W3SA 1S1XB 1RWVB 4UZCA 4WE1A 3MUVP 3GR1A 2W4DA 2VPXB 1JXVA 4J9OA 4QR0A 4UQGA 4NMXA 1X60A 1HPZB 3C15A 2ILZA 3MEGA 3S7RA 4HDHA 1CJUB 2DCUB 1BQNA 3U1MA 5J2PB 4UTGA 3F73A 2WAQD 1RBOB 3ETMA 4K2JA 1Y3JA 4WIIA 3MR6A 1QAYA 2I0XA 5IT9Y 3M8YA 4OZNA 3QIPB 1RT3A 2ZH8A 5C42B 2AP6A 3SQOP 2VFTA 2CPDA 4QWCA 3AJ2A 2DTJA 3W5YA 4NLDA 4F3QA 1EIYB 4B3MJ 2ALYB 3K17A 2CPEA 2R7TA 3KK3B 4EWTA 1ZZFA 4RX6A 3TJAA 2CQBA 4LREA 3SCIE 5I4MA 4GKJJ 1IJEB 3A1YG 5KFWA 2PD1A 4CLWA 4J91A 5D78A 5E7OB 2B3TB 2UUAF 2KRRA 1TELA 5K20B 4NLQA 1IBKF
chains in the Genus database with same CATH topology
5IT0A 3I9ZA 3NBPB 3PW7A 1D9DA 4MK9A 2ZH4A 1SV5A 1GTHA 1TL3B 1N33F 4NA2A 2EC0A 3PW4A 1WF2A 4B9MA 2LECA 2DNQA 4CH0S 2G9OA 5HP1B 4PG5A 4O0IA 5D3GA 2DNGA 2DH8A 3PHEA 3KLHA 1MROA 4PXDA 2QSFA 3DRYA 2EKYA 3FEXB 3MFHA 3NGKA 3C2PA 5L38A 2YNHA 4ES2A 1M5VC 1G6BA 2GQQA 4OI4A 3OJSA 4EO6A 3M9NB 1RGVA 2Y1IA 4F8RA 3MAQA 2KFYA 5J2QB 2UUCF 2XULA 1T94A 5G0RA 1TFYA 2CQGA 3V5RA 2RIJA 2YNFA 2QA4G 2VOOA 4QU6A 4Q0BA 2JFKA 2HZCA 5AE3A 2V4RA 2QFJA 4DV0F 4G3IA 4UY85 1L3KA 1N5YB 2IRUA 4N41A 2CJKA 3T1HF 1TK0A 4DHVA 4X4UA 1VIXA 3DLGB 2VG6A 4WFBQ 4LFAF 4IG0A 2FD2A 4X4TA 3DMJB 3FSXA 1TK5A 3TI0A 2ASJA 3BDEA 4ZPTR 4IR1A 4V19J 2XLKA 1IJFB 1U7LA 4OX8A 1NU4A 4XK8C 5DDQC 1X9SA 3TVYA 3X1LB 4N8OA 4O3PA 1VQ8S 1UFWA 3M30A 5F0WA 2YQ3A 2WB4A 4WE1B 1JLCA 2ZDOA 3PFOA 4ZP9A 4ZVGA 2AYMA 4J9LA 2F8MA 1M5KC 3CJ5A 4CZCA 3CMES 1I1GA 1T3OA 4RW9B 2VL1A 4B02A 3K5LA 3DI6A 3ISZA 3BSNA 4OZLA 5ITHA 3CT9A 5KT5A 2CRLA 3RR7A 4WYWA 2XI3A 3OXFA 2DT9A 5KFYA 4ES3A 4C8YA 3MEGB 2D3ZA 4A46A 4C7QA 3BR9A 2VA2A 1FDAA 4D3HA 3OUYB 1KC8T 3HO1A 1YJVA 3MPYA 5DGAA 5KOXA 3N0VA 1TL5A 4DUYF 4CT8A 4F2SA 3G96A 2RKIB 2ZJRQ 2IMWP 4DL2A 3C6TA 4URSA 4GKKF 4ECZA 2IBKA 4USJC 2EK6A 2JX2A 2UXBF 4OX9F 1HR0F 2RH3A 1BQNB 5HN0A 4MFBB 4EYIB 2GIRA 4ZPWR 1VBYA 3GB0A 2HNZB 1ELOA 3OL9A 2PE8A 3GIIA 5AJ3F 1GNKA 4N76A 1NKCA 4TY8A 4IR9A 2ZDPA 3PR4A 2YKMB 4C8LA 3T9NA 4RNFA 5LMUF 3LP2B 3ISNC 2XY7A 3PEHA 3BO2A 1LW0B 4WFAQ 4M94A 4QYZJ 2C3OA 1FT8A 1XR7A 4NYOA 3B82A 5CQGA 4N56A 1N6QA 1KHWA 1KHVA 2YWGA 3ITHA 3UFCX 1NRKA 5KG7A 2GQCA 2RNEA 2VV5A 2HFOA 5J1EB 2VFUA 3LGMA 4YR0A 3DOLB 2DHAA 1RT3B 5KFJA 2LQJA 2JRSA 3MTJA 4PCQA 1Q79A 4QR1A 4YEAA 2IJNA 3MD1A 4ED5A 5KFMA 1BQMA 1KONA 3CD7A 2A1BA 4EO8A 4I69A 3BSCA 1O8BA 5JUMA 1U48A 1GQEA 1X4EA 2BUNA 2OMLA 4F4ZA 1QE1A 1L5UA 1WHXA 2DK2A 3KK1A 4NLGA 3DHWC 4FS1A 3JB9k 1L3TA 2K8GA 2O3DA 4LF7F 3HKWA 4TYBA 1SI9A 4Y2IA 4DOZA 1C4AA 4U7CA 2PI5A 1T7PA 2E1MC 2GO9A 3OR1B 4NLXA 1QY7A 2VC1A 1DAXA 2B43A 2ASYA 4FZVA 2OPRA 3M9OB 3HP6A 4HDGA 5I3UB 2VOPA 5LL6d 2A2CA 1DTQA 3H8YA 2OLWA 1U25A 2Z2LA 1WEXA 3CVKA 3T5JA 2PC6A 4UOCA 3T1AA 2XNRA 4NPOA 3SV3A 5B0DA 3H5UA 1N4LA 2HS0A 2CPFA 3MEKA 2I5JB 3BO4A 2DR9A 3C46A 1N56A 2IYIA 5A6PA 2CG4A 3MEDA 1BD6A 1ZAXA 2JVOA 1S76D 4B3RF 2VG5B 2UUBF 2BE2A 2KXHA 2OSRA 4H4OA 2GO8A 5DDPC 4DWIA 2IYGA 2YWFA 1HBMA 4QPXA 1W2BR 1MU2A 2OPSB 3RTVA 2HG4A 3M6WA 4KPYA 1KOHA 1SIZA 1RP5A 4PUOB 2XMMA 3CDBA 4ILLA 3BEGB 3J7Z5 3Q8QB 3GMGA 4RNOA 4QIGA 1MW7A 1X9WA 5F8JA 3DYAB 2J9DE 1WELA 4MK7A 1VQYA 5E3PA 1KR4A 2MQLA 1ROFA 1CQNA 3MM7A 1R8BA 3NS5A 4A48A 5I3QA 5K8MA 2LQBA 1RAJA 1XEZA 3KMSA 3UE2A 1SV5B 1HNZF 3RR8A 4CO5A 2CPHA 2F4VF 4A8SA 2Q43A 3CXCR 2I1RA 2MHNA 2MY7A 3NRBA 4XDDA 2XY6A 2ZJPQ 2YNHB 1H98A 4BC7A 2ILYA 3QWPA 5G0RB 3HFKA 4IOAQ 2IBOA 3UCGA 1TKZA 4ZCMA 1YG0A 2YNFB 1SJFA 3RBEA 1JJHA 4DLGA 4C9DA 4X4QA 1FE4A 4ITSA 1KQGB 2LLZA 1U2RA 3DRSA 2BABA 1UAWA 4AUKA 2AJ4A 1JXEA 2V8VA 2UP1A 4X2BA 3LANA 5DM7Q 2UVRA 3PY8A 2ZOFA 2YX7A 4UY8T 1ZPWX 1S9EA 2XI2A 4QOTA 2GQ2A 2HWTA 2EBEA 2JSXA 2W24A 4USHA 3TX8A 1NHUA 3M2RB 4NCBA 1Y5LB 4C2MA 3CJKA 5IXUA 4OL8A 3M30B 3KHRA 4KR0B 1JLCB 1NJZA 4OZ5A 4N77A 1G3OA 2HQ3A 3IO1A 1RT7B 2DNZA 3FSYA 2X51A 3Q8SB 3DI6B 1KD1T 4HT5A 1D9AA 2HLUA 4HYKA 2OPPA 4M1KA 3CC7S 2EFNA 3CIZA 4CTAA 3DLJA 2C2DA 2DPIA 4X64F 4TU9A 1U1QA 3C8YA 1X4HA 4H4KC 4DL6A 1RT1B 1QSYA 2DNYA 3OVAA 3KHHA 4QYRA 1HBNA 2KFNA 4IH5A 1HW9A 5IM0B 3C6TB 2BQRA 1C0TA 4DQRA 1LW2B 2GCFA 2K2PA 4N47A 3QO9A 1CPZA 4DL0C 2YNGA 3JYTA 3DXSX 2LU1A 2DVIA 4ZK7M 1F5BA 2XNQA 2IM2A 3KK2A 5B0GA 2W8LA 3PW5A 2DH7A 3G9CA 2FC8A 2P9GA 1FDNA 3T5KA 2IFXA 2DNMA 4B3MF 4NRTA 1R8CA 4JYAF 2WTFA 3H40A 4ECYA 1XNRF 3BM7A 3SEOA 1SL1A 4PPZA 3NAIA 4D3GA 3POTA 5F0UA 1JLEA 1JLAB 2CPIA 4QWAA 2XMUA 1ZAWA 4MK8A 3V6DA 1QVFR 4EBEA 1LXNA 1S1XA 1S9GA 2UZAA 4WFZA 4J9RA 4XPEA 1FKOB 4X84A 1HBUB 1BC6A 1S7HA 2ZE2B 1IR0A 3MURP 1Q4RA 2LU2A 1K8AT 2QLWA 2GA7A 4F3OA 1F5CA 4G6VB 3VCDA 3PNIA 4ZVHA 1FTRA 5FD1A 3CUNA 3L09A 2KYZA 3UQSA 1HPZA 5CXTA 4CNZA 2COLA 1MWZA 5HMWA 1BQMB 3CCQS 4BS2A 1ULRA 3VALA 1QAJA 2FHJD 3B78A 4OQJA 3MGJA 2M88A 2P6SA 2KZZA 1LFWA 4KRWA 4HVZA 3KK1B 2CPYA 1AFJA 4ZVFA 3ICLA 3GQCA 3R1LA 2OPQB 1ZYQA 4V19X 1KVIA 2OSQA 5GAEI 6FDRA 2FGOA 5A8RA 1L3SA 1ZM9A 1UWBA 1WNEA 1X7VA 2L3MA 5KG5A 3AH6A 2PIIA 4Y6IA 2XWYA 2W4PA 3OTBA 5B08A 5J2PA 3NCQA 2HWHA 2KHCA 2JEIA 4Y3CA 4ZPAA 2FVSA 4RW7A 2FHOB 4LFCF 1HI0P 2VQEF 2RF2A 2E44A 2E29A 1U1KA 3H4DA 1AW0A 5JJBA 2EFQA 5F9NA 4GC6A 4FS2A 2BQUA 4DQIA 1TZ0A 4ECWA 4F02A 2Y1RI 1CSJA 1C0UB 4ED6A 3QIPA 1HL6A 1HFEL 1OSDA 5L9XA 4DQQA 3I55S 2BBEA 1N5VA 2F9DA 2BXJA 2Q6CA 2O1PA 3KLIA 2BE2B 3OQ2A 5LJ3Y 4DJBA 3RRHA 1NB7A 1HBMB 3GG1A 2B9YA 4CIOA 3FRZA 1MU2B 1JLQB 3T1YF 1D8ZA 1XNQF 2GJIA 1PGZA 1SJRA 3I82A 1OQ3A 4MKBA 4LIWA 2B5JA 3P96A 4R5PB 2ASLA 4JI0F 4ED7A 2WSEC 4ZHRA 4H4KA 3BQ0A 5D4OA 4KFBA 4J9NA