2D9PA

Solution structure of rna binding domain 4 in polyadenylation binding protein 3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
103
structure length
103
Chain Sequence
GSSGSSGDRITRYQVVNLYVKNLDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of RNA binding domain 4 in Polyadenylation binding protein 3
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Polyadenylate-binding protein 3
total genus 8
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2d9pA01
2M9KA 2DITA 1G2EA 2I38A 2KHCA 2MZTA 1YWXA 2NLWA 4YB1P 1KC8T 2JX2A 1X4FA 2MSTA 5GAGU 1QVGR 2EK6A 1D8ZA 2ERRA 1WF1A 2DHSA 2XNQA 2KXHA 1UW4A 2X1GA 1H2UX 2RU3A 2LYVA 3J7YU 3R1LA 4W92B 1NJIT 2D9PA 3CC2S 2CQ3A 1ZH5A 2PE8A 1DBDA 1VC5A 2L9WA 3VF0B 4YUDA 3BO4A 2N3OA 2MZRA 5H1SV 2D3OR 1K9MT 5DDQC 2KM8C 2B0GA 1Q86T 2BOPA 5IM0B 3I56S 1IQTA 1YJNS 1S72S 3CCRS 2MQNA 2DNOA 2HVZA 4PRFA 4TU9A 1KQSR 2X1FA 4FXVA 1S79A 2M7SA 2AYEA 2FPHX 2XNRA 2G0CA 2CPZA 2F9JA 1WHYA 5DETA 3B4MA 1SJ3P 2J8AA 2LXUA 3B4DA 2CPJA 3CCUS 2KU7A 3MURP 3D2WA 4WIIA 1WI8A 3FEYB 1U6FA 1QVFR 2CQHA 3CCQS 3H2UB 1VBXA 2HGNA 3UWTA 2CJKA 3MUMP 1PO6A 5CA5A 2G1DA 1X0FA 2E5IA 2JVOA 4M5DB 3S8SA 2ZJPQ 2CQIA 1U1LA 1Q7YT 2CPEA 3P6YC 4IUFA 3G4SS 4CIOA 2CQGA 5HL7Q 2CQDA 2LQ5A 1N54B 2Q79A 4PR6A 1N8RT 1A7GE 4WFBQ 3ZZZA 1H2VZ 3CMES 2EK1A 4Y00A 1XN9A 3RW7A 1X4HA 2DHGA 1R8HA 2MZJA 1YJ9S 2VONA 2EVZA 2E44A 2RT3A 5LJ3Y 2YH1A 1YI2S 1U1OA 1DHMA 2HGLA 2HYIB 2DNRA 5DM7Q 4QPTA 1U6BA 1SJ4P 2RQ4A 2CQBA 3VAHA 3MUTP 1P27B 1X5TA 2U2FA 1BY9A 1X4CA 2BZ2A 2DHXA 1F9FA 1SJQA 4U67Q 2M8HA 1VQ8S 2L08A 2QEXS 2J0SD 4UY8T 2JWNA 1X4DA 3G6ES 4LMZA 4Y0FA 1YIJS 2XS5A 2DGWA 3Q2TC 2LEBA 3TP2A 2MYFA 1WI6A 2CPIA 1AUDA 2LEAA 2OTLS 4WFNQ 2V94A 3CD6S 1X4GA 3P49B 3THTA 5IM0A 1FXLA 2MKIA 1WG4A 3VAJA 4OZ0A 3DLLQ 2MJUA 4C4WA 3LQVA 4TU7A 3BS9A 1UAWA 2CQ4A 5D77A 3ULHA 1H6KX 3IRWP 4QU7A 2OTJS 1ZZFA 2DH8A 4LIRA 1HD1A 4TLQA 5LSOA 3V4MA 3U1LA 2ADBA 5GAHU 2N7CA 2MKSA 1VQ7S 2DGXA 1KD1T 5ITHA 3R27A 1R8PA 2DH7A 4CH0S 3PIPQ 3VAGA 3MD3A 2F9DA 2JVRA 2MZQA 1A9NB 1PGZA 3SMZA 1X5OA 3NMRA 2KXNB 2OIHA 3FEXB 2M8DB 3MDFA 1FJEB 1SJFA 4Z2XA 2MQPA 1VQLS 1JJ2R 1VQOS 2J0QD 2KG0A 4UQTA 2CPDA 3LPYA 1VQPS 4PKDB 4C0OC 3CC4S 2E5JA 1X5SA 2G4BA 1WG1A 1VQ6S 1OIAA 3K0JA 1U1NA 2MKJA 3BO2A 2ADCA 2PEHA 1UFWA 2MHNA 2DIUA 3S01A 1Q81T 3UD4P 1M5OC 4WFAQ 2MY7A 2CPHA 5CXTA 2UP1A 1D9AA 2X1BA 1X4AA 5JVGQ 3P3DA 1OO0B 2DGSA 5GADU 3VAKA 1M5PC 2KG1A 1HA1A 3HHNB 2SXLA 1X5PA 1WHWA 5DDRC 2M52A 2MKHA 2DHAA 1M90T 1O0PA 3EGZA 3OW2R 2O3DA 3I55S 4EGLA 3SDEA 1WEXA 4OZ1A 1WEZA 5IFMA 3TO8A 1YITS 4ED5A 3NNAA 3CC7S 3VAMA 2HGMA 1WELA 2ZJRQ 3MXHP 2DNYA 2KH9A 3NNCA 2MZ1A 4FXWA 5LJ5Y 1URNA 4QU6A 2A3JA 2QA4S 4IO9Q 2YKAA 4ERDA 1WF0A 1X4EA 2MQQA 3R1HA 1KOOA 2YH0A 2ZJQQ 2MQLA 1U2FA 2DNPA 2KT5A 5HO4A 4BS2A 3UCGA 1VQMS 1RK8A 2MJNA 5MLCV 4RU2A 2KFYA 2CQCA 3G8TA 1VQ5S 3CCMS 3EX7B 3UCZP 1W2BR 3MOJB 2OSQA 1FO1A 2AYMA 1YTYA 3CTRA 4LJMA 1FHTA 2MKKA 2K8GA 2MXYA 4J5OA 3H2VE 2DNGA 2D9OA 2L41A 2DIVA 2RVJA 5DDOC 1M5VC 3G96A 2CPYA 1VC6A 1JJ4A 2DH9A 3CF5Q 2XSFA 3UCUP 4WKRA 2MY8A 1CVJA 3G71S 4P6QA 2CQ0A 3MD1A 2YWKA 2FHOB 1JJHA 1M5KC 5LXYA 2DISA 2GHPA 2RNEA 2MGZB 2HZCA 5GVQA 2KN4A 2LXIA 3CCLS 1L3KA 4WCEQ 1HL6A 1WTBA 2MB0B 2KI2A 2FY1A 3CULA 1SJRA 2CQ1A 2RRBA 1FT8A 1FJ7A 2DNLA 5GAEU 1WWHA 2E5GA 2XB2D 3EGNA 1HD0A 2MMYA 4A8XA 1K73T 3Q2SC 5LSLA 2X1AA 3S7RA 1VBZA 3MUVP 3CPWR 2M88A 2LCWA 3NS6A 5JVHQ 1DZ5A 1UP1A 1U1RA 1WHVA 1YJWS 2RS8A 1U1PA 1H2TZ 3US5A 4F25A 3RW6A 1U1MA 3VALA 4QQBA 1YHQS 3G9CA 1OWXA 2LA4A 5D78A 2DGUA 1OPIA 2M70A 4CQ1A 2E5HA 5IQQA 5BJRA 2LA6A 5GMKa 2MQMA 2KM8B 4V19X 2DGTA 2DO4A 2DO0A 1QM9A 2AYGA 2F3JA 2RUGA 2CQ2A 3IWNC 3THPA 2M4MA 4YOEA 5DDPC 3VAFA 2DB1A 2VOOA 3HI9A 1NO8A 3UE2A 1DRZA 2XS2A 3N9UC 2AYBA 3G8SA 2N82B 2XS7A 1U1QA 2FC9A 2DNHA 3SXLA 3VAIA 1ZZNA 1X4BA 1Q82T 3CCJS 4F02A 3S6EA 2CQPA 3NS5A 3CCSS 1VC0A 4F26A 1B7FA 1N52B 3CXCR 2DNQA 4WF9Q 2MZSA 2K3KA 2KXFA 2WBRA 3ZZYA 4TU8A 1VQ9S 2LKZA 2N3LA 3PIOQ 1NU4A 1P1TA 2OJ3A 5DM6Q 3UD3P 1VQNS 1N88A 1JMTA 2OSRA 3DXBA 2LECA 2NZ4A 2DNMA 4IOCQ 4C7QA 2DNKA 3NNHA 2KRRA 1VQ4S 2RQCA 3U1MA 2DK2A 2CPXA 2RRAA 3CCES 2I2YA 1KOHA 3BEGB 3TYTA 2MKCA 2JRSA 2QFJA 3CCVS 2M0GB 5CYJA 5EN1A 2DGQA 3L3CA 2VODA 3BO3A 2MQOA 2CPFA 2M2BA 4W90B 1WF2A 5FJ4A 1M1KT 2FC8A 3CUNA 2KYXA 2MPUA 1FNXH 2RS2A 2MSSA 2DGOA 1SXLA 3JB9k 5LXRA 1WHXA 1U1KA 3P5TL 2YTCA 1RKJA 2DNZA 4IOAQ 2DNNA 2AD9A 2DGVA 4ZKAA 2LMIA 3SDEB 2MGZA 2J76E 2GO9A 1K8AT 1WG5A 3MI7X 2VOPA 3CMAS 1VQKS 2KVIA 2U1AA 1VBYA 1FJCA 4CH1A 2KRBA 1WEYA 3J7ZT
chains in the Genus database with same CATH superfamily
1AW0A 3OFEA 2VG6B 1YQHA 1VCTA 1UTAA 1K0VA 2EKYA 1M5HA 2GVDA 2HMIA 4YB1P 4FF2A 2JX2A 1T11A 4U96A 3ENQA 2BW7A 3MM9B 1QVGR 2W7PA 1WC0A 4PG8A 1TTHB 2Y1RI 1GXLA 2A10A 2ERRA 3QRPA 3ZZOA 2IBKA 2BKNA 3QSYB 1Q16B 2LYVA 2Y0SD 2BRKA 2E9TA 2F8MA 3BGOP 3H42A 4MAKA 4USVA 1F9HA 4JI1F 2XMVA 3CC2S 4P73A 1WOSA 1ZAWA 4KQZA 4NMLA 4WP9A 4TNOA 1EP4A 4HEA9 4WFYA 1YG0A 4B3MF 2XYHB 4A46A 1U47A 1EZZB 3M2UB 4LRDA 3CD7A 2WVDA 1MMLA 2CVEA 2IJNA 4HH1A 4KGMA 4ID5B 1I1GA 2N3OA 4DF8A 2VQEJ 1WACA 2C2EA 3WHIA 5HBMA 3DDNA 2UVWA 4ALZA 4DR5F 5BXIA 1GXTA 2WAQD 5D0RA 3RJMB 3HHLB 3OHAA 2DPIA 4CLWA 1S1TA 5L46A 4G65A 4Q5VA 3A8KA 5KFCA 2B0GA 3UN2A 1X8DA 4Y28C 1Y5LB 1CC7A 2E1PA 3GILA 5F8HA 4M5JA 3RB6A 1RI7A 1RBAA 1IQTA 4ZP6A 2HWTA 2J6TA 1CS4B 4KPYA 1TKTA 2GAGC 2R2RA 3FCHA 4YR2A 2CKWA 2UUTA 4NLUA 3F44A 3CCRS 2YY3A 4PRFA 4EBDA 4DL5A 5KFZA 3ZZPA 2H65B 2ZEJA 4FXVA 5KT5A 4X62F 5KG6A 1QAJA 1HNWJ 1DQ8A 4WK3A 4PPDA 1C1BA 1S6PB 1H98A 4X2BA 4UY85 2CPZA 1ELOA 1C1BB 2VF3A 1RT2B 1M1GA 3IBWA 3J7YI 1CQMA 3Q0AA 2PFFB 5A0YA 3BZQA 3HD1A 3RB0A 1NHKL 4IO1A 4XDDA 2HS4A 1FNMA 3IG1A 3DRRB 1GMWA 2R7RA 3FEYB 1TKTB 1I51B 3O3LA 5KG4A 5A2QY 4DF4A 2NR0A 3QJPA 1C1CB 1OSCA 4J7CA 5G0RA 3R8YA 3HP6A 3C19A 4DLGA 1NKEA 1S1WA 3SCLE 1JJ4A 5J2PA 4ATNA 3W9HA 1OJ4A 4MKVA 4LF6F 2O1PA 3I4PA 3PW0A 2EBGA 1NHUA 2JVOA 2K06A 4K5RA 2V69A 4A8QA 3RBEA 2CQIA 4FKXA 2BXJA 1RHUB 5LMUJ 1U1LA 4X84A 1VRTA 2AJ2A 1RTIB 3TZXA 3UFCX 4TQSA 2ZOFA 3JSMA 2CQGA 4U6PA 2HNDA 4JI4J 4OI0A 2WVEA 5LOQA 1QSYA 5IT9Y 2Q79A 4GMKA 4G1QA 3OR2A 4WFBQ 1CJKA 2GGPB 1U48A 1EP4B 1IM6A 1NSQA 3MPUB 2EK1A 3M6XA 1RAFB 1X4HA 3JYTA 4OLPA 3OUYA 2UUCJ 1CJTB 1RWMB 2ROPA 2RT3A 2YH1A 2A2CA 4AL7A 3GPAA 1NDLA 4X66F 1SV5A 1REVA 2IM0A 2OO4A 4M1KA 4Y6IA 3KHGA 2HYIB 2JJ4D 3GJRB 5DZ6A 2WTFA 3OVBA 2ATCB 5A8RB 1U2CA 1NMEB 4F67A 2J9DA 4DV0F 1SJ4P 5KFBA 1HWLA 1KS2A 5D0EA 3VAHA 1IBLJ 5ETSA 8RUCA 3MUTP 3ZZUA 1P27B 2U2FA 1HBNB 2XY5A 3HFKA 1X4CA 5HANA 4USMA 4P7VA 1XMOF 2HNZB 4R0JA 3H0PA 1XIQA 3IWLA 2CWKA 3CVKA 2IA0A 4IG0B 4U67Q 4HT5A 5D4PA 4LSLB 2KKHA 4NEYA 4RKUC 3RU0A 4QW9A 2AGOA 3K89A 5AT1B 3HHLC 3R7NB 4C6AA 1X4DA 3FGVA 2KZMA 4WZMA 2VC1A 4RWXA 2ZE2B 2BEFA 2IY5B 4UOHA 1B4SA 2ZNYA 3ZC4A 4YEAA 3GV7B 4MK8A 2W25A 5F3TA 3CJKA 3IP0A 1TL7A 1HWUA 4JP8A 1UA1A 1AUDA 3PM9A 2YNHA 2LEAA 3NP5A 4ENOA 3G82B 2V94A 4DBQA 2FLNA 3UO0A 3AOAA 5J2QA 1X4GA 1TAUA 2EI5A 3F41A 4YN3B 3THTA 5IM0A 1FXLA 2MKIA 4K50A 4FYXB 4WTYA 3OBIA 5EX3A 1KEKA 3EMTA 4OZ0A 3DLLQ 5K8NA 4LF2A 3VGTA 4B02A 1OY8A 2AZ1A 2QIFA 2PDAA 1NK6A 4C4WA 1RTJB 2YNIB 1T94A 1JNZB 2VDHA 4TU7A 2KTQA 1R8CA 3ULHA 1XWLA 2AJ0A 3IRWP 2IMOA 1NK7A 1ZZFA 3GG0A 2OPPB 4MYUA 4ZP7A 2YWGA 4PUOA 1JKHA 1D9DA 1JLAB 3MTJA 1OPZA 3OSPA 2MKSA 3OV7A 5KFSA 5ITHA 3PIPQ 5HAOA 2VJUA 4CH0S 1YLXA 3PYGA 4LVOP 3MD3A 3KMQA 1NSKL 1N0UA 4CM2A 2BOAA 2JVRA 2MZQA 2J8SA 3QT5A 2XWXA 5KFYA 3SMZA 1PGZA 1TL5A 4DR6J 1SH0A 5IZHA 1CULA 3GJSB 3R9LA 2JOQA 3MDFA 2GHWA 1N34F 1ZM9A 2GMJA 2ZUAA 1JJ2R 1VQOS 4ECRA 4DQIA 4DL0C 2I5JA 5B09A 4UZBA 2ZDOA 3QIPA 1VQPS 1HIYA 3HULA 4KGZB 4A8KA 3CJRA 4C0OC 4J9KA 3CC4S 3D6TB 1X5SA 4KH0B 1YK9A 2HS0A 3UD5A 4OI4A 2ZH2A 3H5YA 4ZCMA 1OIAA 2LFVA 5JXSA 3KLIA 3DKDA 4MJKA 2HHXA 4QWEA 2DR7A 2GQ2A 2E1MC 4O4RA 4NA3A 2YVSA 3S01A 1F2HA 1HBOB 2D7SA 2NZCA 4KY3A 5ADZA 2EC2A 5DGBA 3BSOA 2C2RA 4QPXA 2BE7D 4USTA 5B7WA 1M5OC 2FJAB 4HT7A 1RSCA 1LWCB 3PRVA 3KTQA 3Q83A 2JNJA 2AJFE 2ZWOA 5KFHA 3DOKA 1NB7A 1FE0A 2F5GA 3H5XA 3KG0A 4B3OA 1ZPWX 1X4AA 4ZPVR 4ZPWR 1NJYA 5JVGQ 5U47A 1OO0B 2DGSA 2IC3B 5GADU 3RYLA 1SUQA 4MKBA 2J9CA 1HI0P 1RLCL 2BW2A 2NREA 3TWZA 4CCHA 4J9UE 1ZM4A 3U1NA 1GX5A 3D1OA 1MU2A 3T9ZA 1HA1A 1HHSA 4A4JA 3S8SA 4Q8EA 2VFRA 4R8UA 2SXLA 4CZCA 3T9NA 1KLMA 2GFFA 4URQU 2MKHA 4QOTA 2FJBB 3MEKA 5F8LA 1TL3A 4X4RA 5D8HB 2NXJA 3M1VA 3IMQJ 1HQUA 4P75A 4X65J 4DV4F 3SDEA 1VLYA 1WEZA 4ES1A 2OPRB 2B6AA 3FBCA 1GNKA 3OTDA 4OYAA 4Q43A 3G6YA 1FF2A 4ECVA 1RB0A 3VAMA 3NNAA 1JB0C 1C0UA 2VBXA 3T1HF 2ZJRQ 4ELUA 4LFBF 2DNYA 4CWBA 1YX2A 4EO6A 4ETXA 2V2QA 1RU2A 4FXWA 2MZ1A 1U7LA 4WP8A 2OPQB 3KK3A 1URNA 1N32F 2HHTA 1PILA 2A3JA 2F1FA 2YWFA 2IRXA 4LVNP 4FN5A 3FMWA 1WF0A 4CLUA 2MQQA 3H4BA 4KHPJ 3DYAA 4ZCKA 4C97A 1SQFA 4HH0A 5HVHA 4C0HA 4DV5F 2AMCB 2HHWA 1XMQF 1MN9A 2ZJQQ 2IPOB 5AE2A 3M8WA 3OTCA 1U2FA 2DNPA 3GE9A 5H9EJ 1U25A 4ZP8A 5HO4A 4OHXA 3CJTA 2IFXA 4DN9A 4Q45A 1VRQC 4Y2AA 3KLGB 4B3MJ 1RU1A 9RUBA 3QJJA 1NDKA 1WORA 3P45B 3BQ2A 1S7IA 3TARA 4MIWA 1S77D 5KFUA 5MLCV 2MJNA 1PJ5A 1S0OA 5CYMB 2CQCA 3QT6A 2PI4A 4Q8FA 1KVKA 4X64J 5B0BA 2OPRA 4C98A 3J81Y 1KDNA 2OSQA 3SQOP 2HHVA 1FRHA 1PAEX 3OJUA 1GMWD 3BB5A 4LR7A 3ZTQA 4DFJA 1N33J 4ZVQB 1NKBA 3M6VA 2FVPA 4R8UB 4I56A 1UEVA 4OX8A 3EVMA 2W2QP 4RW7A 2MXYA 1REGX 3PRBA 4IDKB 3Q8PB 2VJVA 3H2VE 3U27A 4J9OA 2JLFA 4OV6A 3FC9A 2DNGA 2IC3A 3DMJA 2D9OA 2C3YA 4ZOSA 4ECYA 4PG6A 2L41A 1HR0F 1YDLA 3IR6B 1WUUA 4L76A 1VC6A 1X0PA 3CF5Q 1TK0A 1FKOA 2C28A 1NJZA 1GAOA 2JSXA 3UCUP 2Y1JA 3FQKA 5D3GA 3GCXP 1LKZA 1IBMF 4IFYB 3V4IB 4F0KA 1HHQA 1R7IA 3C46A 2L9DA 1FK9B 4RUCA 2RQMA 2QTWA 1FESA 2DRBA 1RACB 1EX8A 3ISNC 2GHPA 3LTOA 4USUA 1RWUA 3SV4A 3BYPA 2Y8WA 1UZDA 4UUXA 2HZCA 2R7XA 5GVQA 4WE1B 4F50A 2G9OA 3UDCA 1HQEA 2QE5A 2RHQB 3HM9A 3JTPA 4L6V3 5IV4A 1L3KA 1MROA 1Q7LB 4RZRA 3SZ2A 5L9XA 4RW6A 1WTBA 2YPZA 1WTFA 3FBEA 3I6PA 4TYBA 2BANB 2CQ1A 4QZVB 2RRBA 1BUXA 3EGVA 1FJ7A 2GVZB 2HNYA 4PWUA 3V2UC 1WWHA 1BE4A 3PXGa 4YY3J 5KFAA 4PG4A 2CNOB 4QWCA 2DXEA 4I2PA 5L8RC 4DSKA 1URRA 1NSPA 3BH7B 3KDOA 3OQ2A 4A8XA 5KFEA 5LSLA 2VB6A 4NLXA 5D4NA 5L38A 2OAUA 2KJWA 2CYYA 3IBFB 4PYDA 3TQEA 4CTAB 5KOWA 2J9DE 3DCAA 2PEBA 3HSDA 4ZJLA 3MUVP 1Q8LA 3I0SA 2JC1A 3CPWR 1FJGJ 2BQ3A 3H59A 2LCWA 1BQXA 3NS6A 3U02A 2HVIA 1S9EA 2XMMA 2IVFB 2BANA 1JK9B 4KGKA 3MGJA 1DZ5A 3DC2A 1UP1A 2BA9A 3CB4A 3C16B 4KKOA 1YJWS 2YX4A 1MROB 4KE5A 1QAXA 1IBKJ 2OPPA 4OHYA 2RS8A 3P4UB 3SQGA 1U1PA 1H2TZ 5HQ8A 3L7UA 1FDBA 1JLBB 4H4KA 4KKOB 4N77A 5F8IA 4Z7YA 3OSNA 4B9MA 4LFCJ 3W1YC 2PO4A 3TJ8A 3VGSA 2BKOA 3W5ZA 1IBKF 3VWSA 1U1MA 3BKUA 3FQLA 4IRKA 2R7UA 4OZ2A 1R0AB 1LWFA 4YHHJ 2ZBRA 2HAFA 2C2MB 1OWXA 3N5FA 4F4WA 1DY3A 2DGUA 4OV1A 3DDKA 4IFYA 5D4LA 1FNOA 3DRPA 1PBAA 3KXDA 3N79A 2E5HA 1LOUA 2VG7B 2W4DA 2ZWPA 3V81A 2R3VA 2LA6A 1TUVA 3MAHA 4HKQA 2VASA 2BQRA 3CJKB 4F4ZA 3Q8YA 2DGTA 1UL3A 3CCWA 3MMAB 2L3MA 4UTGA 1KKHA 4ICLA 3ZZRA 2F3JA 5GAHI 2C2ZB 2CNNB 1QSSA 2JC0A 1ZAXA 3CNQP 1T9WA 4FP9A 4LBHA 4DU8A 3IWNC 4I67A 1RP5A 1NCLA 2YQ3A 3DLGB 4KAIA 5DO2A 4ZVSB 4I6AA 5DDPC 2UUBJ 2DB1A 3EZUA 3LWLA 1U45A 1CC8A 4IG0A 4QIWD 2VOOA 3MOZA 4RNNA 4CO4A 4WE1A 3LWMA 3WC2A 1IKVB 3C66A 2XS7A 1XBWA 2FC9A 2UUCF 1ZZNA 3DRYA 4L72B 3CCJS 1H7WA 3S6EA 3W65A 3RAXA 2FJEB 4WZQA 3UPFA 3CCSS 1V6HA 4CNZA 1VK8A 3HHLD 2FZGB 4F26A 3WX4A 4ZA1A 3GTYX 1NUEA 3HT0A 5HQLA 2C2NA 2ZC3A 1IKWA 1JXEA 1N5QA 4WF9Q 5J2MA 2K3KA 1HI1A 1OQ3A 1GTHA 1CPZA 1VQ9S 1N36F 1TU0B 3M8PB 5H9FJ 4K4VA 2LKZA 1L3VA 1U8SA 2H4YB 1RISA 1T9XA 2UU9F 3CDUA 2OI2A 1FTCA 1LNQA 4WU2A 3UD3P 4USKA 4BCAA 3SSRA 3PJ9A 1ZPVA 4LF8J 4QIEA 3CCTA 3NNHA 4C7QA 2DNKA 3AOBA 3JSMB 4IRDA 1NDCA 3GSDA 1IXKA 1MW7A 4PWDB 1W25A 3NY0A 3U1MA 1KHWA 5K8MA 4OYOA 3KLHA 2PFDA 2I2YA 2LU1A 3OL6A 3QRQA 3CGIA 3CIZA 3TYTA 4JV5J 2MKCA 2Y1IA 1H38A 3BN7A 3CD0A 3DLEB 1QUPA 4F0HA 1WDDA 4QIVA 3AB2B 5CYJA 5DG8A 1C1CA 2KFZA 4RU9A 1ULRA 3HHKA 1PJ6A 3L3CA 4A8SA 1CSJA 2B43A 2I9SA 2J7UA 3MM8B 3KG1A 2XLKA 4MK7A 5JJBA 3R3TA 4OL8A 2LQBA 3EVWA 3LF0A 1XC9A 4ELVA 4FS2A 3PW7A 5FJ4A 3D54A 3E3XA 4AT1B 4RBUA 1ITPA 1FNXH 1CG2A 2DEIA 1JQGA 2MSSA 2OPQA 2NUUG 2XYGB 3BBBA 3QLHA 3VQSA 3M9OB 4ZLLA 1TFWA 1Q8BA 2FB0A 3A1YG 4UOGA 4EYHB 3EXYA 2YBVA 5KOXA 3GR1A 4B9SA 3A4TA 1BGXT 2IDLA 2DNNA 2AWZA 2ZBCA 1HBOA 2DGVA 2VC0A 3BGFA 3I0RA 3FUYA 3L7PA 5E41A 1EKSA 1PIEA 1N36J 2D1CA 3SDEB 3CDAA 2FHKA 2J76E 5IC4B 1KP6A 3JAMY 1RTZA 2JFKA 3L09A 4BWJA 4DHVA 3ADAC 4DLEA 3D7SB 1VQKS 2KVIA 2U1AA 3UI3A 3QWPA 1HNXF 1MU2B 1AYEA 2D74B 4FNHA 4O3PA 1HNZJ 2I38A 1YWXA 2NLWA 2FJDB 3DOLA 3MOJB 2WCXA 3TI0A 5HLFB 3BGLA 4X65F 4DV4J 2EFPA 5GAGU 1R31A 2EK6A 5HP1A 1SQGA 4CO3A 4OZ3A 5HBMB 1CULB 4K4XA 2R8JA 3OXLA 4ZPBA 2FD2A 1TELA 2KXHA 2P6TA 1GFWB 3SCIE 2XZTB 1H2UX 3KKFA 3W60A 3CWJA 4DUYJ 4DZDA 3UR0A 3V6DB 2F8HA 2Z2MA 3DU5A 3QT8A 3M2UA 3R1LA 4HTJA 3BQ0A 1VRUB 1Y5IB 2CQ3A 3AD9C 3FRYA 1UJ6A 1ZETA 2EEYA 2E1AA 1S7HA 2L9WA 1M1HA 2V8PA 3VF0B 4DQSA 4ED7A 3AQPA 3BV8A 2WK4A 3BJYA 2R8HA 2VQFJ 2F4FA 2YWWA 5DG9A 4OHZA 4K59A 4N47A 3Q8QB 4U7CA 2K3IA 2MZRA 3DOMA 1SB6A 3GU0A 3E2EA 4DZ6A 2D3OR 1NKCA 3PEHA 1K9MT 2W24A 2OP5A 5DDQC 1W26A 3KNGA 3UDLA 2BE9B 4O4GA 3N6LA 2QA4G 1Q86T 1JLGB 1NXIA 1U2RA 2CVIA 2XBPA 2HBYB 1SPBP 2WBMA 4GC7A 5IM0B 1T03B 1ZA1B 4JI6J 4DR7J 2F7VA 3I56S 4PWWA 2GC8A 4DX7A 3NWRA 4UZCA 4DV2F 5L39A 3GWCA 5A8WA 6FDRA 4Q2LA 1NH7A 1TL7B 5IQ6A 2DNOA 2HVZA 2B9WA 3K17A 3I32A 2E9RX 1S79A 2IAJB 1IN0A 1S1VA 1HWIA 2FPHX 3BREA 3A8EA 2XNRA 1GX6A 3TZWA 3K57A 1JKHB 3OHBA 5JUMA 2AU0A 2IM1A 4HACB 1AA1B 1N32J 3B4MA 2UU9J 2P5VA 2J8AA 1GTEA 2CPJA 3CCUS 1HYSA 2KU7A 4A8FA 4AL5A 1QUVA 3KFWX 2QZ8A 3MPVA 4AUKA 3D2WA 1JXVA 1UA0A 2FZCB 2ZC4A 3BDPA 2YXLA 1U6FA 2AP6A 3TZZA 1TKXB 2ASLA 2CQHA 5CQGA 5J2NB 2PN6A 3KJQB 3CCQS 1VBXA 2W9BA 5CH7B 1FWKA 3I5CA 2AQ4A 2ZD1A 1RAOA 1YRTA 4LSNB 5CA5A 1NK0A 2HVDA 3M8RA 2UUBF 2AT1B 2UZAA 3M8QB 1SV5B 2EW9A 4RW9A 3PYDA 4RUHA 2E5IA 6FD1A 4MYTA 1TMMA 4E98A 4O3RA 3MEDA 4N8OA 2GHVC 2AEFA 3F73A 5K20B 1Q7YT 2ALYB 3TRGA 2VFUA 1EJ7L 2UUAF 2CPEA 3N28A 1S57A 1QTMA 3MMBA 4CIOA 4ZLPA 4JI0J 5DQIA 1SJ1A 2GGPA 2CQDA 2LQ5A 3OR1A 4J9SA 1YGYA 4IG3A 4LSLA 2RKIB 2V4QA 4CRJA 4XIUA 3EZ5A 4LF4F 4FF3A 2CG8A 3ZZZA 3CMES 3E51A 3I5AA 4ELTA 5DRKA 4PXEA 1XN9A 2HNZA 2RILA 2DHGA 3BPDA 1YJ9S 2VONA 2PA3A 4K4ZA 1WC6A 2EVZA 2E44A 1HBNA 3MCOA 3LPEA 5ETLA 5C2CA 5LJ3Y 3LP1B 1JJCB 1MNEA 2VG5A 1YBTA 5KTQA 2VICA 1U1OA 2ZBIA 2HFUA 2V63A 1RXOB 2CRLA 2HGLA 4P2FA 3MM6A 2VDIA 5J2PB 5L1KA 4M63A 3BBFA 1JLFB 5DM7Q 5KFWA 2OTJS 4C11B 1IKXA 1RT3B 4N5SA 3GP9A 1U6BA 2CQBA 3N4WA 3W63A 3GFXA 2R7WA 4EI2A 3DRRA 2V4JA 4HLBA 4NE9C 3KJVA 4B3SF 2R7VA 1BY9A 3FFIA 3MEEB 2E9ZA 2HRYA 1RWWB 1WC4A 2OEKA 4OYZA 4F04B 2VD3A 1IBLF 2AJ4A 2DHXA 3NGDA 4IFVA 3OR2B 1RT2A 5T41A 2GJ2A 4RWWA 3GCWP 3UVJB 1WC3A 1G6BA 3I9ZA 4UW2A 4LMZA 3DHXA 1ZS6A 4Y0FA 3V6KA 1XNRF 4WWSA 5KFRA 3N6MA 4AXIA 1YIJS 1KFDA 3CO0P 1V3ZA 3OFHA 4IKAA 1UKUA 1Q5VA 2KVQE 2MYFA 3HF5A 4OFZA 4TYAA 1ZBTA 2APOA 2CPIA 2HIYA 2C22A 2OGUA 2HEKA 3GIJA 1UVNA 1RAEB 3KDNA 4M5GA 1T8EA 3OD2A 3N6NA 4LF6J 1YJ7A 1G1XA 1UWAA 2V6AA 5A8KB 1CEZA 3LH2S 3VAJA 1D1UA 4DWIA 4BLGA 1N6QB 1NH8A 4EYIB 3BSCA 1S1XA 4ECTA 4O3SA 5KFNA 3IG1B 1DARA 3W62A 4YR3A 1PYSB 3FK4A 3Q8SB 4C8MA 4CM0A 3VVUA 2QMWA 1HI8A 3DN9A 3GFYA 3JS9A 4MIAA 3W64A 4CT9A 2CAJA 3B54A 3OL9A 5F0UA 2B7BB 3WC0A 4DI6A 1SIZA 2DH8A 3ILJA 5AXLA 1S4EA 3OTOJ 1E6YA 1RHQB 5LSOA 1C0TB 4FBUA 4C3LA 3IM9A 2XULA 2X3DA 1C0TA 1RE1B 4M5NA 3V4MA 4MH8A 3C6UA 2VPWB 3SFUA 1TV6A 5HROA 4A8OA 4LRBA 5GAHU 1VLOA 1RLDA 4B3SJ 4J9VA 4JYAJ 3QO9A 3VAGA 1J5OA 2ZH4A 1XR6A 1UETA 3TX8A 3KJVB 1AROP 1TK8A 1S1XB 1YBUA 4QR1A 3TUZC 1A9NB 1S6QA 2B4OA 2Y0BB 4KHMA 4L74A 4PAAA 4NXNF 2C2OB 3FEXB 4S0MA 2M8DB 1VQ5S 2V9KA 3IM8A 1IKXB 1RQ0A 1JLFA 3SSQA 5F8GA 5M2UA 3IAS9 1TP7A 5C5JA 3PRDA 4NLQA 5DGAA 2H1YA 2GVDB 2KG0A 1VQLS 1FA0A 2CPDA 2VG6A 3I31A 3LPYA 2JLEA 1S1TB 3GG1A 1SQEA 2CNKB 8AT1B 3H40A 2E1RA 2NYHA 2VBYA 3HHLA 4NLOA 3NBPB 4BHQA 2QLWA 3IA0A 4DPYA 1J5EJ 3ZFVA 1SVDA 1KTVA 1LWEB 2BJ7A 2LDIA 1WG1A 4O3OA 4RW4B 4Q7AA 1VQ6S 3DXSX 3K0JA 3BO2A 4ID5A 1X60A 1W7WA 5DG7A 3MPYA 2R8GA 1Q4RA 2D41A 3MEGB 2HHHJ 3SCJE 5ETRA 2DT9A 4H54A 4CYUA 1QSLA 3KYLA 2R2SA 3HLUA 4V1Ak 1HPZA 4LFAF 2UVRA 3MEDB 3AJ2A 3PYFA 2O66A 5DQHA 1T9TA 3UN5A 2W9AA 3NWGA 2B7CB 2JLGA 2Y9HA 3AOCA 1DAXA 4DN0A 4ANEA 3C3LA 2ZD1B 2NXNA 3D68A 2CFXA 2EG2A 1FKPA 3I5BA 3K7RA 3VAKA 1TKXA 4JI3J 4KTQA 2HURA 2WRMA 3EJMA 3NGKA 2ASDA 1M5PC 4LF5J 4PQUA 2HRUA 4B9TA 3I96A 4Z37A 4O23A 5DDRC 2M52A 3G6VA 1SIWB 1M90T 1HYSB 3MFHA 1U49A 4DX6A 2W4CA 1DTQA 3D1HA 4L3KA 1DJ0A 3LP0B 5FLXY 1U09A 3RZAA 2P6SA 2K1RB 1WEXA 3D1QA 4WFXA 4NCAA 2XLIA 4ED5A 5L1LA 3J81U 3CC7S 4B9LA 3CDBA 1G4CA 1WELA 1FRKA 2R7QA 1N4LA 4GKKF 2IAJA 1PG5B 4DSLA 4FPIA 2XCPA 1B0TA 1TR0A 2ZH3A 1UZHA 5BR8F 3CD5A 3OFGA 1GQEA 1IBMJ 4KH1B 3IN5A 3AQOA 1NK5A 4IO9Q 2RB7A 4FVCA 1ZM3A 1L3UA 3OTEA 1QAYA 1X4EA 1WSVA 4LSZB 1NM2A 4UQGA 1KOOA 2GNKA 5KG3A 1L3TA 1T03A 2HFVA 3A8IA 4P71A 2HWHA 4UUWA 5HQMA 1B7YB 1JLGA 3M30A 3PNIA 4NYPA 1KWMA 3K5NA 4M5MA 4OI6A 3QFHA 5EUHA 3T6BA 4K0KJ 3GFZA 4DR3F 4NI2B 3CT9A 3EICA 3M2VA 4Q44A 4IR1A 1FDAA 2VQFF 4NLTA 3DOMB 4USHA 4DSEA 1ZTTA 3O44A 2ZKUA 4RU2A 5FDLB 1CJUB 3IGNA 1Q95G 3AJ1A 3VTIA 3ZNJ1 3QZ7A 3G8TA 3R97A 2RMLA 1N5TA 5L1JA 2BVZA 1NK9A 2QV6A 3RRGA 1B0VA 3CTRA 4RX6A 3OLAA 5LSRA 1CJVA 4K8RA 5E3QA 3PKMA 4YMEA 4PABA 4Z7CA 3V6DA 2K8GA 3HHDA 1HKAA 3L4BC 2X3GA 4HDGA 2ZZNA 4O3NA 1PSDA 1U4BA 3NOGA 2R9LA 5HLFA 1IWAA 3N01A 1M5VC 1IVZA 3G96A 1YZ7A 2CPYA 2NSBA 2W2OP 1I3OB 1RAJA 3PFEA 4Q2MA 3W8PA 5SZTA 2PT0A 1B3TA 3BM7A 2DJWA 4L3NA 5C24A 1LW2B 2GX8A 4P6QA 2E1CA 2CQ0A 1E6VB 4ZHRB 2YWKA 2D3UA 4CO1A 2DY9A 3WIVA 1M5KC 4EZ9A 2AV5A 1BQMB 2DISA 4OX7A 5FIIA 2LVWA 3K8VA 4NLWA 4MKYA 3I82A 2BDPA 3TW0A 2ALZA 1XMBA 2LXIA 3KNAA 2MKYA 2H4WB 5KFVA 4Y34A 1P6TA 4P52A 1VRUA 1RZMA 4GC6A 4LF1A 3NGUA 2WONA 1T9YA 5F3ZA 2D3ZA 1RJJA 3FVYA 4M5DA 4DS5A 3QLHB 2FY1A 3O1LA 5J1EA 1P8GA 1DFDA 2DNLA 1OS5A 4OYXA 4QW8A 2E5GA 4KO0B 4NYOA 3A8JA 3EGNA 1FXDA 3D4JA 4FYYB 2B9YA 1P1LA 2BM0A 3MMJA 2W01A 4Y2KA 3W2WB 1IR2A 2CXEA 2MMYA 3ITHB 2E66A 3MM8A 3K5MA 1D0EA 2XQCA 1JLCA 2XSJA 2XI3A 5DQGA 3J80Y 3TJ9A 1JWWA 3FCWA 5LMNJ 2FYXA 2M88A 3EUNA 5M2RA 1SKRA 1U0SA 2HFZA 1RAAB 3DLEA 3ETMA 2UXBF 3R6GB 1S1UA 1Q79A 3CW2C 3MECB 1BC6A 4XO0A 3C6TA 2H51B 3RAMA 1NPRA 2Z57B 1AB8A 2HAIA 2L9NA 3QSIA 3VGVA 4CLFA 1PYOB 2DPJA 1U1RA 3TR5A 2DHHA 3I0RB 1GMVA 2BM1A 2WOMB 3HSZA 2UXCF 3SI8A 1S0MA 2ROGA 2XMJA 4L75A 4ETZA 3KK1A 4YFUA 2HFNA 3MCMA 2IYGA 3PR5B 3DRSA 3H25A 2PC6A 4ECSA 3DM2B 1R0CB 4MFBB 2HLTA 5ETNA 2NS1B 4DV0J 3EGWB 1X9MA 2LA4A 1ROFA 3FZ2A 4LQ9A 3L9ZA 5E3RA 4ZLNA 2ASYA 3PVXA 2M70A 1PC5A 1XNRJ 2J9EA 2DBBA 5J2MB 5KFQA 5THWA 5CAAA 1IKWB 2IVYA 2YWHA 3IAM9 3T19A 4ZK7M 3UDVA 3GLJA 2KM8B 4NLRA 2QL9B 2JEIA 2KT2A 2E7WA 3VVTA 2BE2A 4GVBB 4HI2A 2K7KA 4Q0BB 2DO0A 1YJTA 3D3BJ 1QM9A 3NAIA 3E01B 2RUGA 4DV1F 3MWBA 3T6JA 4RUAA 3NCRA 1F60B 2VKRA 3TJAA 1U02A 2H3EB 4YOEA 1IKVA 4NZ7A 2JEFA 2R7OA 1NBEB 1QTNB 4KV8A 1SL1A 2BJDA 4DV7F 1F0XA 4NMXA 1HARA 2OUGA 3W2VA 3DRXA 3UE2A 4I0WA 5IT9U 2YX7A 4ECWA 1RKIA 2LLZA 4DR3J 3ENAA 5LMUF 2HQ3A 3TAMB 1HW9A 4FBTA 1C4CA 2W9CB 2DNHA 4OIXA 1DLOB 2CJAA 2W1BA 3MM7B 1JLQA 4TXSA 4V19J 3ILLA 3MMAA 2P8IA 2YQ0A 4TN2A 3H4DA 2BMBA 1Y10A 4X64F 3HJFA 1N52B 1WC1A 4X4SA 4OJGA 2BJ9A 1F5AA 4I2QB 3KHHA 2DD8S 2MZSA 2QLXA 2KXFA 3C8YA 3ZZYA 4UOFA 5KAKA 5HMWA 2B4VA 1KN6A 2ZITA 1JXLA 5HK4A 4PCQA 1WOOA 3PY8A 1NU4A 4H4MB 4DPOA 3OTBA 1P1TA 2XWYA 3OJSA 5DM6Q 1XNQF 4M5HA 2YKNA 3T5KA 1RHJB 1N88A 3DXBA 4I69A 4OI1A 2NZ4A 1VIOA 1TKZA 3SQGB 3LP2B 3BBCA 4RBVA 2RQCA 4ER8A 1XEZA 3HZEA 4ZMMA 2J6SA 1HHTP 5HSPA 2CPXA 2RRAA 5FD1A 1BQNB 1XMQJ 1GMUA 2QGFB 4ICLB 3TUJC 2Y1LB 2DXDA 2FTRA 4RNFA 2JRSA 3C14A 4NEZA 1NZ8A 4ILRA 1RHKB 3DLKB 4P9SA 4DG1B 3JTOA 2VPYB 4HVZA 2M0GB 2V68A 4ZVFA 5B0EA 2DGQA 4F7VA 2HVEA 2VODA 3NAHA 2HK3A 1EETB 3L95X 4JI2J 1XK8A 1PAUB 2F8EX 2OFGX 4CO0A 2MQOA 2VKZG 3X3UA 3BGRB 3UQSA 4CH7A 1BD6A 2VFSA 2VHGA 1K44A 2P9GA 2FC8A 1LWFB 4P2SA 3CUNA 4NCBA 2HLUA 4KIAA 1DTTA 1S48A 1RTHA 2VQEF 1RAIB 2RS2A 1CBKA 2YNGB 1D8YA 1RCXB 3PJXA 2A1BA 2DGOA 3JXOA 3JB9k 1LFPA 1AT1B 3O5TB 3AH6A 4ITSA 5LXRA 4NASA 2DCUB 4QWDA 2YTCA 2IVMA 2DNZA 3FEZA 4CLPA 1R0BG 2ZNZA 3OPKA 3EPIA 2AD9A 4LRAA 1MG7A 2OKQA 5CD4A 4KC5A 5DZ7A 3CDWA 1K8AT 2AHOB 1DTTB 3DFEA 1LW0B 3MI7X 2XMKA 3BKFA 4F2SA 2XO7A 2GAHC 2XGPA 2V9WA 1VBYA 4QU7A 5KT7A 4CH1A 1WEYA 2RF2A 3T1YJ 3FKBA 4NL5A 4CTAA 2M9KA 4DU7A 1NDPA 4D3GA 5AJ3J 4DR4J 5B0GA 3HKZD 4DPUA 1HR0J 8ATCB 3NCPA 4I6YA 2KHCA 2MZTA 4KHRA 5KFKA 1HNWF 2Z2LA 5F41A 1X4FA 2HFSA 2C3UA 4WTOB 1KSPA 4USWA 1TMJA 2G2OA 5LM7E 3C14B 2MLYA 1FDDA 1AZSB 1D8ZA 1R89A 4DUZF 1WF1A 4IDKA 2XNQA 3RR8A 1B99A 4RW7B 1DLOA 5AXNA 4Y2CA 4OJ3A 3J7YU 3GQCA 4W92B 1LK7A 2IIHA 1SC6A 2ZBQA 2D9PA 4GO7X 4PG5A 4JI2F 2ZZMA 2QA4S 3W2VB 1YVFA 4N7TA 3AJDA 5BYQA 1U0HA 3Q22A 1VC5A 3K8WA 2PD1A 4C8OA 4DV5J 4U9RA 4LFAJ 3BO4A 2AJQA 3CJSA 5ETMA 2F63A 1RHRB 4K4WA 3PW5A 2GCFA 5EGYA 4GVBA 3C15A 1WNEA 3L7OA 3V4IA 4Q0BA 2NXEA 1UJ4A 4GO5X 4OX9J 2A0FB 3I87A 3PEJA 2WSFC 4NYZA 4QIGA 1KRPA 4YY3F 1KNZA 3MR5A 1RT7A 4DV2J 4OJHA 2BOPA 5AXKA 2OD4A 1RT5B 2YKQA 4ZP9A 7FDRA 4X4TA 2R8IA 3DMJB 1WDTA 1Z1ZA 3ZTOA 1HQ2A 5E2QA 3SFGA 1JNRB 3MM7A 4M5KA 3MR6A 2J6UA 2FLLA 1SKUB 2N4DA 2QRRA 3M32A 3G2XA 2MQNA 3DI6B 4NA2A 4TU9A 3KK1B 1KQSR 2E7XA 2GS8A 2Z56B 5AJ3F 2RDJA 2Q3PA 1RYSA 2X1FA 4LIWA 2B9EA 1C0UB 2ZH5A 2QC3A 2E29A 3GYXB 4F3QA 4G1IA 4K5SA 4NZ0A 3W9IA 4DL2A 3D0GE 2HQIA 4F3MA 3UR3C 5HMXA 1WHYA 5KFMA 2AW0A 4BC7A 3E01A 3C6TB 5DETA 1SJ3P 1LXNA 3B4DA 1HMVB 3VV2B 5C7PA 2ZH6A 4DR4F 2OFHX 3KLGA 1VFJA 5KG5A 3MURP 1SL2A 1TQLA 2Q1LA 3ILOA 3ETOA 4N76A 1RT1A 3MTKA 4JI5J 4YDDB 1WI8A 1VQSA 3CEDA 2WSEC 4YHHF 2XSJB 3LA0A 1FFSB 5J1NA 4LBPA 3H5SA 2JEJA 4Y2IA 1QVFR 5E33A 4MMOA 4IR9A 4CNYA 3UWTA 1FRJA 2JL9A 3LGNA 2XYPB 4KFBB 3MUMP 1PO6A 3BSNA 3W5XA 1YRXA 3RBZA 2G1DA 3Q23A 5A6WA 3HFZB 2HBZB 2HQDA 3Q86A 4IH5A 4M5DB 3G86A 3WZ0A 1VJWA 4JI0F 3C15B 2OEMA 4RUBA 4OX9F 4BWMA 2ZJPQ 2DRAA 2OD6A 2KB2A 2QL7B 4IUFA 3NS7B 3G4SS 5KT4A 4M5LA 2FVCA 2V2KA 3FNNA 3HVWA 2B6AB 4RNHA 1N54B 3CIMA 4P7TA 1SL0A 5JMNA 3I4HX 3M1VB 4JI8F 1H2VZ 3FZBA 2G2ZA 1S1UB 2MZJA 4HHJA 1H7XA 1R8HA 3R2DJ 1TL4A 4GKJF 1EB0A 2VBZA 4DL7A 3CJ2A 4DV3J 4C8ZA 2QA1A 1YI2S 3FSYA 1UWBA 2UXCJ 3DGPB 4NLDA 3QIPB 2N4CA 4CLKA 4E2FB 3MF5A 5IC6B 1VK3A 1XNQJ 4HHUA 2LEPA 4DV3F 2DNRA 2OELA 4TY9A 5KFJA 4J9PA 3RG6A 2CZVC 3K58A 4KO0A 1APSA 2KYZA 4QPTA 2P9CA 1G7CB 2HRTA 5ETPA 4HHHA 5BYSA 3G6XA 4W98A 1LWCA 1IBCB 2WVFA 5ETQA 4YB7A 3Q8RB 2F40A 5F9LA 4DV6F 4MIBA 1CJVB 5CYQB 4EO8A 5K8OA 5L9NA 2BZ2A 3WQPA 5KT6A 2V8DA 4OYPA 1F9FA 3LOUA 4ED8A 4G6VB 5KFIA 2L08A 4ECZA 3Q24A 1VQ8S 4ZLJA 4LT6A 2VFVA 4LREA 3MM5B 2JWNA 2E5LJ 2RSQA 1Q5YA 4JV2A 4RBTA 3NCQA 5D0HA 5FDLA 5CCMA 3TANA 4QYZJ 4M94A 2IM2A 2IMWP 3RB4A 3JQMA 4K0KF 2DGWA 1FDNA 5F9NA 3M2VB 2BX6A 3Q2TC 1LW2A 1VHIA 3BGUA 5GAGI 2BJ3A 4PG7A 4K4TA 3TNVA 2HS3A 4OI2A 2CDRB 2N7YA 3BH6B 2RD5C 2M3DA 3PFOA 5CHCB 2YNFA 3CD6S 3M30B 2HQCA 4XTTA 4EBEA 2Z8QA 2G0JA 1WG4A 2DRDA 3KWMA 1KFSA 3RGIA 1EETA 2MJUA 1NPPA 4NLYA 3G82A 4FNIA 5B0DA 4FDFA 3PW4A 2Z58B 4C3KA 2GJFA 4NCGB 2DXFA 1IM4A 3GYGA 2QLJB 4JI7F 1RWPB 2CQ4A 3U7JA 4GRSA 1H6KX 3AHPA 5IS2A 1JLAA 3DDIA 1PBUA 2VV5A 1BQNA 3HDSA 3LANA 4I68A 1A6LA 4TLQA 5E3CA 3P5BP 4HI1A 5IOLA 5LL6d 2Q66A 4PUOB 2KT3A 7FD1A 2ZDPA 5HVGA 2YKOA 3MCSA 3LP0A 5E7OB 4QR0A 1ZA2B 4DCJB 1NZAA 4IQXA 2N7CA 1VQ7S 3QPIA 4X66J 1R8PA 2DH7A 2B3TB 2VPXB 3NGRA 2HVHA 2A18A 1RTJA 3D67A 1T3OA 4O3QA 2Q6BA 3TAQA 1VS3A 1X5OA 1HW8A 2OIHA 4XDCA 2XM3A 1FKPB 2NUHA 2OLWA 4EK2A 5KFOA 2V0NA 3ONQA 2ZOMA 3AD7C 3KJNB 3KUGA 4OZJA 4ZVOB 4Y65A 5A8RA 5C25B 5J2QB 4WK1A 5B0CA 3J7Z5 2H48B 2AEJA 1NK8A 2J0QD 4H4OB 1REVB 4I2QA 4PKDB 2Q43A 4LFBJ 5CZXA 1BHNA 3KLFB 1U26A 2RUSA 5KG0A 3LGHA 1VOMA 4USJC 1KQGB 3HO1A 3QGIA 3OXGA 3VCDA 2RE1A 3JYTB 2HHHF 2HK2A 5C2GA 2ADCA 2XTJP 2GO8A 4C0BA 1UFWA 1OQ6A 2B4PA 4RR5A 4CO5A 4DX8H 2DR8A 3RBDA 2QEXS 1KVIA 1FD8A 3OL8A 2FVQA 2DIUA 3D6MB 2AGPA 1Q81T 4FYDA 2BJ8A 2FQQB 3T5HA 1TL1B 3UD4P 4NRUA 1I94J 4BBYA 3DNCA 3OFFA 1T05B 2C2DA 1DQ9A 3ENWA 4J9QA 4WFAQ 2MY7A 2CPHA 3IS9A 3PHEA 1EARA 3F56A 3NBPA 5CXTA 2POKA 1Y9OA 3LALA 4IYQA 3PR4A 2UP1A 2OPSA 2KDOA 4ED0A 3IGVA 1D9AA 2X1BA 2BE2B 3MZIA 4BDPA 4DFMA 2QLFB 1X7VA 3E8OA 3RRKA 5L1IA 1FI4A 2R2TA 4LF4J 3A12A 2PMZD 2JFDA 1RABB 5EWEA 4O44A 4X62J 1RTDB 4B9NA 1OSDA 1OMSA 2ILYA 4F4KA 1X5PA 5HJYA 1Y11A 2EFNA 4ZVRB 4ANDA 2XC9A 2DHAA 3HHEA 4IH7A 1O0PA 3UNGC 4J9LA 3OW2R 2XMUA 2O3DA 1VMBA 3IRXA 3HVRA 4LF8F 3EXCX 1HWJA 1CJKB 1SH3A 2C42A 2YPYA 3MEGA 4MK9A 4EGLA 2XGQA 3PKYA 1HNIB 1MLAA 4N8NA 3TO8A 4JUZA 1FERA 1R43A 4B9UA 4Y3CA 1K0TA 1E6YB 2HGMA 2V34A 1K1SA 3D0IE 1RAGB 1RTIA 4CLYA 4RW4A 3MXHP 3R5AA 1RT6B 2KH9A 1KLNA 1VI7A 3D9BA 4TQRA 3NNCA 2R7TA 2VPZB 4AFFA 2CA9A 4FF1A 4OMFG 3IFEA 5LJ5Y 4CLTA 4ERDA 4P2MA 2R4FA 2ROEA 3T1AA 4DX5A 1HFEL 1VDHA 3R1HA 2GA7A 5K5MA 5A8KA 2H5JB 3TEHB 3DLBA 2MQLA 3HPOA 2BABA 3NMAA 2UUWA 2WB4A 3JSYA 3K2YA 2QYCA 2XMAA 3TUPA 2KT5A 5E0OA 4U7UD 4U8YA 4BS2A 4LF9J 2EFOA 3QO9B 3UCGA 5K8PA 5G4DA 3NEKA 2AGQA 1TV6B 5HROB 4DFPA 5KT2A 4B3TJ 2CUYA 3M6UA 3R5CA 1XR5A 5I4MA 1LEOA 1UCNA 1HNIA 1S6PA 4ZVPB 2HBRB 5GMDA 4ECUA 5A2QU 3QGPA 3HD2A 3NG8A 1W2BR 1FO1A 4OYIA 1YTYA 3LO3A 2OHDA 2V67A 2LU2A 3GV8B 3A3NB 5F8JA 4LJMA 1Y4ZB 4E0DA 3IWXA 3MPDA 1MWYA 5A76A 2WW4A 2MKKA 2O01C 2V4RA 4OI3A 2IA6A 2CG4A 1CS4A 2FHMA 1OY9A 4J5OA 3KLEA 2OEJA 2JZ5A 2M5YA 1R6VA 2E7VA 3GB0A 4K2XA 4IOBA 4ES3A 4EWTA 5EWGA 4PZVA 1UVLA 1ZAVA 2GIQA 2HMIB 1RA6A 2DY1A 2GIRA 2PIIA 3A3OB 1FRIA 4NZ6A 4I7FA 2XSFA 4ZIVA 2AF6A 4LF7J 2OH2A 2OPSB 4WKRA 2MY8A 3EE3A 1CVJA 2AEMA 4LFCF 2WW8A 3MD1A 5EWFA 1S99A 2FHOB 2QLBB 1KBRA 1FRXA 1JJHA 3MR3A 3KHLA 1HNZF 4K4SA 4QWAA 4KHPF 2LQ8A 2WHOA 5LXYA 1HBMA 4MTPA 2RNEA 5T7LA 1XMOJ 2ZUGA 4EEYA 3J7A1 2EFQA 5D0GA 3OR1B 1KONA 1T9UA 4H4KC 4HYKA 1NSAA 2KN4A 4IFVB 4P10A 3PX0A 3EVOA 3CCLS 2ZVIA 5DLFA 4LF7F 1FFGB 3R7BB 4X4PA 4ED2A 4NPOA 1LV5A 2NCKL 4WCEQ 1S0NA 1HL6A 4CDIA 2R8KA 2BACA 5M2PA 2V4JB 3EDRB 1CJUA 4JI1J 5HMYA 1Y00A 3R2CJ 4FZVA 2EFVA 1UEUA 5KFXA 4DFKA 1IR0A 1FT8A 2W8KA 5E5NA 1RYRA 4C11A 4M95A 2XB2D 2FLPA 2HWIA 1WOPA 5LMNF 2GV1A 4NLVA 1K73T 3Q2SC 1N5YB 4JI6F 4DR7F 2G2YA 5GADI 2VG5B 3SCKE 2X1AA 4DR1J 4ED1A 2J0XA 1VBZA 1N5YA 2IRYA 4WYWA 2G13A 3QRRA 3ET6A 2WZ1A 1T7PA 2VA3A 4IG3B 4RLEA 1IUJA 1S9GA 3OLBA 2EFGA 5E3PA 3T1YF 1N33F 5K14A 2Z0GA 4A8WA 3GSIA 2BYCA 2CZ9A 2MEWA 2A6MA 3CJ3A 5H9EK 3B78A 4ED4A 3US5A 1F1BB 2HHSA 3UW1A 3UDEA 3PHTA 1FRLA 1S9GB 4F25A 1TVRA 4HDHA 2J5AA 4DPTA 3RW6A 3FDSA 4U8VA 1O51A 1HBMB 1P9QC 1UVMA 3ET6B 1O8BA 4DUYF 5D78A 2X7IA 3ZNUA 2ZH1A 4JV5F 3THVA 4CQ1A 4PQUB 4QIFA 2B51A 2UXDJ 5IQQA 1PJ7A 4O4GB 3WIUA 3GJTB 2CADA 4F8RA 2B4UA 1MSWD 2MQMA 4YB6A 4EU0A 4AQYF 1S5ZA 3FSIA 2UV8A 3AODA 2EKNA 4C2MA 3R5BA 2AYGA 2CQ2A 4CP5A 1F5CA 3GZ7A 3H2LA 2V8HA 3THPA 1XTZA 2M4MA 1MWQA 2K7JA 3MCNA 2LP4A 4LR8A 3TA2A 5KG2A 4DV1J 4X4QA 1F3VA 4IH6A 4RJVA 3C2PA 3HI9A 1NO8A 4CYUB 3EM1A 3CO9A 4EBCA 1WD6A 1T02A 3N9UC 2QSFA 4GVLA 3RB3A 1DRZA 2HZVA 1H73A 5D4OA 4EZ6A 4B3RF 3VQTA 4WPAA 4CI0B 5T7LB 3G8SA 1HBUA 3BYRA 1VIXA 1Q82T 3IXQA 4ZCIA 5A8WB 3VAIA 3FRZA 2FJVA 4X4OA 4FPRA 4JI4F 4KR0B 1AUSL 2KHDA 4LF5F 3EPGA 3NS5A 2ZHOA 3W66A 2XG8A 1ICEB 1VC0A 1B7FA 4AD6A 1YRUA 3DOLB 2V8VA 1GT8A 3G87A 1D9FA 3ZZTA 4I7FB 5SUHA 3PO4A 2HIQA 1S4FA 3P96A 4TU8A 5ETOA 2MTLA 3LAKA 2CNLB 4J37A 2RRNA 3M9MB 3KLEB 2L48A 2ZVSA 1EQ0A 2YKMB 2RHSB 4I4BA 5ETTA 3UN3A 1Z2ZA 5GAEI 2V50A 1UEKA 4X4VA 2R7SA 5KFTA 2IHR1 2JHEA 3Q8UA 4F36A 1J5OB 1JMTA 1R27B 2ZOGA 3DU6A 5BR8J 1RT6A 2AJ1A 2DNMA 2LDYA 3VGUA 3M05A 2LECA 2CJBA 1NJXA 2HHQA 2JH3A 1YJVA 2KRRA 3CSKA 3MMCB 2C3OA 5BYRA 1N5VA 1JX4A 3B6BA 2KO1A 2AZ3A 1S10A 3D0HE 3ZTSA 1GK8A 1V5VA 3AA8A 1U8WA 5HP1B 2QFJA 3EGZA 4G3IA 3ZO7A 3CCVS 1RT4A 3R5JB 5EN1A 4O44B 1NB2A 1RTDA 1VR6A 2RH3A 1N6QA 3DLHA 3H98A 5F8NA 2CPFA 2QMUB 5KFDA 4W90B 1WF2A 3LAMA 2MPUA 4ZVTB 2QO3A 2IJFA 1KQFB 2ZH7A 1SC1B 2MLZA 2IDEA 4NOHA 5C42A 4GKKJ 1QD1A 1SXLA 2DCLA 2DTJA 3HVAA 2BJ1A 3T5JA 4PWDA 1T05A 1S6UA 1U1KA 3P5TL 4ZVGA 2ZM6F 1UVJA 4EFAC 4FS1A 4IOAQ 4DL3A 1V5IB 2WB1D 5KG1A 2ZKTA 3UVJA 5HATA 5F8MA 5I3UA 4J90A 1D3WA 4XPEA 1VGYA 5IT0A 2MGZA 4A8MP 3HVTA 3ISZA 3IRXB 4KYZA 1I5OB 4OZLA 3ZXWA 2X51A 3H8YA 4LUBA 4OHWA 3KK2B 2VOPA 2GQCA 3CMAS 2NXUA 1RWXB 1T95A 3FFIB 3MEEA 4DCPB 2KJVA 3TEGA 2KRBA 3M8PA 1KQKA 2PMHA 3CE8A 2R2UA 3FJ2A 2DR5A 1RT7B 2MDAA 2DITA 2QMXA 3JQJA 4QR2A 5GMEA 4DUZJ 1L3SA 1G2EA 2KZZA 1RT3A 1TZ0A 2K2PA 3GYNA 3HKWA 5MAOA 1KC8T 3OXFA 4ZJOA 3R5DA 1EQMA 2MSTA 4I6WA 4TY8A 1M0SA 3HX9A 2WVBA 2DHSA 3GIMA 2FJXA 3QJLA 4A8YA 2XZWA 1UW4A 3VR1A 2X1GA 2RU3A 1FCAA 3IS9B 1NEEA 1YKWA 1UVIA 1NJIT 1QDUB 2Z4PA 4XK8C 5DLGA 3TUIC 1ZH5A 4WJBA 1TL1A 2PE8A 2I0XA 3SEOA 3GV5B 1DBDA 3TA1A 1LXJA 1GXUA 3PTWA 4CLZA 1I94F 1EKRA 4ILMA 4IQMA 4M5IA 4YUDA 4N56A 3H7HB 3KLVA 4KGVB 4KT0C 3M2RA 1M5SA 1WC5A 1EIYB 3W8GA 2QN6B 1AZSA 1UMJA 5H1SV 1Y3JA 3JQKA 3K59A 1XERA 1ZTWA 4XAKA 1UFLA 3WDOA 4NCGA 4ZVEA 3KLFA 2HBQB 3RRHA 3GJQB 4H4OA 5I3QA 2GZOA 2KM8C 4A48A 2VG7A 4LSNA 3V81B 2ATLA 2V8GA 1CQNA 2CDQA 5C25A 4URGA 2W9BB 1SH2A 4B3TF 2HQGA 4PXDA 1IJEB 1FWPA 1LFWA 1YJNS 4P2XA 4QCLA 5CABA 3TQ1A 1GEHA 2D69A 5B0AA 5KG7A 1S72S 3G8QA 3QATA 4CT8A 4DQQA 1FWLA 1TAQA 1SKWA 1FJGF 4DEZA 2CJXB 4PPZA 1SC3B 4W4MA 2FVSA 2RAQA 1YSJA 2MQ8A 1WKKA 3O6QA 2M7SA 5I3PA 2AYEA 2GMHA 2FGOA 3MAAA 4HACA 4PQAA 3SIPB 3ZTPA 2G0CA 1L5UA 4HTIA 1PC4A 3C16A 2XHWA 2F9JA 4DDFA 3NKYA 4D3HA 4DSJA 3KJFB 1S9EB 4ZIWA 1IKYA 3AXMA 1N5SA 2LXUA 3M8YA 3AAWB 5EX0A 4NLSA 1Z2LA 2DYAA 2XHCA 4WIIA 2IYIA 1J27A 1Q8KA 2P2CB 3CJ0A 3H90A 4NWBA 4ED3A 3N5BA 1S9FA 3PW2A 3RAQA 1NAQA 4LRFA 2RDIA 3H2UB 1FTRA 2HGNA 3RTVA 1BWVA 4ZPDA 3AXKA 4KSEB 1VHFA 1ZOTA 1V9OA 2CJKA 4KRWA 2YNFB 1HWKA 2HG4A 1H0HB 2HNYB 3CCZA 1FEHA 3DGPA 3H5UA 4HL9A 1UWBB 1X0FA 3B82A 1S59A 4RO0A 1QJHA 2WVCA 3D5MA 5K9FA 3T5LA 5I42B 1QAIA 4RW6B 1N0VC 1J2VA 1IWGA 2WSCC 3LP2A 3QYYA 3R5GA 1UFKA 2F4VF 1TKZB 3A13A 4LR9A 4YQWA 3P6YC 1OYEA 3EYZA 1RDRA 3MM5A 5HL7Q 4OYWA 2H5IB 4PR6A 1N8RT 1I6JA 1A7GE 2VH7A 3PJWA 3CDEA 3NLCA 2I6WA 3M7VA 3HMJG 2VZ9A 4Y00A 4J9MA 1FK9A 4FYWB 3AD8C 4URSA 2XMTA 3RW7A 3T41A 5CYQA 5LT5A 4K4YA 2V5HG 5IT4A 4UF4A 4UT4A 2B9XA 2FIUA 4AE5A 3PZPA 4WIQA 2A2DA 3S1TA 1SKSA 1FD2A 5D3GB 1PYTA 1DHMA 1FKOB 4KB7A 4TLRA 5EDWA 4HR2A 4B9VA 1C4AA 2IM3A 1AFJA 3Q8VA 2COLA 4ZN1A 3J81j 3OL7A 1Z4UA 2QX0A 3QFWA 3D6HB 5D15A 1JLQB 2RQ4A 2JDJA 3D3CJ 3BR8A 2W9CA 1RT1B 4EUVA 1X5TA 2UVUA 2XMWA 3QGGA 4PEOA 3QZ8A 2V2ZA 1TUWA 1KVJA 3BKTA 1T0TV 2RQKA 5D6GA 1SJQA 3NOCA 2M8HA 2XEXA 2J0SD 1PKUA 3POTA 4UY8T 2FUG9 4ZCLA 3J80U 3D66A 4L73A 3G6ES 1QY7A 1RADB 2CZ4A 2Z2YB 3CJ4A 1VISA 5CYMA 2B5JB 4P72A 3RUBL 4NXMF 4DXLA 2XS5A 1RCOB 2ZH9A 2LEBA 2VUGA 4DUTA 3TP2A 1RWNB 4C8LA 3M8SA 1WI6A 3M32B 4ZVHA 4PXCA 2QL5B 5CD4H 1YJUA 1XQIA 2OTLS 4B3RJ 2XZDB 4WFNQ 3QWUA 2Z30B 4E8UA 2W8LA 3IC1A 4KFBA 3J7AN 3P49B 3A3PB 4ID8A 2Q6CA 1Q53A 1UVKA 3M8ZA 3TA0A 2EWHA 1JLEA 1C2PA 1AXQA 2IRUA 3CJ8A 3DRSB 4JV0A 1FEEA 3M6WA 3PDNA 3PV8A 1U24A 4WXWA 1S76D 1FVQA 2ABYA 3BS9A 3LQVA 4CLSA 4ED6A 1UAWA 1HMVA 5D77A 4J9NA 2B5JA 3X1LB 4LIRA 1HD1A 3WX8A 2ZH8A 3KLHB 2GIFA 4JI7J 4WKYA 1FKAF 1V3RA 4F4YA 2BKPA 3QT7A 1ACMB 3POTB 4QYZK 2UXBJ 3U1LA 1RBLA 2ADBA 1HQUB 4B08A 3MECA 2FDNA 1K1QA 2DGXA 3MFIA 1KD1T 1GH8A 1R8BA 3R27A 3DI6A 3NXZA 3D6FB 3JSBA 1JIHA 2F9DA 4C9DA 2AKWB 3I9V9 4AXJA 3VHQA 1JLEB 2B8QA 3NMRA 2KXNB 1JLCB 3NGTA 2PSZA 5DJBA 1FJEB 4OX6A 3BDEA 1SJFA 2PA8D 3ITHA 4Z2XA 2MQPA 3NL0A 1RT5A 1FFWB 3EWGA 1MN7A 2DR6A 3KG4A 2LXFA 2EBEA 3BN4A 4UQTA 2QG9B 4OJ1A 4RPFA 4RNMA 3DOKB 3PX4A 1DURA 2FY8A 4ZPAA 1N56A 2RJZA 4CLLA 5B08A 1RHMB 2E5JA 2RF2B 3OT9A 5EHHA 2WONB 3AA9A 3N0VA 3JAMU 2G4BA 1P9YA 4BC9A 1RBOB 1S6OA 2HQFA 2MKJA 3IR7B 2AX0A 4OZNA 3PACA 2PEHA 3UNYA 1U1NA 4U7UK 2ZZTA 3W5YA 3FSXA 1SC4B 2MHNA 4DPXA 2F4VJ 4X4UA 1U0HB 2W2NP 3LGMA 3P8BB 1CLFA 2HKEA 3ZZ0A 4LQ3A 3KLIB 1NNDA 3RBXA 1NPKA 4JB8B 3FBFA 3IR5B 1KLMB 3DLGA 1EAYC 1MMNA 3IO1A 5F0WA 5IWAJ 1YBAA 2CJYB 4LF9F 2ZM6J 2I8EA 2XLJA 2UVVA 3QAUA 4F4XA 2Z2ZA 1NK4A 1NJWA 2FHJA 1F6TA 1TUGB 2C3MA 1TKDA 3P3DA 4B3OB 2EG1A 4U95A 3DRPB 2KG1A 1OYDA 3HHNB 1WHWA 2EXUA 1XJWB 4YB5A 5HJXA 3PG9A 1XR7A 5KFGA 2NSCA 5IXUA 1LW0A 1HLWA 1R0AA 4NXNJ 4MT1A 2CIMA 3M4XA 3HT3A 3I55S 2NXCA 2QA2A 2ZHAA 2H5EA 4J9RA 2P9EA 4OZ1A 4WYLA 2DEJA 5IFMA 1YITS 4JYAF 1JLBA 5AE3A 5HMZA 1F3FA 4NA1A 4JI5F 3MAAB 3AY0A 1NLKL 1UJ5A 4FVMA 4ZITA 3JTNA 1LQ9A 3GIIA 3W3SA 5E3AA 1VQYA 5I42A 4KBIA 4EMDA 2ZBPA 3ENVA 2YKNB 4QU6A 1LK5A 2YNGA 2YNIA 4YR0A 2G0IA 2V2VA 1K47A 1RTHB 2YKAA 3SBMA 1Y3KA 2I5JB 5KFPA 2C3PA 4PXBA 3I0SB 3VZIA 2Y3YA 3TVZA 2YH0A 3BGRA 4QBUA 5HVFA 1MMDA 3EDQB 4R25A 3HCXA 2HPUA 3F0NA 2LQJA 5B0FA 1FVSA 1SI9A 2DR9A 3MR7A 4DOZA 3BPSP 4I2PB 3HSJA 4FKYA 2FZKB 2HFOA 4K7QA 3DLKA 5CZVA 4DG1A 4DSIA 3ISND 2CJQA 1VQMS 2GVZA 4NX9A 1IKYB 4DR1F 2AIRB 1RK8A 1FXRA 1YZ6A 3M2RB 2ZE2A 3R6LB 2KFYA 2GQQA 5AXMA 3V6HA 4O0IA 3CJQA 3K5OA 3CCMS 2W7AA 2XI2A 4ANCA 3EX7B 2BV3A 3OTOF 2DKOB 2XO6A 4DR5J 3UCZP 5IV3A 3ZTRA 3GR0A 2AYMA 1G3OA 3BR9A 3NGSA 1IQZA 1HQEB 2J7WA 4OQJA 1VBKA 2CWXA 2RIJA 1UPPA 2XY6A 1H3DA 4J91A 4KV8B 4JI8J 1FHTA 1Y0HA 7AT1B 2FVRA 4XPCA 4LRCA 4NLGA 4H4MA 5KT3A 1B0PA 3SV3A 1S49A 2BUNA 3R7SB 3BQ1A 2NPFA 1W2IA 3GIKA 4DMZA 1N48A 4OLOA 5KFLA 2JEGA 1RUSA 2DIVA 2RVJA 5DDOC 3TVKA 2DH9A 1H74A 4ECXA 1U6ZA 1X9WA 3OVSA 2OMLA 2QJ3A 3HZGA 4M8LA 4G1PA 1F9EB 4IRCA 3WBZA 3G71S 3ICLA 4AYBD 1B64A 3OVAA 1HPZB 3MPWA 4N41A 1FE4A 2QT7A 3QIDA 3OUYB 1J5EF 4DQRA 3HFVA 3KK2A 1LWXA 3HVTB 3IBCB 3TAMA 2MGZB 4G1QB 5I3UB 2KL8A 3KHRA 4F4AA 3TAPA 3TX0A 4USIA 1BWEA 2WOMA 4WXOA 1VRTB 4ZS6A 2W2PP 3GMGA 4UOCA 3PCOB 1BXNA 3DHWC 3MAQA 2E5LF 2MB0B 2VBWA 2H54B 3KUHA 2KI2A 5C42B 5HN0A 2VU5A 3CULA 2ILZA 1SJRA 3QGHA 3JSRA 4ZPTR 5KFFA 4DS4A 1FX2A 4TY8B 5GAEU 3HXMA 4K4UA 1HD0A 4NLPA 2Y8YA 4I64A 2C1EB 4ECQA 2UV8G 1SBRA 1YJRA 2YWEA 2OMOA 2HHUA 3TOQA 3AFGA 4DV7J 3EZOA 1S6QB 3S7RA 5T14A 4DR2F 4F3OA 1RT4B 3W7BA 1IR1A 3W2WA 1CJTA 2HHPA 1X31C 2J0WA 2R42A 4C8KA 2B56A 3DYAB 5JVHQ 4ES2A 3VZHA 3DM2A 4MFBA 2W7OA 3KUEA 3HSGA 1RAHB 5A0YB 2ASJA 1BLUA 3KK3B 3C6UB 3SSSA 4ZN3A 4FYVB 2QFIA 2XCAA 1HNXJ 3RR7A 2HSEB 4DL4A 2HNDB 1WHVA 3FMBA 3QQCD 4GKJJ 4OZ5A 1KTQA 4YS2A 1SCJB 4WP3A 2W2MP 3ELHA 5HI7A 4ZDNA 2MHEA 3NRBA 3BF4A 4RL1A 2RU9A 1Q8IA 2G1HA 2GJIA 3T1HJ 1OY6A 3QBCA 2A6OA 1BQMA 3VALA 4QQBA 1TL3B 4YP3A 6AT1B 2QSWA 2ACMA 3AT1B 1DQAA 4C48A 1YHQS 3G9CA 3SYZA 2NYIA 1RGVA 1O6XA 4ZJQA 4DR6F 1S1WB 2O5DA 4K2JA 4Y2MA 3V5RA 1E6VA 5G0RB 2RDDA 4B17A 1ZM2A 3K5LA 2QYGA 1OPIA 2GMLA 4JOUA 4A47A 5C24B 1TK5A 2AX1A 4NXMJ 2HW3A 2NPIA 4FXDA 1SUQB 3QNWB 5BJRA 5GMKa 4DJBA 4CO2A 4I1TA 2NQPA 2D3O1 2W4PA 3GONA 3MHYA 2YKPA 3KOAA 1Q78A 2UXDF 4V19X 2DO4A 3DLJA 4DCOB 2PGCA 5J1EB 1V3SA 3M9NB 3AB4B 1HBUB 3B8HA 2VA2A 4TVAB 4WU3A 4F2RA 2CJ9A 4ZPCA 3MMCA 2MLXA 5ETVA 4DPWA 3VAFA 2XY7A 2FJWA 4LBIA 4KJIA 2J7KA 2XS2A 4YDXA 3GIRA 1VJQA 4DR2J 2AYBA 1Q0NA 1B70B 1WSRA 2ACYA 2H9ZA 4WBFA 2N82B 1U1QA 2UUAJ 4OYMA 3GFHA 3SXLA 1AFIA 1X4BA 2YKMA 2PMWA 4JBCA 1RWKB 2HZAA 4F02A 4FF4A 2CQPA 1RA7A 4ZHRA 1PCAA 3MM6B 5AE1A 3CXCR 2DNQA 4C8YA 3FCVA 3T3FA 1BMQB 2LQ9A 2WBRA 1RWVB 3LP1A 3W9JA 2ZHBA 2N3LA 3Q89A 1O5JA 3PIOQ 1Y7PA 1NRKA 3PX6A 4JI3F 2I1RA 2IBOA 3FBBA 4DV6J 1T3NA 4OHVA 1N34J 2YX1A 1X9SA 4DSFA 2BRLA 3V6JA 1VYAA 4TKTA 2OJ3A 2RKIA 1FRMA 2EPIA 1TVRB 4KPCA 1WKLA 1EHWA 2BR0A 1ZYQA 2OSRA 1S97A 1VQNS 4X4NA 1Q1KA 1R8AA 4IOCQ 3MMBB 4OYBA 1UW9A 1A0OB 4ZVUB 1VQ4S 3QMQA 5K14B 4O0NA 2F65A 3CMQA 3O8WA 2DK2A 3BSAA 4C8NA 3CCES 1MWZA 1KOHA 2KFNA 1KHVA 3BEGB 3DGVA 1R6YA 3O2IA 3M8QA 4RW9B 4RNOA 2BJEA 3MM9A 4NI2A 4R0EA 2VL1A 4DQPA 4RW8B 3H20A 3TVYA 2B8PA 1TFYA 2BBEA 4R5PB 4AQYJ 5J2NA 5A6PA 3BO3A 3LUYA 3HK2A 4NRTA 2YQ1A 4R5PA 3PO5A 3LW5C 5IWAF 1F5BA 2M2BA 4PYAA 1QE1A 4RW8A 1FX4A 1WJ9A 1HNVB 1RWOB 1UPMB 9ATCB 5J1PA 1M1KT 1S0VA 2VIHA 4QWBA 1WKJA 2KYXA 1QLNA 2YNHB 1NHVA 3PYEA 2FHJD 2GW8A 2FGCA 3KMSA 4DL6A 2ZFHA 1R3NA 1H72C 5H9FK 1D09B 1Y5NB 3D28A 4WFZA 1F2GA 1WHXA 4AL6A 2DVIA 2EC0A 4KGXB 1KR4A 2VFTA 3QAEA 1S1VB 4QYRA 4F0MA 1RKJA 5ETKA 4P74A 3W61A 2BQUA 5RUBA 3HJVA 4ZKAA 1S12A 2C2KB 2LMIA 2K1RA 1T9VA 4MKAA 2IJRA 5DS7A 5CCLA 5FLXU 4JV1A 2GO9A 1DTQB 1WG5A 1IJFB 4ILLA 2O67A 1HNVA 3TZYA 3MR2A 4QJVA 1LWEA 1QE1B 4C3MA 2PI5A 1FJCA 3CJ5A 2FLOA 3ILIA 3J7ZT 3K5PA
chains in the Genus database with same CATH topology
1AW0A 3OFEA 2VG6B 1YQHA 2EKYA 1M5HA 4FF2A 2HMIA 4YB1P 2JX2A 3ENQA 3MM9B 1QVGR 2W7PA 4PG8A 2Y1RI 1GXLA 2A10A 2ERRA 3ZZOA 2IBKA 1Q16B 2LYVA 2Y0SD 2BRKA 2E9TA 2F8MA 4MAKA 4JI1F 2XMVA 3CC2S 4KQZA 1ZAWA 4NMLA 4TNOA 1EP4A 4HEA9 4WFYA 1YG0A 4B3MF 4A46A 1U47A 3M2UB 3CD7A 4HH1A 1MMLA 2CVEA 2IJNA 4KGMA 4ID5B 1I1GA 2N3OA 4DF8A 1WACA 2C2EA 5HBMA 3DDNA 2UVWA 4ALZA 4DR5F 1GXTA 2WAQD 3HHLB 3OHAA 2DPIA 1S1TA 4Q5VA 5KFCA 2B0GA 1X8DA 4Y28C 1Y5LB 1CC7A 3GILA 3RB6A 5F8HA 1RI7A 1IQTA 4ZP6A 2HWTA 2J6TA 4KPYA 1TKTA 2R2RA 3FCHA 4YR2A 2CKWA 2UUTA 4NLUA 3F44A 3CCRS 2YY3A 4PRFA 4EBDA 4DL5A 5KFZA 3ZZPA 4FXVA 5KT5A 4X62F 5KG6A 1QAJA 1DQ8A 4WK3A 4PPDA 1C1BA 1S6PB 1H98A 4X2BA 4UY85 2CPZA 1ELOA 1C1BB 1RT2B 3J7YI 3IBWA 3Q0AA 1CQMA 2PFFB 5A0YA 3BZQA 3RB0A 4IO1A 4XDDA 2HS4A 1FNMA 3IG1A 3DRRB 2R7RA 3FEYB 1TKTB 3O3LA 5KG4A 5A2QY 4DF4A 2NR0A 3QJPA 1C1CB 1OSCA 3HP6A 5G0RA 1NKEA 4DLGA 1S1WA 3SCLE 5J2PA 4ATNA 4LF6F 2O1PA 3I4PA 3PW0A 2EBGA 1NHUA 2JVOA 4K5RA 3RBEA 4A8QA 2CQIA 1U1LA 2BXJA 4X84A 1VRTA 1RTIB 3UFCX 4TQSA 2ZOFA 3JSMA 2CQGA 4U6PA 2HNDA 4OI0A 1QSYA 2Q79A 4GMKA 4G1QA 3OR2A 4WFBQ 1U48A 2GGPB 1EP4B 2EK1A 3M6XA 1X4HA 3JYTA 4OLPA 3OUYA 2YH1A 2ROPA 2RT3A 2A2CA 4AL7A 4X66F 1SV5A 1REVA 2IM0A 2OO4A 4M1KA 4Y6IA 3KHGA 2HYIB 2JJ4D 2WTFA 3OVBA 5A8RB 4F67A 2J9DA 4DV0F 1SJ4P 5KFBA 1HWLA 1KS2A 3VAHA 3MUTP 3ZZUA 1P27B 2U2FA 1HBNB 3HFKA 1X4CA 4P7VA 1XMOF 2HNZB 4R0JA 3IWLA 3CVKA 2IA0A 4IG0B 4U67Q 4HT5A 5D4PA 4LSLB 2KKHA 4RKUC 3RU0A 4QW9A 2AGOA 3HHLC 1X4DA 3FGVA 2KZMA 4WZMA 2VC1A 4RWXA 2ZE2B 2ZNYA 3ZC4A 4YEAA 3GV7B 4MK8A 2W25A 5F3TA 3CJKA 1HWUA 1UA1A 1AUDA 3PM9A 2YNHA 2LEAA 3NP5A 2V94A 4DBQA 2FLNA 5J2QA 1X4GA 1TAUA 2EI5A 3F41A 3THTA 5IM0A 1FXLA 2MKIA 4K50A 4WTYA 3OBIA 5EX3A 1KEKA 4OZ0A 3DLLQ 5K8NA 4B02A 2QIFA 1NK6A 2PDAA 4C4WA 1RTJB 2YNIB 1T94A 1JNZB 2KTQA 4TU7A 1R8CA 3ULHA 1XWLA 2AJ0A 3IRWP 2IMOA 1NK7A 1ZZFA 3GG0A 2OPPB 4MYUA 4ZP7A 2YWGA 4PUOA 1JKHA 1D9DA 1JLAB 3MTJA 1OPZA 3OSPA 2MKSA 3OV7A 5KFSA 5ITHA 3PIPQ 4CH0S 4LVOP 3MD3A 3KMQA 1N0UA 2JVRA 2MZQA 5KFYA 2XWXA 1PGZA 3SMZA 1TL5A 1SH0A 5IZHA 2JOQA 3MDFA 2GHWA 1N34F 1ZM9A 2GMJA 1JJ2R 1VQOS 4ECRA 4DQIA 4DL0C 2I5JA 5B09A 2ZDOA 3QIPA 1VQPS 4A8KA 4C0OC 4J9KA 3CC4S 1X5SA 2HS0A 4OI4A 2ZH2A 3H5YA 4ZCMA 1OIAA 5JXSA 3KLIA 4MJKA 2HHXA 4QWEA 2DR7A 2GQ2A 2E1MC 4O4RA 4NA3A 2YVSA 3S01A 1HBOB 2D7SA 5ADZA 5DGBA 3BSOA 2C2RA 4QPXA 5B7WA 1M5OC 2FJAB 4HT7A 1LWCB 1NB7A 2AJFE 5KFHA 3DOKA 1FE0A 3H5XA 4B3OA 3KG0A 1ZPWX 1X4AA 4ZPVR 4ZPWR 1NJYA 5JVGQ 5U47A 1OO0B 2DGSA 2IC3B 5GADU 3RYLA 1SUQA 4MKBA 2J9CA 1HI0P 2BW2A 2NREA 4CCHA 1ZM4A 3U1NA 1GX5A 3D1OA 1MU2A 3T9ZA 1HA1A 1HHSA 4A4JA 3H4BA 4Q8EA 2VFRA 4R8UA 2SXLA 4CZCA 3T9NA 1KLMA 2GFFA 4URQU 2MKHA 4QOTA 2FJBB 3MEKA 5F8LA 1TL3A 4X4RA 5D8HB 3M1VA 1HQUA 4DV4F 3SDEA 1VLYA 1WEZA 4ES1A 2OPRB 2B6AA 3OTDA 1GNKA 4ECVA 4Q43A 3G6YA 1FF2A 3NNAA 3VAMA 1JB0C 1C0UA 2VBXA 3T1HF 2ZJRQ 4ELUA 4LFBF 2DNYA 4EO6A 4ETXA 2MZ1A 4FXWA 1URNA 1U7LA 3KK3A 2OPQB 1N32F 2HHTA 2YWFA 1PILA 2A3JA 2F1FA 2IRXA 4LVNP 4FN5A 3FMWA 1WF0A 2MQQA 2QA4S 3DYAA 4ZCKA 4C97A 4HH0A 4C0HA 4DV5F 2HHWA 1XMQF 2ZJQQ 5AE2A 3OTCA 1U2FA 2DNPA 3GE9A 5H9EJ 1U25A 4ZP8A 5HO4A 4OHXA 2IFXA 4DN9A 4Q45A 4Y2AA 3KLGB 3BQ2A 1S77D 3TARA 4MIWA 5KFUA 5MLCV 2MJNA 1S0OA 5CYMB 2CQCA 2PI4A 4Q8FA 5B0BA 2OPRA 4C98A 3J81Y 2OSQA 2HHVA 1FRHA 3OJUA 3BB5A 4DFJA 1NKBA 3M6VA 2FVPA 4R8UB 4I56A 1UEVA 4OX8A 4RW7A 2MXYA 3PRBA 4IDKB 3Q8PB 4J9OA 3H2VE 3U27A 2JLFA 2DNGA 2IC3A 3DMJA 2D9OA 2C3YA 4ZOSA 4ECYA 4PG6A 2L41A 1HR0F 3IR6B 1VC6A 1X0PA 3CF5Q 1TK0A 1FKOA 2C28A 1NJZA 1GAOA 2JSXA 3UCUP 2Y1JA 3FQKA 5D3GA 1LKZA 1IBMF 4IFYB 3V4IB 3C46A 1R7IA 2L9DA 1FK9B 4RUCA 2RQMA 1FESA 2DRBA 3ISNC 2GHPA 3SV4A 1RWUA 4UUXA 2HZCA 2R7XA 5GVQA 4WE1B 4F50A 2G9OA 3UDCA 1HQEA 2QE5A 3HM9A 3JTPA 4L6V3 1L3KA 1MROA 1Q7LB 4RZRA 3SZ2A 5L9XA 4RW6A 1WTBA 1WTFA 3I6PA 4TYBA 2BANB 2CQ1A 4QZVB 2RRBA 1FJ7A 3V2UC 2HNYA 4PWUA 1WWHA 3PXGa 5KFAA 4PG4A 4DSKA 4QWCA 4I2PA 5L8RC 1URRA 3OQ2A 4A8XA 5KFEA 5LSLA 2VB6A 4NLXA 5D4NA 5L38A 2OAUA 2KJWA 2CYYA 4CTAB 5KOWA 2J9DE 3DCAA 3MUVP 3CPWR 1Q8LA 3I0SA 2JC1A 2BQ3A 3H59A 2LCWA 1BQXA 3NS6A 3U02A 2HVIA 1S9EA 2XMMA 2IVFB 2BANA 1JK9B 4KGKA 3MGJA 1DZ5A 3DC2A 1UP1A 2BA9A 3CB4A 4KKOA 1YJWS 2YX4A 1MROB 4KE5A 1QAXA 4OHYA 2OPPA 2RS8A 3SQGA 1U1PA 1H2TZ 5HQ8A 4N77A 1FDBA 1JLBB 4H4KA 4KKOB 5F8IA 4B9MA 3OSNA 2PO4A 1IBKF 3VWSA 1U1MA 3FQLA 4IRKA 2R7UA 1R0AB 1LWFA 3N5FA 1OWXA 4F4WA 2DGUA 4OV1A 3DDKA 4IFYA 5D4LA 1FNOA 3DRPA 3N79A 2E5HA 1LOUA 2VG7B 2W4DA 3V81A 2LA6A 1TUVA 3MAHA 4HKQA 2VASA 2BQRA 3CJKB 4F4ZA 2DGTA 1UL3A 3CCWA 3MMAB 2L3MA 4ICLA 3ZZRA 1QSSA 2F3JA 5GAHI 3IWNC 2JC0A 1ZAXA 4FP9A 4I67A 1RP5A 2YQ3A 4KAIA 3DLGB 5DO2A 5DDPC 4I6AA 2DB1A 3EZUA 3LWLA 1U45A 1CC8A 4IG0A 4QIWD 2VOOA 3MOZA 4RNNA 4CO4A 4WE1A 3LWMA 3WC2A 1IKVB 3C66A 2XS7A 1XBWA 2FC9A 2UUCF 1ZZNA<