2D9VA

Solution structure of the ph domain of pleckstrin homology domain-containing protein family b member 1 from mouse
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
130
structure length
130
Chain Sequence
GSSGSSGLVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVVIHFNVRDIKVGQECQDVQPPEGRSRDGLLTVNLREGSRLHLCAETRDDAIAWKTALMEANSTPAPAGATVPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing protein family B membe
publication title Solution structure of the PH domain of Pleckstrin homology domain-containing protein family B member 1 from mouse
rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 19
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9vA01
2MDXA 3VIAA 1GG3A 3DXEA 3PP2A 3QWMA 2D2QA 2GCJA 3KY9A 3QBVB 4A6HA 3RCPA 1J19A 2DN6A 4DX8A 1BTNA 1ZSQA 3BJIA 4Z2NA 3ZVRA 3PVLA 2K2JA 3OANA 2Q13A 1MIZB 2E2XA 4GPTB 3A8QA 1MK9B 3HK0A 4ZRIA 4Z2MB 2IFSA 3LJUX 3TFMA 4KHOA 1SGHA 5EFXA 3SUZA 3GYPA 1WJMA 3AU5A 2DLWA 3X23A 1FAOA 3D8DA 3N7CA 1RRPB 3MPXA 2Y8GA 4KVGB 2QKLA 5DHFB 3MDBC 1Y19B 2D4QA 2EMTA 2N0YA 4D0NB 3BINA 3F5RA 1BTKA 2ELBA 1QC6A 5HE2A 2DA0A 5C6RA 2P0DA 1XODA 1MKEA 1ZVRA 4XWXA 4ZRJA 1K5GB 2J59M 2RUKB 3FM8C 1UNQA 2RGNB 1X11A 2CAYA 4DX90 2V76A 2Y7BA 2DFKA 5DHAB 1U5EA 1WGQA 1GC7A 3P7ZA 3IVFA 3ODOA 3QIJA 3ULBA 1J0WA 2GS0A 2UZRA 4PQ0A 4P7IA 2H7DA 4TYZA 3ULCA 4F7UP 4MY6A 2OQBA 1Y5OA 1U5DA 4EKUA 3VOQA 2ADZA 5CLQB 5J3QA 1EVHA 2GJYA 1MPHA 1I2HA 4WJ7A 5KQ1A 5JHGA 3TW1A 2DKPA 1RJ2A 2J0KA 5C5BA 4HHVA 1MIXA 4L6EA 4HB0B 2LOXA 3KRXA 1U27A 2D11A 5J3TA 4GMXB 2YS5A 1X05A 2YSZA 3M1IB 5JP4A 1M7EA 1PMSA 2ROZB 5DI9B 1X1FA 1XX0A 3SV1A 1E5WA 2YF0A 2N23A 1W1DA 2COFA 2YRYA 4EJNA 1U5FA 1X1GA 2RSGA 2EJ8A 3KSYA 2L1CA 2ZPYA 1DYNA 2RNRB 3D8EA 1AWEA 4HAYB 1FHOA 1K5DB 2DHIA 2UVMA 2CODA 3SO6A 1TXDA 3WA0A 4GZUA 1UPRA 3U7DA 5JHHA 3CIKA 1QQGA 2UZSA 4HB3B 2AL6A 4YL8A 2DHKA 2Z0OA 2I5CA 1ZM0A 2W2WA 2BCJA 1V61A 1LW3A 3PZDA 1NTYA 3SNHA 1P6SA 2DYQA 3SYXA 2NZ8B 2KGXB 1AQCA 5JLJB 2D9WA 3P6AA 2L2IA 1WI1A 2COCA 1OMWA 2FJLA 1N3HA 4ZRKA 1V5MA 1WVHA 5D3XA 4BBKA 2DTCA 3FEHA 1U5GA 2J0MA 4GN1A 1Q67A 3ML4A 3TVVA 5D3VA 2H7EA 4HDQA 2YVCA 2DYNA 4K2OA 4Y94A 2LYDA 3O96A 2P0FA 1H10A 2I5FA 1FHWA 1EGXA 1P3RA 2IYBA 4HDOA 4H8SA 4KAXB 5HE3A 4F7GA 5D3WA 2I1KA 2HE7A 2K2UA 2LULA 4HAXB 2VSZA 4DBBA 3PVWA 1TQZA 1UNRA 2MFQA 4PNKA 4CHMA 5LOPB 4A6FA 3TCAA 4NSWA 1X86A 1EF1A 5HE1A 1DDVA 3U8ZA 1BWNA 2Y8FA 1IRSA 5DIFB 2PZ1A 2EMSA 1EAZA 1Z87A 3D8FA 5DH9B 2ELAA 2M38A 1MAIA 3FSSA 1V5PA 2CY5A 2K00A 3UZTA 2R0DA 4HAWB 4HAVB 1U29A 2KCJA 1XD4A 1UPQA 4WVFB 1V5UA 4MK0A 4GXBA 4B6HA 3DXDA 2VRWB 1GC6A 2P0HA 4KHAA 3DXCA 1OY2A 1LB1A 1XR0B 1XKEA 2GCLA 3T06A 2EC1A 3ZDTA 5CLLB 3PEGA 1FHXA 2YS1A 1DDWA 4IAPA 4CHJA 3ODXA 1SHCA 1WG7A 2ROVA 1NI2A 4F7HA 1V89A 2Z0QA 2RVBB 4EMOA 1KZGA 4TKNA 3A8PA 2DX1A 2QKMA 4K2PA 4CYEA 4HB2B 4A5KA 2CRFA 1KI1B 1U2BA 3AJ4A 3TO1A 5C5BB 5J3YA 2MKRA 2YT1A 2VKIA 2YS3A 4DXAB 1WGUA 1ZC3B 3V5WA 1H4RA 1FGZA 2P8VA 1FGYA 1ZC4B 1NU2A 2DKQA 3CXBB 4WSFA 3PSCA 2COAA 1MK7B 2JP2A 4IOYX 4HATB 2D10A 2R09A 1UNPA 2LG1A 1DBHA 2M14A 5FI0A 2J0JA 4KHBB 1B55A 1W1GA 1NTVA 5D3YA 2I1JA 5KQ4A 4C0AA 2W2XD 3G9WA 1UEFA 3KZ1A 1M7RA 4K81A 3PG7A 2D9YA 1PFJA 5L81A 2G35A 2OTXA 2NMBA 2HTHB 5D27A 1P5TA 5C16A 2DHJA 1OQNA 3HW2B 1TJ6A 2XQNM 4IFSA 2DX5A 3HQCA 1FB8A 1BAKA 2KUPA 4NY0A 4HAUB 2X18A 4HB4B 5HE0A 5KCVA 5GOWB 3KRWA 3F0WA 2LOZA 4YONA 2LKOA 2D9ZA 4HAZB 3PVUA 2CY4A 2D9VA 1FOEA 2AEHA 3WYFB 3GYOA 4A6KA 1ISNA 2W2XC 1PLSA 1V88A 3A98B 1I7AA 3AU4A 3ODWA 1DROA 2RLOA 1W1HA 2MWNB 1KZ7A 1XCGA 3NSUA 1WJ1A 4MT7A 2YT0A 5LONB 4A6FB 2D9XA 1DDMA 4GMVA 5C79A 4K17A 5FI1A 2Z0PA
chains in the Genus database with same CATH superfamily
2MDXA 3VIAA 1GG3A 3DXEA 3PP2A 3QWMA 2D2QA 2GCJA 3KY9A 3QBVB 4A6HA 3RCPA 1J19A 2DN6A 4DX8A 1BTNA 1ZSQA 3BJIA 2FJUB 4Z2NA 3ZVRA 3PVLA 2K2JA 3OANA 2Q13A 1MIZB 2E2XA 4GPTB 3A8QA 1MK9B 3HK0A 4ZRIA 4Z2MB 2IFSA 3LJUX 3TFMA 4KHOA 1SGHA 5EFXA 3SUZA 3GYPA 1WJMA 3AU5A 2R2YA 2DLWA 3X23A 1FAOA 3D8DA 3N7CA 1RRPB 3MPXA 2Y8GA 4KVGB 3B77A 2QKLA 5DHFB 3MDBC 1Y19B 2Z13A 2D4QA 2EMTA 2N0YA 4D0NB 3BINA 3F5RA 1BTKA 2ELBA 1QC6A 5HE2A 2DA0A 5C6RA 2P0DA 1XODA 1MKEA 1ZVRA 4XWXA 4ZRJA 1K5GB 2J59M 2RUKB 3FM8C 1UNQA 2RGNB 1X11A 2CAYA 4DX90 2V76A 2Y7BA 2DFKA 5DHAB 1U5EA 1WGQA 1GC7A 3P7ZA 3IVFA 3ODOA 3QIJA 3ULBA 1J0WA 2GS0A 2UZRA 3NWFA 4PQ0A 4P7IA 3HSAA 2H7DA 4TYZA 3ULCA 4F7UP 4MY6A 2OQBA 1Y5OA 1U5DA 4EKUA 3VOQA 2ADZA 5CLQB 5J3QA 1EVHA 2GJYA 1MPHA 2Z4DA 1I2HA 4WJ7A 2YT2A 5KQ1A 5JHGA 3TW1A 2DKPA 1RJ2A 1MI1A 2J0KA 5C5BA 4HHVA 1MIXA 4L6EA 4HB0B 2LOXA 3KRXA 1U27A 2D11A 5J3TA 4GMXB 2YS5A 1X05A 2YSZA 3M1IB 5JP4A 1M7EA 1PMSA 2ROZB 5DI9B 1X1FA 1XX0A 3SV1A 1E5WA 2YF0A 2N23A 1W1DA 4GOUA 2COFA 2YRYA 4EJNA 1U5FA 1X1GA 2RSGA 2EJ8A 3NW8A 3KSYA 1T77A 2L1CA 2ZKMX 2ZPYA 1DYNA 2RNRB 3D8EA 1AWEA 4KHBA 4HAYB 1FHOA 1K5DB 2DHIA 2UVMA 2NBVA 3OHMB 2CODA 3SO6A 1TXDA 3WA0A 2GUMA 1UPRA 4GZUA 3U7DA 5JHHA 2KIGA 3CIKA 4L1RA 1QQGA 2UZSA 3NWAA 4HB3B 2AL6A 4YL8A 2DHKA 4GNKB 2Z0OA 2I5CA 1ZM0A 2W2WA 2BCJA 1V61A 1LW3A 3PZDA 1NTYA 3SNHA 1P6SA 2DYQA 3SYXA 2NZ8B 3HIEA 2KGXB 1AQCA 5JLJB 2D9WA 2L2IA 3P6AA 1WI1A 2COCA 1OMWA 2FJLA 1N3HA 4ZRKA 1V5MA 1WVHA 5D3XA 4BBKA 2DTCA 3FEHA 1U5GA 2J0MA 4GN1A 1Q67A 3ML4A 2KR0A 3TVVA 5D3VA 2H7EA 4HDQA 2YVCA 2DYNA 4K2OA 4Y94A 2LYDA 3O96A 2P0FA 1H10A 2I5FA 1FHWA 1EGXA 1P3RA 2IYBA 4HDOA 4H8SA 4KAXB 5HE3A 4F7GA 4QJ3B 3DCXA 5D3WA 2I1KA 2HE7A 2K2UA 2LULA 4HAXB 2VSZA 4DBBA 3PVWA 1TQZA 1UNRA 2MFQA 4PNKA 4CHMA 5LOPB 4A6FA 3TCAA 4NSWA 1X86A 1EF1A 5HE1A 1DDVA 3U8ZA 1BWNA 2Y8FA 1IRSA 5DIFB 2PZ1A 2EMSA 1EAZA 1Z87A 3D8FA 5DH9B 2ELAA 2M38A 1MAIA 3FSSA 1V5PA 2CY5A 2K00A 3UZTA 2R0DA 3U12A 4HAWB 4HAVB 1U29A 2KCJA 2RRFA 1XD4A 1UPQA 4WVFB 1V5UA 4MK0A 4GXBA 4B6HA 3DXDA 2VRWB 1GC6A 2P0HA 4KHAA 3DXCA 1OY2A 1LB1A 1XR0B 1XKEA 2GCLA 2KUQA 3T06A 2EC1A 3ZDTA 5LG4B 5CLLB 3PEGA 2Z14A 1FHXA 2YS1A 1DDWA 4IAPA 4CHJA 3ODXA 5I2SA 1SHCA 1WG7A 2ROVA 1NI2A 4OT1A 1V89A 4F7HA 2Z0QA 2RVBB 4EMOA 1KZGA 4TKNA 3A8PA 2DX1A 2QKMA 4K2PA 4CYEA 4HB2B 4A5KA 2CRFA 1KI1B 1U2BA 3AJ4A 3TO1A 5IRSA 4QJ5B 5C5BB 5J3YA 2MKRA 2YT1A 2VKIA 2YS3A 4DXAB 2K49A 1WGUA 1ZC3B 3V5WA 1H4RA 3FVCA 1FGZA 1ZYIA 2P8VA 1FGYA 1ZC4B 1NU2A 2DKQA 3CXBB 4WSFA 3PSCA 2COAA 1MK7B 2JP2A 4IOYX 4HATB 2D10A 2R09A 1UNPA 2LG1A 5I2MA 1DBHA 2M14A 5FI0A 2J0JA 4KHBB 1B55A 1W1GA 1NTVA 5D3YA 2I1JA 5KQ4A 4C0AA 2W2XD 3G9WA 4D6WA 5M4YB 1UEFA 3KZ1A 1M7RA 4K81A 3PG7A 2D9YA 1PFJA 5L81A 2G35A 2OTXA 2NMBA 2HTHB 5D27A 4DIXA 1P5TA 5C16A 2DHJA 1OQNA 3HW2B 1TJ6A 2XQNM 4IFSA 2DX5A 4CSQA 3HQCA 1FB8A 1BAKA 2KUPA 4NY0A 2Z59A 4HSIA 4HAUB 2X18A 4HB4B 4OSNA 5HE0A 5KCVA 5GOWB 3KRWA 3F0WA 2LOZA 4YONA 2LKOA 2D9ZA 4HAZB 3NWDA 3PVUA 2CY4A 2D9VA 1FOEA 2AEHA 3WYFB 3GYOA 4A6KA 1ISNA 4QJ4B 2W2XC 1PLSA 3A58A 4QXAB 1V88A 3A98B 1I7AA 3AU4A 3ODWA 1DROA 2RLOA 1W1HA 2MWNB 1KZ7A 1XCGA 3NSUA 1WJ1A 4MT7A 2YT0A 5LONB 4A6FB 2D9XA 1DDMA 4GMVA 5C79A 4K17A 2K8EA 2KIEA 5FI1A 2Z0PA
chains in the Genus database with same CATH topology
2MDXA 3VIAA 1GG3A 3DXEA 3PP2A 3QWMA 2D2QA 2GCJA 3KY9A 3QBVB 4A6HA 3RCPA 1J19A 2DN6A 4DX8A 1BTNA 1ZSQA 3BJIA 4Z2NA 3ZVRA 3PVLA 2K2JA 3OANA 2Q13A 1MIZB 2E2XA 4GPTB 3A8QA 1MK9B 3HK0A 4ZRIA 4Z2MB 2IFSA 3LJUX 3TFMA 4KHOA 1SGHA 5EFXA 3SUZA 3GYPA 1WJMA 3AU5A 2DLWA 3X23A 1FAOA 3D8DA 3N7CA 1RRPB 3MPXA 2Y8GA 4KVGB 2QKLA 5DHFB 3MDBC 1Y19B 2D4QA 2EMTA 2N0YA 4D0NB 3BINA 3F5RA 1BTKA 2ELBA 1QC6A 5HE2A 2DA0A 5C6RA 2P0DA 1XODA 1MKEA 1ZVRA 4XWXA 4ZRJA 1K5GB 2J59M 2RUKB 3FM8C 1UNQA 2RGNB 1X11A 2CAYA 4DX90 2V76A 2Y7BA 2DFKA 5DHAB 1U5EA 1WGQA 1GC7A 3P7ZA 3IVFA 3ODOA 3QIJA 3ULBA 1J0WA 2GS0A 2UZRA 4PQ0A 4P7IA 2H7DA 4TYZA 3ULCA 4F7UP 4MY6A 2OQBA 1Y5OA 1U5DA 4EKUA 3VOQA 2ADZA 5CLQB 5J3QA 1EVHA 2GJYA 1MPHA 1I2HA 4WJ7A 5KQ1A 5JHGA 3TW1A 2DKPA 1RJ2A 2J0KA 5C5BA 4HHVA 1MIXA 4L6EA 4HB0B 2LOXA 3KRXA 1U27A 2D11A 5J3TA 4GMXB 2YS5A 1X05A 2YSZA 3M1IB 5JP4A 1M7EA 1PMSA 2ROZB 5DI9B 1X1FA 1XX0A 3SV1A 1E5WA 2YF0A 2N23A 1W1DA 2COFA 2YRYA 4EJNA 1U5FA 1X1GA 2RSGA 2EJ8A 3KSYA 2L1CA 2ZPYA 1DYNA 2RNRB 3D8EA 1AWEA 4HAYB 1FHOA 1K5DB 2DHIA 2UVMA 2CODA 3SO6A 1TXDA 3WA0A 4GZUA 1UPRA 3U7DA 5JHHA 3CIKA 1QQGA 2UZSA 4HB3B 2AL6A 4YL8A 2DHKA 2Z0OA 2I5CA 1ZM0A 2W2WA 2BCJA 1V61A 1LW3A 3PZDA 1NTYA 3SNHA 1P6SA 2DYQA 3SYXA 2NZ8B 2KGXB 1AQCA 5JLJB 2D9WA 3P6AA 2L2IA 1WI1A 2COCA 1OMWA 2FJLA 1N3HA 4ZRKA 1V5MA 1WVHA 5D3XA 4BBKA 2DTCA 3FEHA 1U5GA 2J0MA 4GN1A 1Q67A 3ML4A 3TVVA 5D3VA 2H7EA 4HDQA 2YVCA 2DYNA 4K2OA 4Y94A 2LYDA 3O96A 2P0FA 1H10A 2I5FA 1FHWA 1EGXA 1P3RA 2IYBA 4HDOA 4H8SA 4KAXB 5HE3A 4F7GA 5D3WA 2I1KA 2HE7A 2K2UA 2LULA 4HAXB 2VSZA 4DBBA 3PVWA 1TQZA 1UNRA 2MFQA 4PNKA 4CHMA 5LOPB 4A6FA 3TCAA 4NSWA 1X86A 1EF1A 5HE1A 1DDVA 3U8ZA 1BWNA 2Y8FA 1IRSA 5DIFB 2PZ1A 2EMSA 1EAZA 1Z87A 3D8FA 5DH9B 2ELAA 2M38A 1MAIA 3FSSA 1V5PA 2CY5A 2K00A 3UZTA 2R0DA 4HAWB 4HAVB 1U29A 2KCJA 1XD4A 1UPQA 4WVFB 1V5UA 4MK0A 4GXBA 4B6HA 3DXDA 2VRWB 1GC6A 2P0HA 4KHAA 3DXCA 1OY2A 1LB1A 1XR0B 1XKEA 2GCLA 3T06A 2EC1A 3ZDTA 5CLLB 3PEGA 1FHXA 2YS1A 1DDWA 4IAPA 4CHJA 3ODXA 1SHCA 1WG7A 2ROVA 1NI2A 4F7HA 1V89A 2Z0QA 2RVBB 4EMOA 1KZGA 4TKNA 3A8PA 2DX1A 2QKMA 4K2PA 4CYEA 4HB2B 4A5KA 2CRFA 1KI1B 1U2BA 3AJ4A 3TO1A 5C5BB 5J3YA 2MKRA 2YT1A 2VKIA 2YS3A 4DXAB 1WGUA 1ZC3B 3V5WA 1H4RA 1FGZA 2P8VA 1FGYA 1ZC4B 1NU2A 2DKQA 3CXBB 4WSFA 3PSCA 2COAA 1MK7B 2JP2A 4IOYX 4HATB 2D10A 2R09A 1UNPA 2LG1A 1DBHA 2M14A 5FI0A 2J0JA 4KHBB 1B55A 1W1GA 1NTVA 5D3YA 2I1JA 5KQ4A 4C0AA 2W2XD 3G9WA 1UEFA 3KZ1A 1M7RA 4K81A 3PG7A 2D9YA 1PFJA 5L81A 2G35A 2OTXA 2NMBA 2HTHB 5D27A 1P5TA 5C16A 2DHJA 1OQNA 3HW2B 1TJ6A 2XQNM 4IFSA 2DX5A 3HQCA 1FB8A 1BAKA 2KUPA 4NY0A 4HAUB 2X18A 4HB4B 5HE0A 5KCVA 5GOWB 3KRWA 3F0WA 2LOZA 4YONA 2LKOA 2D9ZA 4HAZB 3PVUA 2CY4A 2D9VA 1FOEA 2AEHA 3WYFB 3GYOA 4A6KA 1ISNA 2W2XC 1PLSA 1V88A 3A98B 1I7AA 3AU4A 3ODWA 1DROA 2RLOA 1W1HA 2MWNB 1KZ7A 1XCGA 3NSUA 1WJ1A 4MT7A 2YT0A 5LONB 4A6FB 2D9XA 1DDMA 4GMVA 5C79A 4K17A 5FI1A 2Z0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDX A;  3VIA A;  1GG3 A;  3DXE A;  3PP2 A;  3QWM A;  2D2Q A;  2GCJ A;  3KY9 A;  3QBV B;  4A6H A;  3RCP A;  1J19 A;  2DN6 A;  4DX8 A;  1BTN A;  1ZSQ A;  3BJI A;  4Z2N A;  3ZVR A;  3PVL A;  2K2J A;  3OAN A;  2Q13 A;  1MIZ B;  2E2X A;  4GPT B;  3A8Q A;  1MK9 B;  3HK0 A;  4ZRI A;  4Z2M B;  2IFS A;  3LJU X;  3TFM A;  4KHO A;  1SGH A;  5EFX A;  3SUZ A;  3GYP A;  1WJM A;  3AU5 A;  2DLW A;  3X23 A;  1FAO A;  3D8D A;  3N7C A;  1RRP B;  3MPX A;  2Y8G A;  4KVG B;  2QKL A;  5DHF B;  3MDB C;  1Y19 B;  2D4Q A;  2EMT A;  2N0Y A;  4D0N B;  3BIN A;  3F5R A;  1BTK A;  2ELB A;  1QC6 A;  5HE2 A;  2DA0 A;  5C6R A;  2P0D A;  1XOD A;  1MKE A;  1ZVR A;  4XWX A;  4ZRJ A;  1K5G B;  2J59 M;  2RUK B;  3FM8 C;  1UNQ A;  2RGN B;  1X11 A;  2CAY A;  4DX9 0;  2V76 A;  2Y7B A;  2DFK A;  5DHA B;  1U5E A;  1WGQ A;  1GC7 A;  3P7Z A;  3IVF A;  3ODO A;  3QIJ A;  3ULB A;  1J0W A;  2GS0 A;  2UZR A;  4PQ0 A;  4P7I A;  2H7D A;  4TYZ A;  3ULC A;  4F7U P;  4MY6 A;  2OQB A;  1Y5O A;  1U5D A;  4EKU A;  3VOQ A;  2ADZ A;  5CLQ B;  5J3Q A;  1EVH A;  2GJY A;  1MPH A;  1I2H A;  4WJ7 A;  5KQ1 A;  5JHG A;  3TW1 A;  2DKP A;  1RJ2 A;  2J0K A;  5C5B A;  4HHV A;  1MIX A;  4L6E A;  4HB0 B;  2LOX A;  3KRX A;  1U27 A;  2D11 A;  5J3T A;  4GMX B;  2YS5 A;  1X05 A;  2YSZ A;  3M1I B;  5JP4 A;  1M7E A;  1PMS A;  2ROZ B;  5DI9 B;  1X1F A;  1XX0 A;  3SV1 A;  1E5W A;  2YF0 A;  2N23 A;  1W1D A;  2COF A;  2YRY A;  4EJN A;  1U5F A;  1X1G A;  2RSG A;  2EJ8 A;  3KSY A;  2L1C A;  2ZPY A;  1DYN A;  2RNR B;  3D8E A;  1AWE A;  4HAY B;  1FHO A;  1K5D B;  2DHI A;  2UVM A;  2COD A;  3SO6 A;  1TXD A;  3WA0 A;  4GZU A;  1UPR A;  3U7D A;  5JHH A;  3CIK A;  1QQG A;  2UZS A;  4HB3 B;  2AL6 A;  4YL8 A;  2DHK A;  2Z0O A;  2I5C A;  1ZM0 A;  2W2W A;  2BCJ A;  1V61 A;  1LW3 A;  3PZD A;  1NTY A;  3SNH A;  1P6S A;  2DYQ A;  3SYX A;  2NZ8 B;  2KGX B;  1AQC A;  5JLJ B;  2D9W A;  3P6A A;  2L2I A;  1WI1 A;  2COC A;  1OMW A;  2FJL A;  1N3H A;  4ZRK A;  1V5M A;  1WVH A;  5D3X A;  4BBK A;  2DTC A;  3FEH A;  1U5G A;  2J0M A;  4GN1 A;  1Q67 A;  3ML4 A;  3TVV A;  5D3V A;  2H7E A;  4HDQ A;  2YVC A;  2DYN A;  4K2O A;  4Y94 A;  2LYD A;  3O96 A;  2P0F A;  1H10 A;  2I5F A;  1FHW A;  1EGX A;  1P3R A;  2IYB A;  4HDO A;  4H8S A;  4KAX B;  5HE3 A;  4F7G A;  5D3W A;  2I1K A;  2HE7 A;  2K2U A;  2LUL A;  4HAX B;  2VSZ A;  4DBB A;  3PVW A;  1TQZ A;  1UNR A;  2MFQ A;  4PNK A;  4CHM A;  5LOP B;  4A6F A;  3TCA A;  4NSW A;  1X86 A;  1EF1 A;  5HE1 A;  1DDV A;  3U8Z A;  1BWN A;  2Y8F A;  1IRS A;  5DIF B;  2PZ1 A;  2EMS A;  1EAZ A;  1Z87 A;  3D8F A;  5DH9 B;  2ELA A;  2M38 A;  1MAI A;  3FSS A;  1V5P A;  2CY5 A;  2K00 A;  3UZT A;  2R0D A;  4HAW B;  4HAV B;  1U29 A;  2KCJ A;  1XD4 A;  1UPQ A;  4WVF B;  1V5U A;  4MK0 A;  4GXB A;  4B6H A;  3DXD A;  2VRW B;  1GC6 A;  2P0H A;  4KHA A;  3DXC A;  1OY2 A;  1LB1 A;  1XR0 B;  1XKE A;  2GCL A;  3T06 A;  2EC1 A;  3ZDT A;  5CLL B;  3PEG A;  1FHX A;  2YS1 A;  1DDW A;  4IAP A;  4CHJ A;  3ODX A;  1SHC A;  1WG7 A;  2ROV A;  1NI2 A;  4F7H A;  1V89 A;  2Z0Q A;  2RVB B;  4EMO A;  1KZG A;  4TKN A;  3A8P A;  2DX1 A;  2QKM A;  4K2P A;  4CYE A;  4HB2 B;  4A5K A;  2CRF A;  1KI1 B;  1U2B A;  3AJ4 A;  3TO1 A;  5C5B B;  5J3Y A;  2MKR A;  2YT1 A;  2VKI A;  2YS3 A;  4DXA B;  1WGU A;  1ZC3 B;  3V5W A;  1H4R A;  1FGZ A;  2P8V A;  1FGY A;  1ZC4 B;  1NU2 A;  2DKQ A;  3CXB B;  4WSF A;  3PSC A;  2COA A;  1MK7 B;  2JP2 A;  4IOY X;  4HAT B;  2D10 A;  2R09 A;  1UNP A;  2LG1 A;  1DBH A;  2M14 A;  5FI0 A;  2J0J A;  4KHB B;  1B55 A;  1W1G A;  1NTV A;  5D3Y A;  2I1J A;  5KQ4 A;  4C0A A;  2W2X D;  3G9W A;  1UEF A;  3KZ1 A;  1M7R A;  4K81 A;  3PG7 A;  2D9Y A;  1PFJ A;  5L81 A;  2G35 A;  2OTX A;  2NMB A;  2HTH B;  5D27 A;  1P5T A;  5C16 A;  2DHJ A;  1OQN A;  3HW2 B;  1TJ6 A;  2XQN M;  4IFS A;  2DX5 A;  3HQC A;  1FB8 A;  1BAK A;  2KUP A;  4NY0 A;  4HAU B;  2X18 A;  4HB4 B;  5HE0 A;  5KCV A;  5GOW B;  3KRW A;  3F0W A;  2LOZ A;  4YON A;  2LKO A;  2D9Z A;  4HAZ B;  3PVU A;  2CY4 A;  2D9V A;  1FOE A;  2AEH A;  3WYF B;  3GYO A;  4A6K A;  1ISN A;  2W2X C;  1PLS A;  1V88 A;  3A98 B;  1I7A A;  3AU4 A;  3ODW A;  1DRO A;  2RLO A;  1W1H A;  2MWN B;  1KZ7 A;  1XCG A;  3NSU A;  1WJ1 A;  4MT7 A;  2YT0 A;  5LON B;  4A6F B;  2D9X A;  1DDM A;  4GMV A;  5C79 A;  4K17 A;  5FI1 A;  2Z0P A; 
#chains in the Genus database with same CATH topology
 2MDX A;  3VIA A;  1GG3 A;  3DXE A;  3PP2 A;  3QWM A;  2D2Q A;  2GCJ A;  3KY9 A;  3QBV B;  4A6H A;  3RCP A;  1J19 A;  2DN6 A;  4DX8 A;  1BTN A;  1ZSQ A;  3BJI A;  2FJU B;  4Z2N A;  3ZVR A;  3PVL A;  2K2J A;  3OAN A;  2Q13 A;  1MIZ B;  2E2X A;  4GPT B;  3A8Q A;  1MK9 B;  3HK0 A;  4ZRI A;  4Z2M B;  2IFS A;  3LJU X;  3TFM A;  4KHO A;  1SGH A;  5EFX A;  3SUZ A;  3GYP A;  1WJM A;  3AU5 A;  2R2Y A;  2DLW A;  3X23 A;  1FAO A;  3D8D A;  3N7C A;  1RRP B;  3MPX A;  2Y8G A;  4KVG B;  3B77 A;  2QKL A;  5DHF B;  3MDB C;  1Y19 B;  2Z13 A;  2D4Q A;  2EMT A;  2N0Y A;  4D0N B;  3BIN A;  3F5R A;  1BTK A;  2ELB A;  1QC6 A;  5HE2 A;  2DA0 A;  5C6R A;  2P0D A;  1XOD A;  1MKE A;  1ZVR A;  4XWX A;  4ZRJ A;  1K5G B;  2J59 M;  2RUK B;  3FM8 C;  1UNQ A;  2RGN B;  1X11 A;  2CAY A;  4DX9 0;  2V76 A;  2Y7B A;  2DFK A;  5DHA B;  1U5E A;  1WGQ A;  1GC7 A;  3P7Z A;  3IVF A;  3ODO A;  3QIJ A;  3ULB A;  1J0W A;  2GS0 A;  2UZR A;  3NWF A;  4PQ0 A;  4P7I A;  3HSA A;  2H7D A;  4TYZ A;  3ULC A;  4F7U P;  4MY6 A;  2OQB A;  1Y5O A;  1U5D A;  4EKU A;  3VOQ A;  2ADZ A;  5CLQ B;  5J3Q A;  1EVH A;  2GJY A;  1MPH A;  2Z4D A;  1I2H A;  4WJ7 A;  2YT2 A;  5KQ1 A;  5JHG A;  3TW1 A;  2DKP A;  1RJ2 A;  1MI1 A;  2J0K A;  5C5B A;  4HHV A;  1MIX A;  4L6E A;  4HB0 B;  2LOX A;  3KRX A;  1U27 A;  2D11 A;  5J3T A;  4GMX B;  2YS5 A;  1X05 A;  2YSZ A;  3M1I B;  5JP4 A;  1M7E A;  1PMS A;  2ROZ B;  5DI9 B;  1X1F A;  1XX0 A;  3SV1 A;  1E5W A;  2YF0 A;  2N23 A;  1W1D A;  4GOU A;  2COF A;  2YRY A;  4EJN A;  1U5F A;  1X1G A;  2RSG A;  2EJ8 A;  3NW8 A;  3KSY A;  1T77 A;  2L1C A;  2ZKM X;  2ZPY A;  1DYN A;  2RNR B;  3D8E A;  1AWE A;  4KHB A;  4HAY B;  1FHO A;  1K5D B;  2DHI A;  2UVM A;  2NBV A;  3OHM B;  2COD A;  3SO6 A;  1TXD A;  3WA0 A;  2GUM A;  1UPR A;  4GZU A;  3U7D A;  5JHH A;  2KIG A;  3CIK A;  4L1R A;  1QQG A;  2UZS A;  3NWA A;  4HB3 B;  2AL6 A;  4YL8 A;  2DHK A;  4GNK B;  2Z0O A;  2I5C A;  1ZM0 A;  2W2W A;  2BCJ A;  1V61 A;  1LW3 A;  3PZD A;  1NTY A;  3SNH A;  1P6S A;  2DYQ A;  3SYX A;  2NZ8 B;  3HIE A;  2KGX B;  1AQC A;  5JLJ B;  2D9W A;  2L2I A;  3P6A A;  1WI1 A;  2COC A;  1OMW A;  2FJL A;  1N3H A;  4ZRK A;  1V5M A;  1WVH A;  5D3X A;  4BBK A;  2DTC A;  3FEH A;  1U5G A;  2J0M A;  4GN1 A;  1Q67 A;  3ML4 A;  2KR0 A;  3TVV A;  5D3V A;  2H7E A;  4HDQ A;  2YVC A;  2DYN A;  4K2O A;  4Y94 A;  2LYD A;  3O96 A;  2P0F A;  1H10 A;  2I5F A;  1FHW A;  1EGX A;  1P3R A;  2IYB A;  4HDO A;  4H8S A;  4KAX B;  5HE3 A;  4F7G A;  4QJ3 B;  3DCX A;  5D3W A;  2I1K A;  2HE7 A;  2K2U A;  2LUL A;  4HAX B;  2VSZ A;  4DBB A;  3PVW A;  1TQZ A;  1UNR A;  2MFQ A;  4PNK A;  4CHM A;  5LOP B;  4A6F A;  3TCA A;  4NSW A;  1X86 A;  1EF1 A;  5HE1 A;  1DDV A;  3U8Z A;  1BWN A;  2Y8F A;  1IRS A;  5DIF B;  2PZ1 A;  2EMS A;  1EAZ A;  1Z87 A;  3D8F A;  5DH9 B;  2ELA A;  2M38 A;  1MAI A;  3FSS A;  1V5P A;  2CY5 A;  2K00 A;  3UZT A;  2R0D A;  3U12 A;  4HAW B;  4HAV B;  1U29 A;  2KCJ A;  2RRF A;  1XD4 A;  1UPQ A;  4WVF B;  1V5U A;  4MK0 A;  4GXB A;  4B6H A;  3DXD A;  2VRW B;  1GC6 A;  2P0H A;  4KHA A;  3DXC A;  1OY2 A;  1LB1 A;  1XR0 B;  1XKE A;  2GCL A;  2KUQ A;  3T06 A;  2EC1 A;  3ZDT A;  5LG4 B;  5CLL B;  3PEG A;  2Z14 A;  1FHX A;  2YS1 A;  1DDW A;  4IAP A;  4CHJ A;  3ODX A;  5I2S A;  1SHC A;  1WG7 A;  2ROV A;  1NI2 A;  4OT1 A;  1V89 A;  4F7H A;  2Z0Q A;  2RVB B;  4EMO A;  1KZG A;  4TKN A;  3A8P A;  2DX1 A;  2QKM A;  4K2P A;  4CYE A;  4HB2 B;  4A5K A;  2CRF A;  1KI1 B;  1U2B A;  3AJ4 A;  3TO1 A;  5IRS A;  4QJ5 B;  5C5B B;  5J3Y A;  2MKR A;  2YT1 A;  2VKI A;  2YS3 A;  4DXA B;  2K49 A;  1WGU A;  1ZC3 B;  3V5W A;  1H4R A;  3FVC A;  1FGZ A;  1ZYI A;  2P8V A;  1FGY A;  1ZC4 B;  1NU2 A;  2DKQ A;  3CXB B;  4WSF A;  3PSC A;  2COA A;  1MK7 B;  2JP2 A;  4IOY X;  4HAT B;  2D10 A;  2R09 A;  1UNP A;  2LG1 A;  5I2M A;  1DBH A;  2M14 A;  5FI0 A;  2J0J A;  4KHB B;  1B55 A;  1W1G A;  1NTV A;  5D3Y A;  2I1J A;  5KQ4 A;  4C0A A;  2W2X D;  3G9W A;  4D6W A;  5M4Y B;  1UEF A;  3KZ1 A;  1M7R A;  4K81 A;  3PG7 A;  2D9Y A;  1PFJ A;  5L81 A;  2G35 A;  2OTX A;  2NMB A;  2HTH B;  5D27 A;  4DIX A;  1P5T A;  5C16 A;  2DHJ A;  1OQN A;  3HW2 B;  1TJ6 A;  2XQN M;  4IFS A;  2DX5 A;  4CSQ A;  3HQC A;  1FB8 A;  1BAK A;  2KUP A;  4NY0 A;  2Z59 A;  4HSI A;  4HAU B;  2X18 A;  4HB4 B;  4OSN A;  5HE0 A;  5KCV A;  5GOW B;  3KRW A;  3F0W A;  2LOZ A;  4YON A;  2LKO A;  2D9Z A;  4HAZ B;  3NWD A;  3PVU A;  2CY4 A;  2D9V A;  1FOE A;  2AEH A;  3WYF B;  3GYO A;  4A6K A;  1ISN A;  4QJ4 B;  2W2X C;  1PLS A;  3A58 A;  4QXA B;  1V88 A;  3A98 B;  1I7A A;  3AU4 A;  3ODW A;  1DRO A;  2RLO A;  1W1H A;  2MWN B;  1KZ7 A;  1XCG A;  3NSU A;  1WJ1 A;  4MT7 A;  2YT0 A;  5LON B;  4A6F B;  2D9X A;  1DDM A;  4GMV A;  5C79 A;  4K17 A;  2K8E A;  2KIE A;  5FI1 A;  2Z0P A; 
#chains in the Genus database with same CATH homology
 2MDX A;  3VIA A;  1GG3 A;  3DXE A;  3PP2 A;  3QWM A;  2D2Q A;  2GCJ A;  3KY9 A;  3QBV B;  4A6H A;  3RCP A;  1J19 A;  2DN6 A;  4DX8 A;  1BTN A;  1ZSQ A;  3BJI A;  4Z2N A;  3ZVR A;  3PVL A;  2K2J A;  3OAN A;  2Q13 A;  1MIZ B;  2E2X A;  4GPT B;  3A8Q A;  1MK9 B;  3HK0 A;  4ZRI A;  4Z2M B;  2IFS A;  3LJU X;  3TFM A;  4KHO A;  1SGH A;  5EFX A;  3SUZ A;  3GYP A;  1WJM A;  3AU5 A;  2DLW A;  3X23 A;  1FAO A;  3D8D A;  3N7C A;  1RRP B;  3MPX A;  2Y8G A;  4KVG B;  2QKL A;  5DHF B;  3MDB C;  1Y19 B;  2D4Q A;  2EMT A;  2N0Y A;  4D0N B;  3BIN A;  3F5R A;  1BTK A;  2ELB A;  1QC6 A;  5HE2 A;  2DA0 A;  5C6R A;  2P0D A;  1XOD A;  1MKE A;  1ZVR A;  4XWX A;  4ZRJ A;  1K5G B;  2J59 M;  2RUK B;  3FM8 C;  1UNQ A;  2RGN B;  1X11 A;  2CAY A;  4DX9 0;  2V76 A;  2Y7B A;  2DFK A;  5DHA B;  1U5E A;  1WGQ A;  1GC7 A;  3P7Z A;  3IVF A;  3ODO A;  3QIJ A;  3ULB A;  1J0W A;  2GS0 A;  2UZR A;  4PQ0 A;  4P7I A;  2H7D A;  4TYZ A;  3ULC A;  4F7U P;  4MY6 A;  2OQB A;  1Y5O A;  1U5D A;  4EKU A;  3VOQ A;  2ADZ A;  5CLQ B;  5J3Q A;  1EVH A;  2GJY A;  1MPH A;  1I2H A;  4WJ7 A;  5KQ1 A;  5JHG A;  3TW1 A;  2DKP A;  1RJ2 A;  2J0K A;  5C5B A;  4HHV A;  1MIX A;  4L6E A;  4HB0 B;  2LOX A;  3KRX A;  1U27 A;  2D11 A;  5J3T A;  4GMX B;  2YS5 A;  1X05 A;  2YSZ A;  3M1I B;  5JP4 A;  1M7E A;  1PMS A;  2ROZ B;  5DI9 B;  1X1F A;  1XX0 A;  3SV1 A;  1E5W A;  2YF0 A;  2N23 A;  1W1D A;  2COF A;  2YRY A;  4EJN A;  1U5F A;  1X1G A;  2RSG A;  2EJ8 A;  3KSY A;  2L1C A;  2ZPY A;  1DYN A;  2RNR B;  3D8E A;  1AWE A;  4HAY B;  1FHO A;  1K5D B;  2DHI A;  2UVM A;  2COD A;  3SO6 A;  1TXD A;  3WA0 A;  4GZU A;  1UPR A;  3U7D A;  5JHH A;  3CIK A;  1QQG A;  2UZS A;  4HB3 B;  2AL6 A;  4YL8 A;  2DHK A;  2Z0O A;  2I5C A;  1ZM0 A;  2W2W A;  2BCJ A;  1V61 A;  1LW3 A;  3PZD A;  1NTY A;  3SNH A;  1P6S A;  2DYQ A;  3SYX A;  2NZ8 B;  2KGX B;  1AQC A;  5JLJ B;  2D9W A;  3P6A A;  2L2I A;  1WI1 A;  2COC A;  1OMW A;  2FJL A;  1N3H A;  4ZRK A;  1V5M A;  1WVH A;  5D3X A;  4BBK A;  2DTC A;  3FEH A;  1U5G A;  2J0M A;  4GN1 A;  1Q67 A;  3ML4 A;  3TVV A;  5D3V A;  2H7E A;  4HDQ A;  2YVC A;  2DYN A;  4K2O A;  4Y94 A;  2LYD A;  3O96 A;  2P0F A;  1H10 A;  2I5F A;  1FHW A;  1EGX A;  1P3R A;  2IYB A;  4HDO A;  4H8S A;  4KAX B;  5HE3 A;  4F7G A;  5D3W A;  2I1K A;  2HE7 A;  2K2U A;  2LUL A;  4HAX B;  2VSZ A;  4DBB A;  3PVW A;  1TQZ A;  1UNR A;  2MFQ A;  4PNK A;  4CHM A;  5LOP B;  4A6F A;  3TCA A;  4NSW A;  1X86 A;  1EF1 A;  5HE1 A;  1DDV A;  3U8Z A;  1BWN A;  2Y8F A;  1IRS A;  5DIF B;  2PZ1 A;  2EMS A;  1EAZ A;  1Z87 A;  3D8F A;  5DH9 B;  2ELA A;  2M38 A;  1MAI A;  3FSS A;  1V5P A;  2CY5 A;  2K00 A;  3UZT A;  2R0D A;  4HAW B;  4HAV B;  1U29 A;  2KCJ A;  1XD4 A;  1UPQ A;  4WVF B;  1V5U A;  4MK0 A;  4GXB A;  4B6H A;  3DXD A;  2VRW B;  1GC6 A;  2P0H A;  4KHA A;  3DXC A;  1OY2 A;  1LB1 A;  1XR0 B;  1XKE A;  2GCL A;  3T06 A;  2EC1 A;  3ZDT A;  5CLL B;  3PEG A;  1FHX A;  2YS1 A;  1DDW A;  4IAP A;  4CHJ A;  3ODX A;  1SHC A;  1WG7 A;  2ROV A;  1NI2 A;  4F7H A;  1V89 A;  2Z0Q A;  2RVB B;  4EMO A;  1KZG A;  4TKN A;  3A8P A;  2DX1 A;  2QKM A;  4K2P A;  4CYE A;  4HB2 B;  4A5K A;  2CRF A;  1KI1 B;  1U2B A;  3AJ4 A;  3TO1 A;  5C5B B;  5J3Y A;  2MKR A;  2YT1 A;  2VKI A;  2YS3 A;  4DXA B;  1WGU A;  1ZC3 B;  3V5W A;  1H4R A;  1FGZ A;  2P8V A;  1FGY A;  1ZC4 B;  1NU2 A;  2DKQ A;  3CXB B;  4WSF A;  3PSC A;  2COA A;  1MK7 B;  2JP2 A;  4IOY X;  4HAT B;  2D10 A;  2R09 A;  1UNP A;  2LG1 A;  1DBH A;  2M14 A;  5FI0 A;  2J0J A;  4KHB B;  1B55 A;  1W1G A;  1NTV A;  5D3Y A;  2I1J A;  5KQ4 A;  4C0A A;  2W2X D;  3G9W A;  1UEF A;  3KZ1 A;  1M7R A;  4K81 A;  3PG7 A;  2D9Y A;  1PFJ A;  5L81 A;  2G35 A;  2OTX A;  2NMB A;  2HTH B;  5D27 A;  1P5T A;  5C16 A;  2DHJ A;  1OQN A;  3HW2 B;  1TJ6 A;  2XQN M;  4IFS A;  2DX5 A;  3HQC A;  1FB8 A;  1BAK A;  2KUP A;  4NY0 A;  4HAU B;  2X18 A;  4HB4 B;  5HE0 A;  5KCV A;  5GOW B;  3KRW A;  3F0W A;  2LOZ A;  4YON A;  2LKO A;  2D9Z A;  4HAZ B;  3PVU A;  2CY4 A;  2D9V A;  1FOE A;  2AEH A;  3WYF B;  3GYO A;  4A6K A;  1ISN A;  2W2X C;  1PLS A;  1V88 A;  3A98 B;  1I7A A;  3AU4 A;  3ODW A;  1DRO A;  2RLO A;  1W1H A;  2MWN B;  1KZ7 A;  1XCG A;  3NSU A;  1WJ1 A;  4MT7 A;  2YT0 A;  5LON B;  4A6F B;  2D9X A;  1DDM A;  4GMV A;  5C79 A;  4K17 A;  5FI1 A;  2Z0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...