2D9VA

Solution structure of the ph domain of pleckstrin homology domain-containing protein family b member 1 from mouse
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
130
structure length
130
Chain Sequence
b'GSSGSSGLVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVVIHFNVRDIKVGQECQDVQPPEGRSRDGLLTVNLREGSRLHLCAETRDDAIAWKTALMEANSTPAPAGATVPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing protein family B membe
publication title Solution structure of the PH domain of Pleckstrin homology domain-containing protein family B member 1 from mouse
rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 19
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9vA01
4ZRJA 2DHIA 1W1GA 3MDBC 3QIJA 3AJ4A 3PVWA 2IYBA 4Z2NA 2DKPA 1FAOA 2H7EA 4K2OA 2D4QA 3VIAA 3PVUA 1LW3A 5FI0A 1UNPA 2E2XA 2X18A 4DXAB 2R0DA 3FEHA 2LYDA 3ODOA 4TKNA 4IOYX 2P8VA 2R09A 1KZGA 4IAPA 1PFJA 1B55A 1DBHA 5DHFB 3SO6A 1ZSQA 1ZVRA 2DFKA 1MK7B 5DIFB 1FHOA 2Y7BA 4NY0A 5KQ1A 2J0KA 1IRSA 1AQCA 3SYXA 4KHAA 1XR0B 3U8ZA 3PSCA 1J0WA 4ZRIA 2L1CA 4HAZB 2RVBB 2CODA 5J3YA 5C6RA 2EC1A 4Z2MB 4GN1A 5HE1A 4BBKA 1P5TA 2DKQA 4DBBA 4HB3B 3FSSA 1V88A 2OQBA 1U5GA 2COCA 1TQZA 3A8QA 2K00A 2HE7A 4F7UP 1K5DB 1XX0A 1U29A 3A98B 1QQGA 2BCJA 2COFA 2YF0A 2XQNM 5FI1A 2LOXA 1OY2A 1U2BA 2MKRA 1WGUA 4ZRKA 3ODWA 2Y8GA 3PZDA 3ODXA 2I5FA 1U5FA 4KAXB 2N0YA 2J59M 4DX90 1MPHA 2DYQA 4A6KA 1TJ6A 5JLJB 1UNQA 2EMSA 2NMBA 1V5PA 3T06A 2ELBA 2D10A 2YSZA 1AWEA 1Y5OA 2DX1A 2ROZB 2VKIA 1DYNA 3A8PA 4DX8A 2W2XC 2UVMA 5KQ4A 1GC7A 2MFQA 5D3XA 1Q67A 4XWXA 1DDMA 5HE0A 5C5BA 2I1KA 5JP4A 4GMXB 3TCAA 1WG7A 4HAUB 4HB2B 1J19A 3D8EA 5DH9B 1P3RA 3BINA 3KRWA 1SHCA 1MIXA 1XD4A 2Z0QA 4HDQA 2M14A 2DA0A 4NSWA 5GOWB 2D2QA 2D9ZA 1XCGA 1UNRA 1W1HA 2DN6A 1DROA 2GJYA 1EAZA 1U27A 1X1FA 3WA0A 2EJ8A 1GG3A 3G9WA 3AU4A 4KHBB 5D3VA 4B6HA 4L6EA 4EKUA 2COAA 4HB4B 1UPRA 2G35A 2GCLA 2YS3A 2D9YA 3GYOA 3D8FA 4HATB 4H8SA 1H10A 2AEHA 5HE3A 4A6HA 1ISNA 1EF1A 2MWNB 4A6FB 2J0MA 2UZSA 4HAYB 4PNKA 5D3WA 5C79A 1V89A 1KI1B 2Z0PA 1X11A 2DHJA 1U5DA 3TVVA 1WI1A 1MKEA 1XKEA 2W2WA 5KCVA 3QBVB 3IVFA 1V61A 3O96A 3SV1A 2K2JA 1EVHA 2YT0A 5EFXA 2YS5A 1FHXA 3NSUA 2ROVA 3TFMA 2AL6A 4F7GA 3WYFB 2CY5A 3U7DA 1FB8A 3MPXA 1RRPB 4D0NB 1X1GA 4MY6A 4YONA 4C0AA 1Y19B 2KCJA 4GZUA 4WSFA 2Q13A 3PP2A 1M7EA 2GS0A 2KUPA 2PZ1A 3M1IB 1K5GB 1WVHA 3DXDA 2DLWA 3ZDTA 1DDWA 2M38A 4F7HA 2P0HA 4HDOA 3P7ZA 2V76A 1MAIA 2NZ8B 2K2UA 3GYPA 2D9WA 1MIZB 2OTXA 3HQCA 2JP2A 2RNRB 5CLQB 3HW2B 3PEGA 1KZ7A 1I7AA 3AU5A 3PVLA 4CHJA 1NI2A 4CHMA 3PG7A 1PLSA 2P0FA 4KHOA 1W1DA 2L2IA 1FGZA 4HAXB 1EGXA 2YRYA 1X05A 4KVGB 3N7CA 2Z0OA 4P7IA 3D8DA 2DTCA 2YT1A 3ULCA 2VRWB 2YS1A 1SGHA 3F0WA 1OQNA 4GMVA 3QWMA 4EJNA 2D9VA 4MK0A 4IFSA 5C16A 2D11A 2GCJA 2VSZA 3ULBA 5J3QA 1NTYA 1OMWA 1BWNA 2EMTA 2I1JA 1WJMA 1FGYA 1UEFA 2UZRA 4YL8A 1M7RA 3KZ1A 2ZPYA 2KGXB 3ML4A 1RJ2A 1E5WA 3UZTA 4GPTB 3VOQA 5CLLB 1P6SA 2QKLA 5HE2A 2HTHB 2DYNA 2QKMA 2Y8FA 3KRXA 4HAWB 4PQ0A 4WJ7A 1U5EA 1V5UA 1BAKA 2J0JA 1ZC3B 2LKOA 5L81A 2LULA 5LOPB 3BJIA 1BTKA 1QC6A 2DHKA 1WJ1A 3OANA 4HHVA 4K2PA 3DXEA 1FOEA 3FM8C 4HAVB 3RCPA 2MDXA 5DHAB 5J3TA 3KSYA 4K81A 3TW1A 3DXCA 1NTVA 1X86A 1NU2A 2CRFA 1BTNA 4A6FA 1WGQA 1ZM0A 1LB1A 2N23A 2I5CA 2RLOA 1Z87A 3SNHA 1I2HA 2ELAA 4CYEA 4Y94A 4TYZA 1FHWA 2CAYA 2LOZA 1TXDA 5LONB 2IFSA 3P6AA 3F5RA 3CIKA 2FJLA 3LJUX 1XODA 2CY4A 2P0DA 2DX5A 3CXBB 5D27A 2H7DA 5D3YA 2ADZA 4EMOA 4A5KA 2YVCA 3TO1A 1H4RA 1PMSA 3KY9A 2RSGA 5C5BB 5JHGA 4MT7A 2W2XD 1V5MA 2RUKB 1N3HA 3ZVRA 1MK9B 3SUZA 3X23A 1DDVA 2D9XA 1ZC4B 4GXBA 2RGNB 5DI9B 3HK0A 4HB0B 3V5WA 2LG1A 1UPQA 4K17A 5JHHA 4WVFB 1GC6A
chains in the Genus database with same CATH superfamily
4ZRJA 2DHIA 1W1GA 3MDBC 3QIJA 3AJ4A 3PVWA 2IYBA 4Z2NA 2DKPA 1FAOA 2H7EA 4K2OA 2D4QA 3VIAA 3PVUA 1LW3A 5FI0A 1UNPA 2E2XA 2X18A 4DXAB 2R0DA 3FEHA 2LYDA 3ODOA 4TKNA 4IOYX 2P8VA 2R09A 1KZGA 4IAPA 1PFJA 1B55A 1DBHA 5DHFB 3SO6A 1ZSQA 1ZVRA 2DFKA 1MK7B 5DIFB 1FHOA 2Y7BA 4NY0A 5KQ1A 2J0KA 1IRSA 1AQCA 3SYXA 2KIGA 3B77A 4KHAA 1XR0B 3U8ZA 3PSCA 1J0WA 1ZYIA 4ZRIA 2L1CA 4HAZB 2RVBB 2CODA 5J3YA 5C6RA 2EC1A 4Z2MB 2YT2A 4GN1A 5HE1A 4BBKA 2FJUB 1P5TA 2DKQA 4DBBA 4HB3B 3FSSA 1V88A 2OQBA 1U5GA 2COCA 1TQZA 3A8QA 2K8EA 2K00A 2HE7A 4F7UP 4DIXA 1K5DB 5I2MA 4HSIA 3HIEA 1XX0A 1U29A 3A98B 1QQGA 2BCJA 2COFA 2YF0A 2XQNM 5FI1A 2LOXA 1OY2A 1MI1A 1U2BA 2MKRA 1WGUA 4ZRKA 3ODWA 5IRSA 2Y8GA 2Z13A 3PZDA 3ODXA 2I5FA 3NWFA 1U5FA 4KAXB 2N0YA 2J59M 4DX90 1MPHA 2DYQA 4A6KA 1TJ6A 5JLJB 1UNQA 2EMSA 2NMBA 1V5PA 3T06A 2ELBA 2D10A 2YSZA 1AWEA 1Y5OA 2DX1A 2ROZB 2VKIA 4QJ3B 4QJ4B 1DYNA 3A8PA 4DX8A 2W2XC 2UVMA 5KQ4A 1GC7A 2MFQA 5D3XA 1Q67A 4XWXA 1DDMA 5HE0A 5C5BA 2I1KA 5JP4A 4GMXB 3TCAA 5LG4B 1WG7A 4HAUB 4HB2B 1J19A 3D8EA 5DH9B 1P3RA 3BINA 3KRWA 1SHCA 1MIXA 1XD4A 2Z0QA 4HDQA 2ZKMX 2M14A 3NWAA 2DA0A 4NSWA 5GOWB 2D2QA 2D9ZA 1XCGA 4QJ5B 1UNRA 1W1HA 2DN6A 4OSNA 1DROA 2GJYA 1EAZA 1U27A 1X1FA 2KR0A 5I2SA 3WA0A 4QXAB 3NW8A 2EJ8A 1GG3A 3G9WA 3AU4A 4KHBB 5D3VA 4B6HA 4L6EA 4EKUA 2COAA 4HB4B 1UPRA 2G35A 2GCLA 2YS3A 2D9YA 3GYOA 3D8FA 4HATB 4H8SA 1H10A 2Z59A 2AEHA 5HE3A 4A6HA 1ISNA 1EF1A 2MWNB 4A6FB 2J0MA 2UZSA 4HAYB 4PNKA 5D3WA 5C79A 1V89A 1KI1B 2Z0PA 1X11A 2DHJA 1U5DA 3OHMB 3TVVA 1WI1A 1MKEA 1XKEA 2W2WA 5KCVA 3QBVB 3IVFA 1V61A 3O96A 3SV1A 2K2JA 1EVHA 2YT0A 5EFXA 2YS5A 1FHXA 3NSUA 2ROVA 3U12A 3TFMA 2Z14A 4OT1A 2AL6A 4F7GA 3WYFB 2CY5A 3U7DA 1FB8A 3MPXA 1RRPB 4D0NB 1X1GA 4MY6A 4YONA 4C0AA 1Y19B 2KCJA 4GZUA 4WSFA 2Q13A 3PP2A 1M7EA 2GS0A 2KUPA 2PZ1A 3M1IB 1K5GB 1WVHA 3DXDA 2DLWA 3ZDTA 1DDWA 2M38A 4F7HA 2P0HA 4HDOA 3P7ZA 2V76A 1MAIA 2NZ8B 2K2UA 3GYPA 2D9WA 3DCXA 1MIZB 3HQCA 2OTXA 2JP2A 2RNRB 5CLQB 3HW2B 3PEGA 1KZ7A 1I7AA 3AU5A 3PVLA 4CHJA 1NI2A 4CHMA 3PG7A 1PLSA 2P0FA 4KHOA 1W1DA 2L2IA 1FGZA 3FVCA 4HAXB 1EGXA 2YRYA 1X05A 4KVGB 3N7CA 2Z0OA 4P7IA 3D8DA 2DTCA 2YT1A 3ULCA 2VRWB 2YS1A 1SGHA 2KIEA 3F0WA 1OQNA 4GMVA 3QWMA 4EJNA 1T77A 2GUMA 2D9VA 3HSAA 4MK0A 4IFSA 5C16A 2D11A 2GCJA 2VSZA 3ULBA 5J3QA 1NTYA 1OMWA 1BWNA 2R2YA 2EMTA 2I1JA 1WJMA 1FGYA 1UEFA 2UZRA 4YL8A 1M7RA 3KZ1A 2ZPYA 2KGXB 3ML4A 1RJ2A 1E5WA 3UZTA 4GPTB 3VOQA 5CLLB 1P6SA 2QKLA 5HE2A 2HTHB 2DYNA 2QKMA 2Y8FA 3KRXA 4HAWB 4PQ0A 4WJ7A 1U5EA 1V5UA 1BAKA 2J0JA 1ZC3B 2LKOA 5L81A 2LULA 5LOPB 3BJIA 1BTKA 1QC6A 2DHKA 1WJ1A 3OANA 4HHVA 4K2PA 3DXEA 4KHBA 1FOEA 3FM8C 3A58A 4HAVB 3RCPA 2MDXA 5DHAB 5J3TA 2KUQA 3KSYA 4K81A 3TW1A 3DXCA 1NTVA 1X86A 1NU2A 2CRFA 1BTNA 4A6FA 1WGQA 1ZM0A 1LB1A 2N23A 2I5CA 2RLOA 1Z87A 3SNHA 1I2HA 2ELAA 4GNKB 4CYEA 4Y94A 4TYZA 4D6WA 1FHWA 2CAYA 2NBVA 2LOZA 5M4YB 1TXDA 5LONB 2IFSA 3P6AA 3F5RA 3CIKA 2FJLA 3LJUX 1XODA 2CY4A 2Z4DA 2P0DA 2DX5A 3CXBB 5D27A 2H7DA 5D3YA 2ADZA 3NWDA 4EMOA 4A5KA 2YVCA 3TO1A 1H4RA 1PMSA 3KY9A 2RSGA 5C5BB 5JHGA 4MT7A 2W2XD 4CSQA 1V5MA 2RUKB 1N3HA 3ZVRA 1MK9B 3SUZA 2RRFA 3X23A 1DDVA 2D9XA 1ZC4B 4GXBA 2RGNB 4L1RA 5DI9B 3HK0A 4HB0B 3V5WA 2LG1A 1UPQA 4GOUA 2K49A 4K17A 5JHHA 4WVFB 1GC6A
chains in the Genus database with same CATH topology
4ZRJA 2DHIA 1W1GA 3MDBC 3QIJA 3AJ4A 3PVWA 2IYBA 4Z2NA 2DKPA 1FAOA 2H7EA 4K2OA 2D4QA 3VIAA 3PVUA 1LW3A 5FI0A 1UNPA 2E2XA 2X18A 4DXAB 2R0DA 3FEHA 2LYDA 3ODOA 4TKNA 4IOYX 2P8VA 2R09A 1KZGA 4IAPA 1PFJA 1B55A 1DBHA 5DHFB 3SO6A 1ZSQA 1ZVRA 2DFKA 1MK7B 5DIFB 1FHOA 2Y7BA 4NY0A 5KQ1A 2J0KA 1IRSA 1AQCA 3SYXA 4KHAA 1XR0B 3U8ZA 3PSCA 1J0WA 4ZRIA 2L1CA 4HAZB 2RVBB 2CODA 5J3YA 5C6RA 2EC1A 4Z2MB 4GN1A 5HE1A 4BBKA 1P5TA 2DKQA 4DBBA 4HB3B 3FSSA 1V88A 2OQBA 1U5GA 2COCA 1TQZA 3A8QA 2K00A 2HE7A 4F7UP 1K5DB 1XX0A 1U29A 3A98B 1QQGA 2BCJA 2COFA 2YF0A 2XQNM 5FI1A 2LOXA 1OY2A 1U2BA 2MKRA 1WGUA 4ZRKA 3ODWA 2Y8GA 3PZDA 3ODXA 2I5FA 1U5FA 4KAXB 2N0YA 2J59M 4DX90 1MPHA 2DYQA 4A6KA 1TJ6A 5JLJB 1UNQA 2EMSA 2NMBA 1V5PA 3T06A 2ELBA 2D10A 2YSZA 1AWEA 1Y5OA 2DX1A 2ROZB 2VKIA 1DYNA 3A8PA 4DX8A 2W2XC 2UVMA 5KQ4A 1GC7A 2MFQA 5D3XA 1Q67A 4XWXA 1DDMA 5HE0A 5C5BA 2I1KA 5JP4A 4GMXB 3TCAA 1WG7A 4HAUB 4HB2B 1J19A 3D8EA 5DH9B 1P3RA 3BINA 3KRWA 1SHCA 1MIXA 1XD4A 2Z0QA 4HDQA 2M14A 2DA0A 4NSWA 5GOWB 2D2QA 2D9ZA 1XCGA 1UNRA 1W1HA 2DN6A 1DROA 2GJYA 1EAZA 1U27A 1X1FA 3WA0A 2EJ8A 1GG3A 3G9WA 3AU4A 4KHBB 5D3VA 4B6HA 4L6EA 4EKUA 2COAA 4HB4B 1UPRA 2G35A 2GCLA 2YS3A 2D9YA 3GYOA 3D8FA 4HATB 4H8SA 1H10A 2AEHA 5HE3A 4A6HA 1ISNA 1EF1A 2MWNB 4A6FB 2J0MA 2UZSA 4HAYB 4PNKA 5D3WA 5C79A 1V89A 1KI1B 2Z0PA 1X11A 2DHJA 1U5DA 3TVVA 1WI1A 1MKEA 1XKEA 2W2WA 5KCVA 3QBVB 3IVFA 1V61A 3O96A 3SV1A 2K2JA 1EVHA 2YT0A 5EFXA 2YS5A 1FHXA 3NSUA 2ROVA 3TFMA 2AL6A 4F7GA 3WYFB 2CY5A 3U7DA 1FB8A 3MPXA 1RRPB 4D0NB 1X1GA 4MY6A 4YONA 4C0AA 1Y19B 2KCJA 4GZUA 4WSFA 2Q13A 3PP2A 1M7EA 2GS0A 2KUPA 2PZ1A 3M1IB 1K5GB 1WVHA 3DXDA 2DLWA 3ZDTA 1DDWA 2M38A 4F7HA 2P0HA 4HDOA 3P7ZA 2V76A 1MAIA 2NZ8B 2K2UA 3GYPA 2D9WA 1MIZB 2OTXA 3HQCA 2JP2A 2RNRB 5CLQB 3HW2B 3PEGA 1KZ7A 1I7AA 3AU5A 3PVLA 4CHJA 1NI2A 4CHMA 3PG7A 1PLSA 2P0FA 4KHOA 1W1DA 2L2IA 1FGZA 4HAXB 1EGXA 2YRYA 1X05A 4KVGB 3N7CA 2Z0OA 4P7IA 3D8DA 2DTCA 2YT1A 3ULCA 2VRWB 2YS1A 1SGHA 3F0WA 1OQNA 4GMVA 3QWMA 4EJNA 2D9VA 4MK0A 4IFSA 5C16A 2D11A 2GCJA 2VSZA 3ULBA 5J3QA 1NTYA 1OMWA 1BWNA 2EMTA 2I1JA 1WJMA 1FGYA 1UEFA 2UZRA 4YL8A 1M7RA 3KZ1A 2ZPYA 2KGXB 3ML4A 1RJ2A 1E5WA 3UZTA 4GPTB 3VOQA 5CLLB 1P6SA 2QKLA 5HE2A 2HTHB 2DYNA 2QKMA 2Y8FA 3KRXA 4HAWB 4PQ0A 4WJ7A 1U5EA 1V5UA 1BAKA 2J0JA 1ZC3B 2LKOA 5L81A 2LULA 5LOPB 3BJIA 1BTKA 1QC6A 2DHKA 1WJ1A 3OANA 4HHVA 4K2PA 3DXEA 1FOEA 3FM8C 4HAVB 3RCPA 2MDXA 5DHAB 5J3TA 3KSYA 4K81A 3TW1A 3DXCA 1NTVA 1X86A 1NU2A 2CRFA 1BTNA 4A6FA 1WGQA 1ZM0A 1LB1A 2N23A 2I5CA 2RLOA 1Z87A 3SNHA 1I2HA 2ELAA 4CYEA 4Y94A 4TYZA 1FHWA 2CAYA 2LOZA 1TXDA 5LONB 2IFSA 3P6AA 3F5RA 3CIKA 2FJLA 3LJUX 1XODA 2CY4A 2P0DA 2DX5A 3CXBB 5D27A 2H7DA 5D3YA 2ADZA 4EMOA 4A5KA 2YVCA 3TO1A 1H4RA 1PMSA 3KY9A 2RSGA 5C5BB 5JHGA 4MT7A 2W2XD 1V5MA 2RUKB 1N3HA 3ZVRA 1MK9B 3SUZA 3X23A 1DDVA 2D9XA 1ZC4B 4GXBA 2RGNB 5DI9B 3HK0A 4HB0B 3V5WA 2LG1A 1UPQA 4K17A 5JHHA 4WVFB 1GC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRJ A;  2DHI A;  1W1G A;  3MDB C;  3QIJ A;  3AJ4 A;  3PVW A;  2IYB A;  4Z2N A;  2DKP A;  1FAO A;  2H7E A;  4K2O A;  2D4Q A;  3VIA A;  3PVU A;  1LW3 A;  5FI0 A;  1UNP A;  2E2X A;  2X18 A;  4DXA B;  2R0D A;  3FEH A;  2LYD A;  3ODO A;  4TKN A;  4IOY X;  2P8V A;  2R09 A;  1KZG A;  4IAP A;  1PFJ A;  1B55 A;  1DBH A;  5DHF B;  3SO6 A;  1ZSQ A;  1ZVR A;  2DFK A;  1MK7 B;  5DIF B;  1FHO A;  2Y7B A;  4NY0 A;  5KQ1 A;  2J0K A;  1IRS A;  1AQC A;  3SYX A;  4KHA A;  1XR0 B;  3U8Z A;  3PSC A;  1J0W A;  4ZRI A;  2L1C A;  4HAZ B;  2RVB B;  2COD A;  5J3Y A;  5C6R A;  2EC1 A;  4Z2M B;  4GN1 A;  5HE1 A;  4BBK A;  1P5T A;  2DKQ A;  4DBB A;  4HB3 B;  3FSS A;  1V88 A;  2OQB A;  1U5G A;  2COC A;  1TQZ A;  3A8Q A;  2K00 A;  2HE7 A;  4F7U P;  1K5D B;  1XX0 A;  1U29 A;  3A98 B;  1QQG A;  2BCJ A;  2COF A;  2YF0 A;  2XQN M;  5FI1 A;  2LOX A;  1OY2 A;  1U2B A;  2MKR A;  1WGU A;  4ZRK A;  3ODW A;  2Y8G A;  3PZD A;  3ODX A;  2I5F A;  1U5F A;  4KAX B;  2N0Y A;  2J59 M;  4DX9 0;  1MPH A;  2DYQ A;  4A6K A;  1TJ6 A;  5JLJ B;  1UNQ A;  2EMS A;  2NMB A;  1V5P A;  3T06 A;  2ELB A;  2D10 A;  2YSZ A;  1AWE A;  1Y5O A;  2DX1 A;  2ROZ B;  2VKI A;  1DYN A;  3A8P A;  4DX8 A;  2W2X C;  2UVM A;  5KQ4 A;  1GC7 A;  2MFQ A;  5D3X A;  1Q67 A;  4XWX A;  1DDM A;  5HE0 A;  5C5B A;  2I1K A;  5JP4 A;  4GMX B;  3TCA A;  1WG7 A;  4HAU B;  4HB2 B;  1J19 A;  3D8E A;  5DH9 B;  1P3R A;  3BIN A;  3KRW A;  1SHC A;  1MIX A;  1XD4 A;  2Z0Q A;  4HDQ A;  2M14 A;  2DA0 A;  4NSW A;  5GOW B;  2D2Q A;  2D9Z A;  1XCG A;  1UNR A;  1W1H A;  2DN6 A;  1DRO A;  2GJY A;  1EAZ A;  1U27 A;  1X1F A;  3WA0 A;  2EJ8 A;  1GG3 A;  3G9W A;  3AU4 A;  4KHB B;  5D3V A;  4B6H A;  4L6E A;  4EKU A;  2COA A;  4HB4 B;  1UPR A;  2G35 A;  2GCL A;  2YS3 A;  2D9Y A;  3GYO A;  3D8F A;  4HAT B;  4H8S A;  1H10 A;  2AEH A;  5HE3 A;  4A6H A;  1ISN A;  1EF1 A;  2MWN B;  4A6F B;  2J0M A;  2UZS A;  4HAY B;  4PNK A;  5D3W A;  5C79 A;  1V89 A;  1KI1 B;  2Z0P A;  1X11 A;  2DHJ A;  1U5D A;  3TVV A;  1WI1 A;  1MKE A;  1XKE A;  2W2W A;  5KCV A;  3QBV B;  3IVF A;  1V61 A;  3O96 A;  3SV1 A;  2K2J A;  1EVH A;  2YT0 A;  5EFX A;  2YS5 A;  1FHX A;  3NSU A;  2ROV A;  3TFM A;  2AL6 A;  4F7G A;  3WYF B;  2CY5 A;  3U7D A;  1FB8 A;  3MPX A;  1RRP B;  4D0N B;  1X1G A;  4MY6 A;  4YON A;  4C0A A;  1Y19 B;  2KCJ A;  4GZU A;  4WSF A;  2Q13 A;  3PP2 A;  1M7E A;  2GS0 A;  2KUP A;  2PZ1 A;  3M1I B;  1K5G B;  1WVH A;  3DXD A;  2DLW A;  3ZDT A;  1DDW A;  2M38 A;  4F7H A;  2P0H A;  4HDO A;  3P7Z A;  2V76 A;  1MAI A;  2NZ8 B;  2K2U A;  3GYP A;  2D9W A;  1MIZ B;  2OTX A;  3HQC A;  2JP2 A;  2RNR B;  5CLQ B;  3HW2 B;  3PEG A;  1KZ7 A;  1I7A A;  3AU5 A;  3PVL A;  4CHJ A;  1NI2 A;  4CHM A;  3PG7 A;  1PLS A;  2P0F A;  4KHO A;  1W1D A;  2L2I A;  1FGZ A;  4HAX B;  1EGX A;  2YRY A;  1X05 A;  4KVG B;  3N7C A;  2Z0O A;  4P7I A;  3D8D A;  2DTC A;  2YT1 A;  3ULC A;  2VRW B;  2YS1 A;  1SGH A;  3F0W A;  1OQN A;  4GMV A;  3QWM A;  4EJN A;  2D9V A;  4MK0 A;  4IFS A;  5C16 A;  2D11 A;  2GCJ A;  2VSZ A;  3ULB A;  5J3Q A;  1NTY A;  1OMW A;  1BWN A;  2EMT A;  2I1J A;  1WJM A;  1FGY A;  1UEF A;  2UZR A;  4YL8 A;  1M7R A;  3KZ1 A;  2ZPY A;  2KGX B;  3ML4 A;  1RJ2 A;  1E5W A;  3UZT A;  4GPT B;  3VOQ A;  5CLL B;  1P6S A;  2QKL A;  5HE2 A;  2HTH B;  2DYN A;  2QKM A;  2Y8F A;  3KRX A;  4HAW B;  4PQ0 A;  4WJ7 A;  1U5E A;  1V5U A;  1BAK A;  2J0J A;  1ZC3 B;  2LKO A;  5L81 A;  2LUL A;  5LOP B;  3BJI A;  1BTK A;  1QC6 A;  2DHK A;  1WJ1 A;  3OAN A;  4HHV A;  4K2P A;  3DXE A;  1FOE A;  3FM8 C;  4HAV B;  3RCP A;  2MDX A;  5DHA B;  5J3T A;  3KSY A;  4K81 A;  3TW1 A;  3DXC A;  1NTV A;  1X86 A;  1NU2 A;  2CRF A;  1BTN A;  4A6F A;  1WGQ A;  1ZM0 A;  1LB1 A;  2N23 A;  2I5C A;  2RLO A;  1Z87 A;  3SNH A;  1I2H A;  2ELA A;  4CYE A;  4Y94 A;  4TYZ A;  1FHW A;  2CAY A;  2LOZ A;  1TXD A;  5LON B;  2IFS A;  3P6A A;  3F5R A;  3CIK A;  2FJL A;  3LJU X;  1XOD A;  2CY4 A;  2P0D A;  2DX5 A;  3CXB B;  5D27 A;  2H7D A;  5D3Y A;  2ADZ A;  4EMO A;  4A5K A;  2YVC A;  3TO1 A;  1H4R A;  1PMS A;  3KY9 A;  2RSG A;  5C5B B;  5JHG A;  4MT7 A;  2W2X D;  1V5M A;  2RUK B;  1N3H A;  3ZVR A;  1MK9 B;  3SUZ A;  3X23 A;  1DDV A;  2D9X A;  1ZC4 B;  4GXB A;  2RGN B;  5DI9 B;  3HK0 A;  4HB0 B;  3V5W A;  2LG1 A;  1UPQ A;  4K17 A;  5JHH A;  4WVF B;  1GC6 A; 
#chains in the Genus database with same CATH topology
 4ZRJ A;  2DHI A;  1W1G A;  3MDB C;  3QIJ A;  3AJ4 A;  3PVW A;  2IYB A;  4Z2N A;  2DKP A;  1FAO A;  2H7E A;  4K2O A;  2D4Q A;  3VIA A;  3PVU A;  1LW3 A;  5FI0 A;  1UNP A;  2E2X A;  2X18 A;  4DXA B;  2R0D A;  3FEH A;  2LYD A;  3ODO A;  4TKN A;  4IOY X;  2P8V A;  2R09 A;  1KZG A;  4IAP A;  1PFJ A;  1B55 A;  1DBH A;  5DHF B;  3SO6 A;  1ZSQ A;  1ZVR A;  2DFK A;  1MK7 B;  5DIF B;  1FHO A;  2Y7B A;  4NY0 A;  5KQ1 A;  2J0K A;  1IRS A;  1AQC A;  3SYX A;  2KIG A;  3B77 A;  4KHA A;  1XR0 B;  3U8Z A;  3PSC A;  1J0W A;  1ZYI A;  4ZRI A;  2L1C A;  4HAZ B;  2RVB B;  2COD A;  5J3Y A;  5C6R A;  2EC1 A;  4Z2M B;  2YT2 A;  4GN1 A;  5HE1 A;  4BBK A;  2FJU B;  1P5T A;  2DKQ A;  4DBB A;  4HB3 B;  3FSS A;  1V88 A;  2OQB A;  1U5G A;  2COC A;  1TQZ A;  3A8Q A;  2K8E A;  2K00 A;  2HE7 A;  4F7U P;  4DIX A;  1K5D B;  5I2M A;  4HSI A;  3HIE A;  1XX0 A;  1U29 A;  3A98 B;  1QQG A;  2BCJ A;  2COF A;  2YF0 A;  2XQN M;  5FI1 A;  2LOX A;  1OY2 A;  1MI1 A;  1U2B A;  2MKR A;  1WGU A;  4ZRK A;  3ODW A;  5IRS A;  2Y8G A;  2Z13 A;  3PZD A;  3ODX A;  2I5F A;  3NWF A;  1U5F A;  4KAX B;  2N0Y A;  2J59 M;  4DX9 0;  1MPH A;  2DYQ A;  4A6K A;  1TJ6 A;  5JLJ B;  1UNQ A;  2EMS A;  2NMB A;  1V5P A;  3T06 A;  2ELB A;  2D10 A;  2YSZ A;  1AWE A;  1Y5O A;  2DX1 A;  2ROZ B;  2VKI A;  4QJ3 B;  4QJ4 B;  1DYN A;  3A8P A;  4DX8 A;  2W2X C;  2UVM A;  5KQ4 A;  1GC7 A;  2MFQ A;  5D3X A;  1Q67 A;  4XWX A;  1DDM A;  5HE0 A;  5C5B A;  2I1K A;  5JP4 A;  4GMX B;  3TCA A;  5LG4 B;  1WG7 A;  4HAU B;  4HB2 B;  1J19 A;  3D8E A;  5DH9 B;  1P3R A;  3BIN A;  3KRW A;  1SHC A;  1MIX A;  1XD4 A;  2Z0Q A;  4HDQ A;  2ZKM X;  2M14 A;  3NWA A;  2DA0 A;  4NSW A;  5GOW B;  2D2Q A;  2D9Z A;  1XCG A;  4QJ5 B;  1UNR A;  1W1H A;  2DN6 A;  4OSN A;  1DRO A;  2GJY A;  1EAZ A;  1U27 A;  1X1F A;  2KR0 A;  5I2S A;  3WA0 A;  4QXA B;  3NW8 A;  2EJ8 A;  1GG3 A;  3G9W A;  3AU4 A;  4KHB B;  5D3V A;  4B6H A;  4L6E A;  4EKU A;  2COA A;  4HB4 B;  1UPR A;  2G35 A;  2GCL A;  2YS3 A;  2D9Y A;  3GYO A;  3D8F A;  4HAT B;  4H8S A;  1H10 A;  2Z59 A;  2AEH A;  5HE3 A;  4A6H A;  1ISN A;  1EF1 A;  2MWN B;  4A6F B;  2J0M A;  2UZS A;  4HAY B;  4PNK A;  5D3W A;  5C79 A;  1V89 A;  1KI1 B;  2Z0P A;  1X11 A;  2DHJ A;  1U5D A;  3OHM B;  3TVV A;  1WI1 A;  1MKE A;  1XKE A;  2W2W A;  5KCV A;  3QBV B;  3IVF A;  1V61 A;  3O96 A;  3SV1 A;  2K2J A;  1EVH A;  2YT0 A;  5EFX A;  2YS5 A;  1FHX A;  3NSU A;  2ROV A;  3U12 A;  3TFM A;  2Z14 A;  4OT1 A;  2AL6 A;  4F7G A;  3WYF B;  2CY5 A;  3U7D A;  1FB8 A;  3MPX A;  1RRP B;  4D0N B;  1X1G A;  4MY6 A;  4YON A;  4C0A A;  1Y19 B;  2KCJ A;  4GZU A;  4WSF A;  2Q13 A;  3PP2 A;  1M7E A;  2GS0 A;  2KUP A;  2PZ1 A;  3M1I B;  1K5G B;  1WVH A;  3DXD A;  2DLW A;  3ZDT A;  1DDW A;  2M38 A;  4F7H A;  2P0H A;  4HDO A;  3P7Z A;  2V76 A;  1MAI A;  2NZ8 B;  2K2U A;  3GYP A;  2D9W A;  3DCX A;  1MIZ B;  3HQC A;  2OTX A;  2JP2 A;  2RNR B;  5CLQ B;  3HW2 B;  3PEG A;  1KZ7 A;  1I7A A;  3AU5 A;  3PVL A;  4CHJ A;  1NI2 A;  4CHM A;  3PG7 A;  1PLS A;  2P0F A;  4KHO A;  1W1D A;  2L2I A;  1FGZ A;  3FVC A;  4HAX B;  1EGX A;  2YRY A;  1X05 A;  4KVG B;  3N7C A;  2Z0O A;  4P7I A;  3D8D A;  2DTC A;  2YT1 A;  3ULC A;  2VRW B;  2YS1 A;  1SGH A;  2KIE A;  3F0W A;  1OQN A;  4GMV A;  3QWM A;  4EJN A;  1T77 A;  2GUM A;  2D9V A;  3HSA A;  4MK0 A;  4IFS A;  5C16 A;  2D11 A;  2GCJ A;  2VSZ A;  3ULB A;  5J3Q A;  1NTY A;  1OMW A;  1BWN A;  2R2Y A;  2EMT A;  2I1J A;  1WJM A;  1FGY A;  1UEF A;  2UZR A;  4YL8 A;  1M7R A;  3KZ1 A;  2ZPY A;  2KGX B;  3ML4 A;  1RJ2 A;  1E5W A;  3UZT A;  4GPT B;  3VOQ A;  5CLL B;  1P6S A;  2QKL A;  5HE2 A;  2HTH B;  2DYN A;  2QKM A;  2Y8F A;  3KRX A;  4HAW B;  4PQ0 A;  4WJ7 A;  1U5E A;  1V5U A;  1BAK A;  2J0J A;  1ZC3 B;  2LKO A;  5L81 A;  2LUL A;  5LOP B;  3BJI A;  1BTK A;  1QC6 A;  2DHK A;  1WJ1 A;  3OAN A;  4HHV A;  4K2P A;  3DXE A;  4KHB A;  1FOE A;  3FM8 C;  3A58 A;  4HAV B;  3RCP A;  2MDX A;  5DHA B;  5J3T A;  2KUQ A;  3KSY A;  4K81 A;  3TW1 A;  3DXC A;  1NTV A;  1X86 A;  1NU2 A;  2CRF A;  1BTN A;  4A6F A;  1WGQ A;  1ZM0 A;  1LB1 A;  2N23 A;  2I5C A;  2RLO A;  1Z87 A;  3SNH A;  1I2H A;  2ELA A;  4GNK B;  4CYE A;  4Y94 A;  4TYZ A;  4D6W A;  1FHW A;  2CAY A;  2NBV A;  2LOZ A;  5M4Y B;  1TXD A;  5LON B;  2IFS A;  3P6A A;  3F5R A;  3CIK A;  2FJL A;  3LJU X;  1XOD A;  2CY4 A;  2Z4D A;  2P0D A;  2DX5 A;  3CXB B;  5D27 A;  2H7D A;  5D3Y A;  2ADZ A;  3NWD A;  4EMO A;  4A5K A;  2YVC A;  3TO1 A;  1H4R A;  1PMS A;  3KY9 A;  2RSG A;  5C5B B;  5JHG A;  4MT7 A;  2W2X D;  4CSQ A;  1V5M A;  2RUK B;  1N3H A;  3ZVR A;  1MK9 B;  3SUZ A;  2RRF A;  3X23 A;  1DDV A;  2D9X A;  1ZC4 B;  4GXB A;  2RGN B;  4L1R A;  5DI9 B;  3HK0 A;  4HB0 B;  3V5W A;  2LG1 A;  1UPQ A;  4GOU A;  2K49 A;  4K17 A;  5JHH A;  4WVF B;  1GC6 A; 
#chains in the Genus database with same CATH homology
 4ZRJ A;  2DHI A;  1W1G A;  3MDB C;  3QIJ A;  3AJ4 A;  3PVW A;  2IYB A;  4Z2N A;  2DKP A;  1FAO A;  2H7E A;  4K2O A;  2D4Q A;  3VIA A;  3PVU A;  1LW3 A;  5FI0 A;  1UNP A;  2E2X A;  2X18 A;  4DXA B;  2R0D A;  3FEH A;  2LYD A;  3ODO A;  4TKN A;  4IOY X;  2P8V A;  2R09 A;  1KZG A;  4IAP A;  1PFJ A;  1B55 A;  1DBH A;  5DHF B;  3SO6 A;  1ZSQ A;  1ZVR A;  2DFK A;  1MK7 B;  5DIF B;  1FHO A;  2Y7B A;  4NY0 A;  5KQ1 A;  2J0K A;  1IRS A;  1AQC A;  3SYX A;  4KHA A;  1XR0 B;  3U8Z A;  3PSC A;  1J0W A;  4ZRI A;  2L1C A;  4HAZ B;  2RVB B;  2COD A;  5J3Y A;  5C6R A;  2EC1 A;  4Z2M B;  4GN1 A;  5HE1 A;  4BBK A;  1P5T A;  2DKQ A;  4DBB A;  4HB3 B;  3FSS A;  1V88 A;  2OQB A;  1U5G A;  2COC A;  1TQZ A;  3A8Q A;  2K00 A;  2HE7 A;  4F7U P;  1K5D B;  1XX0 A;  1U29 A;  3A98 B;  1QQG A;  2BCJ A;  2COF A;  2YF0 A;  2XQN M;  5FI1 A;  2LOX A;  1OY2 A;  1U2B A;  2MKR A;  1WGU A;  4ZRK A;  3ODW A;  2Y8G A;  3PZD A;  3ODX A;  2I5F A;  1U5F A;  4KAX B;  2N0Y A;  2J59 M;  4DX9 0;  1MPH A;  2DYQ A;  4A6K A;  1TJ6 A;  5JLJ B;  1UNQ A;  2EMS A;  2NMB A;  1V5P A;  3T06 A;  2ELB A;  2D10 A;  2YSZ A;  1AWE A;  1Y5O A;  2DX1 A;  2ROZ B;  2VKI A;  1DYN A;  3A8P A;  4DX8 A;  2W2X C;  2UVM A;  5KQ4 A;  1GC7 A;  2MFQ A;  5D3X A;  1Q67 A;  4XWX A;  1DDM A;  5HE0 A;  5C5B A;  2I1K A;  5JP4 A;  4GMX B;  3TCA A;  1WG7 A;  4HAU B;  4HB2 B;  1J19 A;  3D8E A;  5DH9 B;  1P3R A;  3BIN A;  3KRW A;  1SHC A;  1MIX A;  1XD4 A;  2Z0Q A;  4HDQ A;  2M14 A;  2DA0 A;  4NSW A;  5GOW B;  2D2Q A;  2D9Z A;  1XCG A;  1UNR A;  1W1H A;  2DN6 A;  1DRO A;  2GJY A;  1EAZ A;  1U27 A;  1X1F A;  3WA0 A;  2EJ8 A;  1GG3 A;  3G9W A;  3AU4 A;  4KHB B;  5D3V A;  4B6H A;  4L6E A;  4EKU A;  2COA A;  4HB4 B;  1UPR A;  2G35 A;  2GCL A;  2YS3 A;  2D9Y A;  3GYO A;  3D8F A;  4HAT B;  4H8S A;  1H10 A;  2AEH A;  5HE3 A;  4A6H A;  1ISN A;  1EF1 A;  2MWN B;  4A6F B;  2J0M A;  2UZS A;  4HAY B;  4PNK A;  5D3W A;  5C79 A;  1V89 A;  1KI1 B;  2Z0P A;  1X11 A;  2DHJ A;  1U5D A;  3TVV A;  1WI1 A;  1MKE A;  1XKE A;  2W2W A;  5KCV A;  3QBV B;  3IVF A;  1V61 A;  3O96 A;  3SV1 A;  2K2J A;  1EVH A;  2YT0 A;  5EFX A;  2YS5 A;  1FHX A;  3NSU A;  2ROV A;  3TFM A;  2AL6 A;  4F7G A;  3WYF B;  2CY5 A;  3U7D A;  1FB8 A;  3MPX A;  1RRP B;  4D0N B;  1X1G A;  4MY6 A;  4YON A;  4C0A A;  1Y19 B;  2KCJ A;  4GZU A;  4WSF A;  2Q13 A;  3PP2 A;  1M7E A;  2GS0 A;  2KUP A;  2PZ1 A;  3M1I B;  1K5G B;  1WVH A;  3DXD A;  2DLW A;  3ZDT A;  1DDW A;  2M38 A;  4F7H A;  2P0H A;  4HDO A;  3P7Z A;  2V76 A;  1MAI A;  2NZ8 B;  2K2U A;  3GYP A;  2D9W A;  1MIZ B;  2OTX A;  3HQC A;  2JP2 A;  2RNR B;  5CLQ B;  3HW2 B;  3PEG A;  1KZ7 A;  1I7A A;  3AU5 A;  3PVL A;  4CHJ A;  1NI2 A;  4CHM A;  3PG7 A;  1PLS A;  2P0F A;  4KHO A;  1W1D A;  2L2I A;  1FGZ A;  4HAX B;  1EGX A;  2YRY A;  1X05 A;  4KVG B;  3N7C A;  2Z0O A;  4P7I A;  3D8D A;  2DTC A;  2YT1 A;  3ULC A;  2VRW B;  2YS1 A;  1SGH A;  3F0W A;  1OQN A;  4GMV A;  3QWM A;  4EJN A;  2D9V A;  4MK0 A;  4IFS A;  5C16 A;  2D11 A;  2GCJ A;  2VSZ A;  3ULB A;  5J3Q A;  1NTY A;  1OMW A;  1BWN A;  2EMT A;  2I1J A;  1WJM A;  1FGY A;  1UEF A;  2UZR A;  4YL8 A;  1M7R A;  3KZ1 A;  2ZPY A;  2KGX B;  3ML4 A;  1RJ2 A;  1E5W A;  3UZT A;  4GPT B;  3VOQ A;  5CLL B;  1P6S A;  2QKL A;  5HE2 A;  2HTH B;  2DYN A;  2QKM A;  2Y8F A;  3KRX A;  4HAW B;  4PQ0 A;  4WJ7 A;  1U5E A;  1V5U A;  1BAK A;  2J0J A;  1ZC3 B;  2LKO A;  5L81 A;  2LUL A;  5LOP B;  3BJI A;  1BTK A;  1QC6 A;  2DHK A;  1WJ1 A;  3OAN A;  4HHV A;  4K2P A;  3DXE A;  1FOE A;  3FM8 C;  4HAV B;  3RCP A;  2MDX A;  5DHA B;  5J3T A;  3KSY A;  4K81 A;  3TW1 A;  3DXC A;  1NTV A;  1X86 A;  1NU2 A;  2CRF A;  1BTN A;  4A6F A;  1WGQ A;  1ZM0 A;  1LB1 A;  2N23 A;  2I5C A;  2RLO A;  1Z87 A;  3SNH A;  1I2H A;  2ELA A;  4CYE A;  4Y94 A;  4TYZ A;  1FHW A;  2CAY A;  2LOZ A;  1TXD A;  5LON B;  2IFS A;  3P6A A;  3F5R A;  3CIK A;  2FJL A;  3LJU X;  1XOD A;  2CY4 A;  2P0D A;  2DX5 A;  3CXB B;  5D27 A;  2H7D A;  5D3Y A;  2ADZ A;  4EMO A;  4A5K A;  2YVC A;  3TO1 A;  1H4R A;  1PMS A;  3KY9 A;  2RSG A;  5C5B B;  5JHG A;  4MT7 A;  2W2X D;  1V5M A;  2RUK B;  1N3H A;  3ZVR A;  1MK9 B;  3SUZ A;  3X23 A;  1DDV A;  2D9X A;  1ZC4 B;  4GXB A;  2RGN B;  5DI9 B;  3HK0 A;  4HB0 B;  3V5W A;  2LG1 A;  1UPQ A;  4K17 A;  5JHH A;  4WVF B;  1GC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...