2D9YA

Solution structure of the ph domain of pepp-3 from human
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
117
structure length
117
Chain Sequence
GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of PEPP-3 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pleckstrin homology domain-containing protein family A membe
total genus 11
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9yA00
3PVWA 4YONA 3BJIA 3DXCA 3PVUA 2EMTA 1UEFA 4KHAA 4Z2NA 3ODOA 2KCJA 1KZ7A 1PLSA 1MIZB 5DIFB 5J3YA 1DDVA 2M14A 3RCPA 4BBKA 4A5KA 3P6AA 3GYPA 2Z0QA 1DBHA 4A6KA 3PSCA 2I5FA 5FI1A 1LB1A 2VRWB 4F7UP 2P0HA 2G35A 5JHHA 3V5WA 1RRPB 1MPHA 1MKEA 1XX0A 1EF1A 1WJMA 3ULBA 2GS0A 2RLOA 1DDMA 3A8QA 4TYZA 2CAYA 3QWMA 3FM8C 5LOPB 2NMBA 1ZC4B 1BTNA 1U5FA 1XR0B 4MY6A 2DKPA 3BINA 3HK0A 4TKNA 1V89A 3O96A 1ZC3B 5LONB 3ODWA 2DHIA 3CXBB 2DTCA 2GCJA 4L6EA 3TVVA 1E5WA 3KY9A 1XD4A 1P6SA 1V61A 2ROVA 2AEHA 2DHKA 4ZRIA 3SO6A 2DLWA 4IAPA 2R0DA 1K5GB 2GCLA 1OQNA 1W1GA 3ZDTA 2L2IA 1U5GA 3PVLA 1NI2A 2M38A 4IOYX 1K5DB 5HE3A 1H4RA 1NTVA 1J0WA 4H8SA 3ULCA 2DYNA 3TO1A 3HQCA 3MDBC 2Y8FA 2MDXA 2D9YA 4ZRKA 3OANA 2UZSA 4GPTB 4HAYB 3WYFB 4GMXB 1FGZA 1ZM0A 5C6RA 1WI1A 2CY4A 1UNRA 1MAIA 3ODXA 2XQNM 2RVBB 4K2PA 2NZ8B 1WVHA 5KCVA 2DHJA 5D3VA 1UPRA 4HDOA 3PEGA 1KZGA 2D10A 1TJ6A 3F5RA 1UPQA 1U2BA 4HB0B 4WSFA 3D8EA 2EJ8A 4WJ7A 2KUPA 1U5EA 1XCGA 4HHVA 5DHFB 2I1JA 2J59M 5DI9B 2D4QA 2DA0A 1V5UA 4F7HA 5C5BA 1FB8A 1WG7A 5L81A 2I5CA 4HB4B 3SUZA 1P3RA 2LKOA 5HE1A 3M1IB 1DYNA 1N3HA 2EC1A 4GZUA 2YF0A 2YS1A 2MKRA 3FEHA 4HB3B 1V5PA 1XKEA 3CIKA 3T06A 4P7IA 1FHOA 2OQBA 3PZDA 4K17A 2X18A 4ZRJA 4KAXB 1I2HA 2N0YA 2J0KA 3QBVB 2Y8GA 4HAXB 2D9ZA 1Q67A 2UVMA 3DXDA 3D8DA 1PMSA 2CRFA 1ZVRA 5C79A 2K2JA 2Q13A 2LYDA 3A8PA 1TXDA 3P7ZA 4HATB 3IVFA 2HTHB 2AL6A 2RUKB 5HE0A 1GG3A 4D0NB 2D9WA 1X86A 2D2QA 2H7EA 2ELAA 3F0WA 1UNQA 4MK0A 4HB2B 2VKIA 2QKMA 1BWNA 2CY5A 2W2XC 2ROZB 2LOXA 1W1DA 2V76A 3MPXA 5CLLB 5J3QA 1ZSQA 1Y19B 1MK7B 3AJ4A 3G9WA 4CHMA 1P5TA 2R09A 3HW2B 1WGUA 3TW1A 2QKLA 5DH9B 2D9XA 2W2WA 2EMSA 1KI1B 1M7EA 2YSZA 4HAUB 4GXBA 1WJ1A 4F7GA 4NY0A 1LW3A 2FJLA 2DFKA 2UZRA 4A6FB 1PFJA 4K81A 3WA0A 2YT1A 4EJNA 4MT7A 2Z0PA 3AU4A 1W1HA 2K2UA 3AU5A 5C5BB 3KRWA 2HE7A 1QQGA 4HAZB 2OTXA 4A6FA 1FHWA 4IFSA 4KHBB 2YRYA 1I7AA 1Z87A 1J19A 2ADZA 4HAWB 2W2XD 4HDQA 1V5MA 3U8ZA 4WVFB 2Y7BA 2DX5A 1GC6A 1B55A 2J0JA 3ML4A 1SHCA 1FOEA 2P8VA 1DROA 3U7DA 1IRSA 3SV1A 1X1FA 5KQ1A 3KRXA 3X23A 3VOQA 2P0DA 2D9VA 3KZ1A 1Y5OA 2DKQA 2COFA 1TQZA 1XODA 4PNKA 1M7RA 2LG1A 2DYQA 5D3WA 4C0AA 1EAZA 2YS3A 3D8FA 1OY2A 1FGYA 3GYOA 1FAOA 4DX90 2YT0A 5CLQB 2RSGA 1U29A 2CODA 4DBBA 2GJYA 5DHAB 5GOWB 2IYBA 4HAVB 5KQ4A 3A98B 2RNRB 2MFQA 2I1KA 2MWNB 1WGQA 1OMWA 1X05A 2J0MA 3VIAA 4GN1A 1BAKA 2P0FA 1MIXA 1QC6A 2JP2A 2Z0OA 3UZTA 2COCA 4KVGB 3SNHA 2RGNB 1EVHA 5D27A 2DN6A 4Y94A 3NSUA 2IFSA 3LJUX 1UNPA 5EFXA 2DX1A 1FHXA 1X11A 4YL8A 1H10A 2LOZA 3PG7A 2ZPYA 4Z2MB 2L1CA 4K2OA 2YS5A 3KSYA 1GC7A 2ELBA 1EGXA 3N7CA 5D3YA 4EKUA 4B6HA 4CHJA 1ISNA 3QIJA 4CYEA 3DXEA 1AWEA 4PQ0A 5JHGA 1MK9B 4NSWA 3FSSA 3TFMA 2D11A 2PZ1A 5J3TA 1RJ2A 1NTYA 2N23A 1DDWA 4A6HA 1X1GA 1NU2A 3PP2A 4KHOA 3TCAA 5JP4A 2LULA 4DX8A 2E2XA 5D3XA 1SGHA 5JLJB 4GMVA 4EMOA 4XWXA 2VSZA 2KGXB 1U27A 3ZVRA 2YVCA 1AQCA 5HE2A 1V88A 2COAA 2H7DA 1BTKA 2BCJA 1U5DA 2K00A 5FI0A 3SYXA 4DXAB 5C16A
chains in the Genus database with same CATH superfamily
4QXAB 3PVWA 4YONA 2K49A 3BJIA 3DXCA 3PVUA 2EMTA 1UEFA 4KHAA 4Z2NA 3ODOA 2KCJA 3NWAA 1KZ7A 1PLSA 1MIZB 5DIFB 5J3YA 1DDVA 2M14A 3RCPA 4BBKA 4A5KA 3P6AA 3GYPA 2Z0QA 1DBHA 4A6KA 3PSCA 2I5FA 5FI1A 1LB1A 2VRWB 4F7UP 2P0HA 2G35A 5JHHA 3V5WA 3FVCA 1RRPB 1MPHA 1MKEA 1XX0A 1EF1A 1WJMA 3ULBA 2GS0A 2RLOA 1DDMA 3A8QA 4OSNA 4TYZA 2CAYA 3QWMA 3FM8C 5LOPB 2NMBA 1ZC4B 1BTNA 1U5FA 1XR0B 4MY6A 2DKPA 3BINA 3HK0A 4TKNA 1V89A 3O96A 1ZC3B 5LONB 3ODWA 2DHIA 3CXBB 3U12A 2DTCA 4QJ5B 2GCJA 4L6EA 3TVVA 1E5WA 3KY9A 1XD4A 4GOUA 1P6SA 4QJ4B 1V61A 2ROVA 2AEHA 2DHKA 4ZRIA 3SO6A 2DLWA 4IAPA 1T77A 2R0DA 1K5GB 2GCLA 1OQNA 1W1GA 3ZDTA 2L2IA 1U5GA 3PVLA 1NI2A 2M38A 4IOYX 1K5DB 4KHBA 5HE3A 1H4RA 1NTVA 1J0WA 4H8SA 3ULCA 2DYNA 3TO1A 3HQCA 3MDBC 2Y8FA 2MDXA 2D9YA 2KIEA 4ZRKA 1MI1A 3OANA 2UZSA 4GPTB 4HAYB 3WYFB 4GMXB 1FGZA 1ZM0A 5M4YB 5C6RA 1WI1A 2CY4A 1UNRA 1MAIA 3ODXA 2XQNM 2RVBB 4K2PA 2NZ8B 1WVHA 5KCVA 2DHJA 5D3VA 1UPRA 4HDOA 3PEGA 1KZGA 2D10A 1TJ6A 3F5RA 4L1RA 2R2YA 1UPQA 1U2BA 4HB0B 4WSFA 3D8EA 2EJ8A 3NW8A 4WJ7A 2KUPA 1U5EA 3OHMB 1XCGA 4HHVA 5DHFB 2I1JA 2J59M 5DI9B 5IRSA 2D4QA 2DA0A 1V5UA 4F7HA 5C5BA 1FB8A 1WG7A 5L81A 2I5CA 4HB4B 3SUZA 1P3RA 2LKOA 5HE1A 2NBVA 3M1IB 1DYNA 1N3HA 2EC1A 4GZUA 2YF0A 2YS1A 2MKRA 3FEHA 4HB3B 1V5PA 1XKEA 3CIKA 2Z13A 3T06A 4P7IA 1FHOA 2OQBA 1ZYIA 3B77A 3PZDA 4K17A 2X18A 4ZRJA 4KAXB 2GUMA 1I2HA 2N0YA 2J0KA 3QBVB 2Y8GA 4HAXB 2D9ZA 1Q67A 2UVMA 3DXDA 3D8DA 1PMSA 2Z4DA 2CRFA 1ZVRA 5C79A 2K2JA 2Q13A 2LYDA 3A8PA 1TXDA 3P7ZA 4HATB 3IVFA 2HTHB 2AL6A 2RUKB 5HE0A 1GG3A 4D0NB 2D9WA 1X86A 2D2QA 2H7EA 2ELAA 5I2SA 3F0WA 1UNQA 4MK0A 4QJ3B 4HB2B 2VKIA 2QKMA 5LG4B 1BWNA 2CY5A 2W2XC 2ROZB 2LOXA 1W1DA 2KIGA 2V76A 3MPXA 5CLLB 5J3QA 1ZSQA 1Y19B 1MK7B 3AJ4A 3G9WA 4CHMA 1P5TA 2R09A 3HW2B 1WGUA 3TW1A 2QKLA 3NWDA 5DH9B 3HSAA 2D9XA 2W2WA 2EMSA 1KI1B 4CSQA 1M7EA 2YSZA 4GXBA 4HAUB 1WJ1A 4F7GA 4NY0A 1LW3A 2KR0A 2FJLA 4GNKB 2DFKA 2UZRA 4A6FB 3NWFA 1PFJA 4K81A 2Z14A 3WA0A 2YT1A 2FJUB 4EJNA 4MT7A 2Z0PA 3AU4A 2K8EA 1W1HA 2K2UA 3AU5A 5C5BB 3KRWA 2HE7A 1QQGA 4D6WA 4HAZB 2OTXA 4A6FA 1FHWA 4IFSA 4KHBB 5I2MA 2YRYA 1I7AA 1Z87A 1J19A 2ADZA 4HAWB 2W2XD 4HDQA 1V5MA 3A58A 3U8ZA 4WVFB 2Y7BA 2DX5A 1GC6A 1B55A 2J0JA 3ML4A 1SHCA 1FOEA 2P8VA 1DROA 3U7DA 1IRSA 3SV1A 1X1FA 5KQ1A 3KRXA 3X23A 3VOQA 2P0DA 3HIEA 2D9VA 3KZ1A 1Y5OA 2DKQA 2COFA 1TQZA 1XODA 4PNKA 1M7RA 2LG1A 2DYQA 5D3WA 4C0AA 1EAZA 2YS3A 2ZKMX 3D8FA 1OY2A 1FGYA 3GYOA 2YT2A 4OT1A 1FAOA 4DX90 2YT0A 5CLQB 2RSGA 1U29A 2CODA 4DBBA 2GJYA 5DHAB 5GOWB 2IYBA 4HAVB 5KQ4A 3A98B 2RNRB 2MFQA 2I1KA 4DIXA 2MWNB 1WGQA 1OMWA 1X05A 2J0MA 3VIAA 4GN1A 1BAKA 2P0FA 1MIXA 1QC6A 2JP2A 2Z0OA 3UZTA 2RRFA 2COCA 4KVGB 3SNHA 2RGNB 2KUQA 1EVHA 5D27A 2DN6A 4Y94A 4HSIA 3NSUA 2IFSA 3LJUX 1UNPA 2Z59A 5EFXA 2DX1A 1FHXA 1X11A 4YL8A 1H10A 2LOZA 3PG7A 2ZPYA 4Z2MB 2L1CA 4K2OA 2YS5A 3KSYA 1GC7A 2ELBA 1EGXA 3N7CA 5D3YA 4EKUA 4B6HA 4CHJA 1ISNA 3QIJA 4CYEA 3DXEA 1AWEA 4PQ0A 5JHGA 1MK9B 4NSWA 3DCXA 3FSSA 3TFMA 2D11A 2PZ1A 5J3TA 1RJ2A 1NTYA 2N23A 1DDWA 4A6HA 1X1GA 1NU2A 3PP2A 4KHOA 3TCAA 5JP4A 2LULA 4DX8A 2E2XA 5D3XA 1SGHA 5JLJB 4GMVA 4EMOA 4XWXA 2VSZA 2KGXB 1U27A 3ZVRA 2YVCA 1AQCA 5HE2A 1V88A 2COAA 2H7DA 1BTKA 2BCJA 1U5DA 2K00A 5FI0A 3SYXA 4DXAB 5C16A
chains in the Genus database with same CATH topology
3PVWA 4YONA 3BJIA 3DXCA 3PVUA 2EMTA 1UEFA 4KHAA 4Z2NA 3ODOA 2KCJA 1KZ7A 1PLSA 1MIZB 5DIFB 5J3YA 1DDVA 2M14A 3RCPA 4BBKA 4A5KA 3P6AA 3GYPA 2Z0QA 1DBHA 4A6KA 3PSCA 2I5FA 5FI1A 1LB1A 2VRWB 4F7UP 2P0HA 2G35A 5JHHA 3V5WA 1RRPB 1MPHA 1MKEA 1XX0A 1EF1A 1WJMA 3ULBA 2GS0A 2RLOA 1DDMA 3A8QA 4TYZA 2CAYA 3QWMA 3FM8C 5LOPB 2NMBA 1ZC4B 1BTNA 1U5FA 1XR0B 4MY6A 2DKPA 3BINA 3HK0A 4TKNA 1V89A 3O96A 1ZC3B 5LONB 3ODWA 2DHIA 3CXBB 2DTCA 2GCJA 4L6EA 3TVVA 1E5WA 3KY9A 1XD4A 1P6SA 1V61A 2ROVA 2AEHA 2DHKA 4ZRIA 3SO6A 2DLWA 4IAPA 2R0DA 1K5GB 2GCLA 1OQNA 1W1GA 3ZDTA 2L2IA 1U5GA 3PVLA 1NI2A 2M38A 4IOYX 1K5DB 5HE3A 1H4RA 1NTVA 1J0WA 4H8SA 3ULCA 2DYNA 3TO1A 3HQCA 3MDBC 2Y8FA 2MDXA 2D9YA 4ZRKA 3OANA 2UZSA 4GPTB 4HAYB 3WYFB 4GMXB 1FGZA 1ZM0A 5C6RA 1WI1A 2CY4A 1UNRA 1MAIA 3ODXA 2XQNM 2RVBB 4K2PA 2NZ8B 1WVHA 5KCVA 2DHJA 5D3VA 1UPRA 4HDOA 3PEGA 1KZGA 2D10A 1TJ6A 3F5RA 1UPQA 1U2BA 4HB0B 4WSFA 3D8EA 2EJ8A 4WJ7A 2KUPA 1U5EA 1XCGA 4HHVA 5DHFB 2I1JA 2J59M 5DI9B 2D4QA 2DA0A 1V5UA 4F7HA 5C5BA 1FB8A 1WG7A 5L81A 2I5CA 4HB4B 3SUZA 1P3RA 2LKOA 5HE1A 3M1IB 1DYNA 1N3HA 2EC1A 4GZUA 2YF0A 2YS1A 2MKRA 3FEHA 4HB3B 1V5PA 1XKEA 3CIKA 3T06A 4P7IA 1FHOA 2OQBA 3PZDA 4K17A 2X18A 4ZRJA 4KAXB 1I2HA 2N0YA 2J0KA 3QBVB 2Y8GA 4HAXB 2D9ZA 1Q67A 2UVMA 3DXDA 3D8DA 1PMSA 2CRFA 1ZVRA 5C79A 2K2JA 2Q13A 2LYDA 3A8PA 1TXDA 3P7ZA 4HATB 3IVFA 2HTHB 2AL6A 2RUKB 5HE0A 1GG3A 4D0NB 2D9WA 1X86A 2D2QA 2H7EA 2ELAA 3F0WA 1UNQA 4MK0A 4HB2B 2VKIA 2QKMA 1BWNA 2CY5A 2W2XC 2ROZB 2LOXA 1W1DA 2V76A 3MPXA 5CLLB 5J3QA 1ZSQA 1Y19B 1MK7B 3AJ4A 3G9WA 4CHMA 1P5TA 2R09A 3HW2B 1WGUA 3TW1A 2QKLA 5DH9B 2D9XA 2W2WA 2EMSA 1KI1B 1M7EA 2YSZA 4HAUB 4GXBA 1WJ1A 4F7GA 4NY0A 1LW3A 2FJLA 2DFKA 2UZRA 4A6FB 1PFJA 4K81A 3WA0A 2YT1A 4EJNA 4MT7A 2Z0PA 3AU4A 1W1HA 2K2UA 3AU5A 5C5BB 3KRWA 2HE7A 1QQGA 4HAZB 2OTXA 4A6FA 1FHWA 4IFSA 4KHBB 2YRYA 1I7AA 1Z87A 1J19A 2ADZA 4HAWB 2W2XD 4HDQA 1V5MA 3U8ZA 4WVFB 2Y7BA 2DX5A 1GC6A 1B55A 2J0JA 3ML4A 1SHCA 1FOEA 2P8VA 1DROA 3U7DA 1IRSA 3SV1A 1X1FA 5KQ1A 3KRXA 3X23A 3VOQA 2P0DA 2D9VA 3KZ1A 1Y5OA 2DKQA 2COFA 1TQZA 1XODA 4PNKA 1M7RA 2LG1A 2DYQA 5D3WA 4C0AA 1EAZA 2YS3A 3D8FA 1OY2A 1FGYA 3GYOA 1FAOA 4DX90 2YT0A 5CLQB 2RSGA 1U29A 2CODA 4DBBA 2GJYA 5DHAB 5GOWB 2IYBA 4HAVB 5KQ4A 3A98B 2RNRB 2MFQA 2I1KA 2MWNB 1WGQA 1OMWA 1X05A 2J0MA 3VIAA 4GN1A 1BAKA 2P0FA 1MIXA 1QC6A 2JP2A 2Z0OA 3UZTA 2COCA 4KVGB 3SNHA 2RGNB 1EVHA 5D27A 2DN6A 4Y94A 3NSUA 2IFSA 3LJUX 1UNPA 5EFXA 2DX1A 1FHXA 1X11A 4YL8A 1H10A 2LOZA 3PG7A 2ZPYA 4Z2MB 2L1CA 4K2OA 2YS5A 3KSYA 1GC7A 2ELBA 1EGXA 3N7CA 5D3YA 4EKUA 4B6HA 4CHJA 1ISNA 3QIJA 4CYEA 3DXEA 1AWEA 4PQ0A 5JHGA 1MK9B 4NSWA 3FSSA 3TFMA 2D11A 2PZ1A 5J3TA 1RJ2A 1NTYA 2N23A 1DDWA 4A6HA 1X1GA 1NU2A 3PP2A 4KHOA 3TCAA 5JP4A 2LULA 4DX8A 2E2XA 5D3XA 1SGHA 5JLJB 4GMVA 4EMOA 4XWXA 2VSZA 2KGXB 1U27A 3ZVRA 2YVCA 1AQCA 5HE2A 1V88A 2COAA 2H7DA 1BTKA 2BCJA 1U5DA 2K00A 5FI0A 3SYXA 4DXAB 5C16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVW A;  4YON A;  3BJI A;  3DXC A;  3PVU A;  2EMT A;  1UEF A;  4KHA A;  4Z2N A;  3ODO A;  2KCJ A;  1KZ7 A;  1PLS A;  1MIZ B;  5DIF B;  5J3Y A;  1DDV A;  2M14 A;  3RCP A;  4BBK A;  4A5K A;  3P6A A;  3GYP A;  2Z0Q A;  1DBH A;  4A6K A;  3PSC A;  2I5F A;  5FI1 A;  1LB1 A;  2VRW B;  4F7U P;  2P0H A;  2G35 A;  5JHH A;  3V5W A;  1RRP B;  1MPH A;  1MKE A;  1XX0 A;  1EF1 A;  1WJM A;  3ULB A;  2GS0 A;  2RLO A;  1DDM A;  3A8Q A;  4TYZ A;  2CAY A;  3QWM A;  3FM8 C;  5LOP B;  2NMB A;  1ZC4 B;  1BTN A;  1U5F A;  1XR0 B;  4MY6 A;  2DKP A;  3BIN A;  3HK0 A;  4TKN A;  1V89 A;  3O96 A;  1ZC3 B;  5LON B;  3ODW A;  2DHI A;  3CXB B;  2DTC A;  2GCJ A;  4L6E A;  3TVV A;  1E5W A;  3KY9 A;  1XD4 A;  1P6S A;  1V61 A;  2ROV A;  2AEH A;  2DHK A;  4ZRI A;  3SO6 A;  2DLW A;  4IAP A;  2R0D A;  1K5G B;  2GCL A;  1OQN A;  1W1G A;  3ZDT A;  2L2I A;  1U5G A;  3PVL A;  1NI2 A;  2M38 A;  4IOY X;  1K5D B;  5HE3 A;  1H4R A;  1NTV A;  1J0W A;  4H8S A;  3ULC A;  2DYN A;  3TO1 A;  3HQC A;  3MDB C;  2Y8F A;  2MDX A;  2D9Y A;  4ZRK A;  3OAN A;  2UZS A;  4GPT B;  4HAY B;  3WYF B;  4GMX B;  1FGZ A;  1ZM0 A;  5C6R A;  1WI1 A;  2CY4 A;  1UNR A;  1MAI A;  3ODX A;  2XQN M;  2RVB B;  4K2P A;  2NZ8 B;  1WVH A;  5KCV A;  2DHJ A;  5D3V A;  1UPR A;  4HDO A;  3PEG A;  1KZG A;  2D10 A;  1TJ6 A;  3F5R A;  1UPQ A;  1U2B A;  4HB0 B;  4WSF A;  3D8E A;  2EJ8 A;  4WJ7 A;  2KUP A;  1U5E A;  1XCG A;  4HHV A;  5DHF B;  2I1J A;  2J59 M;  5DI9 B;  2D4Q A;  2DA0 A;  1V5U A;  4F7H A;  5C5B A;  1FB8 A;  1WG7 A;  5L81 A;  2I5C A;  4HB4 B;  3SUZ A;  1P3R A;  2LKO A;  5HE1 A;  3M1I B;  1DYN A;  1N3H A;  2EC1 A;  4GZU A;  2YF0 A;  2YS1 A;  2MKR A;  3FEH A;  4HB3 B;  1V5P A;  1XKE A;  3CIK A;  3T06 A;  4P7I A;  1FHO A;  2OQB A;  3PZD A;  4K17 A;  2X18 A;  4ZRJ A;  4KAX B;  1I2H A;  2N0Y A;  2J0K A;  3QBV B;  2Y8G A;  4HAX B;  2D9Z A;  1Q67 A;  2UVM A;  3DXD A;  3D8D A;  1PMS A;  2CRF A;  1ZVR A;  5C79 A;  2K2J A;  2Q13 A;  2LYD A;  3A8P A;  1TXD A;  3P7Z A;  4HAT B;  3IVF A;  2HTH B;  2AL6 A;  2RUK B;  5HE0 A;  1GG3 A;  4D0N B;  2D9W A;  1X86 A;  2D2Q A;  2H7E A;  2ELA A;  3F0W A;  1UNQ A;  4MK0 A;  4HB2 B;  2VKI A;  2QKM A;  1BWN A;  2CY5 A;  2W2X C;  2ROZ B;  2LOX A;  1W1D A;  2V76 A;  3MPX A;  5CLL B;  5J3Q A;  1ZSQ A;  1Y19 B;  1MK7 B;  3AJ4 A;  3G9W A;  4CHM A;  1P5T A;  2R09 A;  3HW2 B;  1WGU A;  3TW1 A;  2QKL A;  5DH9 B;  2D9X A;  2W2W A;  2EMS A;  1KI1 B;  1M7E A;  2YSZ A;  4HAU B;  4GXB A;  1WJ1 A;  4F7G A;  4NY0 A;  1LW3 A;  2FJL A;  2DFK A;  2UZR A;  4A6F B;  1PFJ A;  4K81 A;  3WA0 A;  2YT1 A;  4EJN A;  4MT7 A;  2Z0P A;  3AU4 A;  1W1H A;  2K2U A;  3AU5 A;  5C5B B;  3KRW A;  2HE7 A;  1QQG A;  4HAZ B;  2OTX A;  4A6F A;  1FHW A;  4IFS A;  4KHB B;  2YRY A;  1I7A A;  1Z87 A;  1J19 A;  2ADZ A;  4HAW B;  2W2X D;  4HDQ A;  1V5M A;  3U8Z A;  4WVF B;  2Y7B A;  2DX5 A;  1GC6 A;  1B55 A;  2J0J A;  3ML4 A;  1SHC A;  1FOE A;  2P8V A;  1DRO A;  3U7D A;  1IRS A;  3SV1 A;  1X1F A;  5KQ1 A;  3KRX A;  3X23 A;  3VOQ A;  2P0D A;  2D9V A;  3KZ1 A;  1Y5O A;  2DKQ A;  2COF A;  1TQZ A;  1XOD A;  4PNK A;  1M7R A;  2LG1 A;  2DYQ A;  5D3W A;  4C0A A;  1EAZ A;  2YS3 A;  3D8F A;  1OY2 A;  1FGY A;  3GYO A;  1FAO A;  4DX9 0;  2YT0 A;  5CLQ B;  2RSG A;  1U29 A;  2COD A;  4DBB A;  2GJY A;  5DHA B;  5GOW B;  2IYB A;  4HAV B;  5KQ4 A;  3A98 B;  2RNR B;  2MFQ A;  2I1K A;  2MWN B;  1WGQ A;  1OMW A;  1X05 A;  2J0M A;  3VIA A;  4GN1 A;  1BAK A;  2P0F A;  1MIX A;  1QC6 A;  2JP2 A;  2Z0O A;  3UZT A;  2COC A;  4KVG B;  3SNH A;  2RGN B;  1EVH A;  5D27 A;  2DN6 A;  4Y94 A;  3NSU A;  2IFS A;  3LJU X;  1UNP A;  5EFX A;  2DX1 A;  1FHX A;  1X11 A;  4YL8 A;  1H10 A;  2LOZ A;  3PG7 A;  2ZPY A;  4Z2M B;  2L1C A;  4K2O A;  2YS5 A;  3KSY A;  1GC7 A;  2ELB A;  1EGX A;  3N7C A;  5D3Y A;  4EKU A;  4B6H A;  4CHJ A;  1ISN A;  3QIJ A;  4CYE A;  3DXE A;  1AWE A;  4PQ0 A;  5JHG A;  1MK9 B;  4NSW A;  3FSS A;  3TFM A;  2D11 A;  2PZ1 A;  5J3T A;  1RJ2 A;  1NTY A;  2N23 A;  1DDW A;  4A6H A;  1X1G A;  1NU2 A;  3PP2 A;  4KHO A;  3TCA A;  5JP4 A;  2LUL A;  4DX8 A;  2E2X A;  5D3X A;  1SGH A;  5JLJ B;  4GMV A;  4EMO A;  4XWX A;  2VSZ A;  2KGX B;  1U27 A;  3ZVR A;  2YVC A;  1AQC A;  5HE2 A;  1V88 A;  2COA A;  2H7D A;  1BTK A;  2BCJ A;  1U5D A;  2K00 A;  5FI0 A;  3SYX A;  4DXA B;  5C16 A; 
#chains in the Genus database with same CATH topology
 4QXA B;  3PVW A;  4YON A;  2K49 A;  3BJI A;  3DXC A;  3PVU A;  2EMT A;  1UEF A;  4KHA A;  4Z2N A;  3ODO A;  2KCJ A;  3NWA A;  1KZ7 A;  1PLS A;  1MIZ B;  5DIF B;  5J3Y A;  1DDV A;  2M14 A;  3RCP A;  4BBK A;  4A5K A;  3P6A A;  3GYP A;  2Z0Q A;  1DBH A;  4A6K A;  3PSC A;  2I5F A;  5FI1 A;  1LB1 A;  2VRW B;  4F7U P;  2P0H A;  2G35 A;  5JHH A;  3V5W A;  3FVC A;  1RRP B;  1MPH A;  1MKE A;  1XX0 A;  1EF1 A;  1WJM A;  3ULB A;  2GS0 A;  2RLO A;  1DDM A;  3A8Q A;  4OSN A;  4TYZ A;  2CAY A;  3QWM A;  3FM8 C;  5LOP B;  2NMB A;  1ZC4 B;  1BTN A;  1U5F A;  1XR0 B;  4MY6 A;  2DKP A;  3BIN A;  3HK0 A;  4TKN A;  1V89 A;  3O96 A;  1ZC3 B;  5LON B;  3ODW A;  2DHI A;  3CXB B;  3U12 A;  2DTC A;  4QJ5 B;  2GCJ A;  4L6E A;  3TVV A;  1E5W A;  3KY9 A;  1XD4 A;  4GOU A;  1P6S A;  4QJ4 B;  1V61 A;  2ROV A;  2AEH A;  2DHK A;  4ZRI A;  3SO6 A;  2DLW A;  4IAP A;  1T77 A;  2R0D A;  1K5G B;  2GCL A;  1OQN A;  1W1G A;  3ZDT A;  2L2I A;  1U5G A;  3PVL A;  1NI2 A;  2M38 A;  4IOY X;  1K5D B;  4KHB A;  5HE3 A;  1H4R A;  1NTV A;  1J0W A;  4H8S A;  3ULC A;  2DYN A;  3TO1 A;  3HQC A;  3MDB C;  2Y8F A;  2MDX A;  2D9Y A;  2KIE A;  4ZRK A;  1MI1 A;  3OAN A;  2UZS A;  4GPT B;  4HAY B;  3WYF B;  4GMX B;  1FGZ A;  1ZM0 A;  5M4Y B;  5C6R A;  1WI1 A;  2CY4 A;  1UNR A;  1MAI A;  3ODX A;  2XQN M;  2RVB B;  4K2P A;  2NZ8 B;  1WVH A;  5KCV A;  2DHJ A;  5D3V A;  1UPR A;  4HDO A;  3PEG A;  1KZG A;  2D10 A;  1TJ6 A;  3F5R A;  4L1R A;  2R2Y A;  1UPQ A;  1U2B A;  4HB0 B;  4WSF A;  3D8E A;  2EJ8 A;  3NW8 A;  4WJ7 A;  2KUP A;  1U5E A;  3OHM B;  1XCG A;  4HHV A;  5DHF B;  2I1J A;  2J59 M;  5DI9 B;  5IRS A;  2D4Q A;  2DA0 A;  1V5U A;  4F7H A;  5C5B A;  1FB8 A;  1WG7 A;  5L81 A;  2I5C A;  4HB4 B;  3SUZ A;  1P3R A;  2LKO A;  5HE1 A;  2NBV A;  3M1I B;  1DYN A;  1N3H A;  2EC1 A;  4GZU A;  2YF0 A;  2YS1 A;  2MKR A;  3FEH A;  4HB3 B;  1V5P A;  1XKE A;  3CIK A;  2Z13 A;  3T06 A;  4P7I A;  1FHO A;  2OQB A;  1ZYI A;  3B77 A;  3PZD A;  4K17 A;  2X18 A;  4ZRJ A;  4KAX B;  2GUM A;  1I2H A;  2N0Y A;  2J0K A;  3QBV B;  2Y8G A;  4HAX B;  2D9Z A;  1Q67 A;  2UVM A;  3DXD A;  3D8D A;  1PMS A;  2Z4D A;  2CRF A;  1ZVR A;  5C79 A;  2K2J A;  2Q13 A;  2LYD A;  3A8P A;  1TXD A;  3P7Z A;  4HAT B;  3IVF A;  2HTH B;  2AL6 A;  2RUK B;  5HE0 A;  1GG3 A;  4D0N B;  2D9W A;  1X86 A;  2D2Q A;  2H7E A;  2ELA A;  5I2S A;  3F0W A;  1UNQ A;  4MK0 A;  4QJ3 B;  4HB2 B;  2VKI A;  2QKM A;  5LG4 B;  1BWN A;  2CY5 A;  2W2X C;  2ROZ B;  2LOX A;  1W1D A;  2KIG A;  2V76 A;  3MPX A;  5CLL B;  5J3Q A;  1ZSQ A;  1Y19 B;  1MK7 B;  3AJ4 A;  3G9W A;  4CHM A;  1P5T A;  2R09 A;  3HW2 B;  1WGU A;  3TW1 A;  2QKL A;  3NWD A;  5DH9 B;  3HSA A;  2D9X A;  2W2W A;  2EMS A;  1KI1 B;  4CSQ A;  1M7E A;  2YSZ A;  4GXB A;  4HAU B;  1WJ1 A;  4F7G A;  4NY0 A;  1LW3 A;  2KR0 A;  2FJL A;  4GNK B;  2DFK A;  2UZR A;  4A6F B;  3NWF A;  1PFJ A;  4K81 A;  2Z14 A;  3WA0 A;  2YT1 A;  2FJU B;  4EJN A;  4MT7 A;  2Z0P A;  3AU4 A;  2K8E A;  1W1H A;  2K2U A;  3AU5 A;  5C5B B;  3KRW A;  2HE7 A;  1QQG A;  4D6W A;  4HAZ B;  2OTX A;  4A6F A;  1FHW A;  4IFS A;  4KHB B;  5I2M A;  2YRY A;  1I7A A;  1Z87 A;  1J19 A;  2ADZ A;  4HAW B;  2W2X D;  4HDQ A;  1V5M A;  3A58 A;  3U8Z A;  4WVF B;  2Y7B A;  2DX5 A;  1GC6 A;  1B55 A;  2J0J A;  3ML4 A;  1SHC A;  1FOE A;  2P8V A;  1DRO A;  3U7D A;  1IRS A;  3SV1 A;  1X1F A;  5KQ1 A;  3KRX A;  3X23 A;  3VOQ A;  2P0D A;  3HIE A;  2D9V A;  3KZ1 A;  1Y5O A;  2DKQ A;  2COF A;  1TQZ A;  1XOD A;  4PNK A;  1M7R A;  2LG1 A;  2DYQ A;  5D3W A;  4C0A A;  1EAZ A;  2YS3 A;  2ZKM X;  3D8F A;  1OY2 A;  1FGY A;  3GYO A;  2YT2 A;  4OT1 A;  1FAO A;  4DX9 0;  2YT0 A;  5CLQ B;  2RSG A;  1U29 A;  2COD A;  4DBB A;  2GJY A;  5DHA B;  5GOW B;  2IYB A;  4HAV B;  5KQ4 A;  3A98 B;  2RNR B;  2MFQ A;  2I1K A;  4DIX A;  2MWN B;  1WGQ A;  1OMW A;  1X05 A;  2J0M A;  3VIA A;  4GN1 A;  1BAK A;  2P0F A;  1MIX A;  1QC6 A;  2JP2 A;  2Z0O A;  3UZT A;  2RRF A;  2COC A;  4KVG B;  3SNH A;  2RGN B;  2KUQ A;  1EVH A;  5D27 A;  2DN6 A;  4Y94 A;  4HSI A;  3NSU A;  2IFS A;  3LJU X;  1UNP A;  2Z59 A;  5EFX A;  2DX1 A;  1FHX A;  1X11 A;  4YL8 A;  1H10 A;  2LOZ A;  3PG7 A;  2ZPY A;  4Z2M B;  2L1C A;  4K2O A;  2YS5 A;  3KSY A;  1GC7 A;  2ELB A;  1EGX A;  3N7C A;  5D3Y A;  4EKU A;  4B6H A;  4CHJ A;  1ISN A;  3QIJ A;  4CYE A;  3DXE A;  1AWE A;  4PQ0 A;  5JHG A;  1MK9 B;  4NSW A;  3DCX A;  3FSS A;  3TFM A;  2D11 A;  2PZ1 A;  5J3T A;  1RJ2 A;  1NTY A;  2N23 A;  1DDW A;  4A6H A;  1X1G A;  1NU2 A;  3PP2 A;  4KHO A;  3TCA A;  5JP4 A;  2LUL A;  4DX8 A;  2E2X A;  5D3X A;  1SGH A;  5JLJ B;  4GMV A;  4EMO A;  4XWX A;  2VSZ A;  2KGX B;  1U27 A;  3ZVR A;  2YVC A;  1AQC A;  5HE2 A;  1V88 A;  2COA A;  2H7D A;  1BTK A;  2BCJ A;  1U5D A;  2K00 A;  5FI0 A;  3SYX A;  4DXA B;  5C16 A; 
#chains in the Genus database with same CATH homology
 3PVW A;  4YON A;  3BJI A;  3DXC A;  3PVU A;  2EMT A;  1UEF A;  4KHA A;  4Z2N A;  3ODO A;  2KCJ A;  1KZ7 A;  1PLS A;  1MIZ B;  5DIF B;  5J3Y A;  1DDV A;  2M14 A;  3RCP A;  4BBK A;  4A5K A;  3P6A A;  3GYP A;  2Z0Q A;  1DBH A;  4A6K A;  3PSC A;  2I5F A;  5FI1 A;  1LB1 A;  2VRW B;  4F7U P;  2P0H A;  2G35 A;  5JHH A;  3V5W A;  1RRP B;  1MPH A;  1MKE A;  1XX0 A;  1EF1 A;  1WJM A;  3ULB A;  2GS0 A;  2RLO A;  1DDM A;  3A8Q A;  4TYZ A;  2CAY A;  3QWM A;  3FM8 C;  5LOP B;  2NMB A;  1ZC4 B;  1BTN A;  1U5F A;  1XR0 B;  4MY6 A;  2DKP A;  3BIN A;  3HK0 A;  4TKN A;  1V89 A;  3O96 A;  1ZC3 B;  5LON B;  3ODW A;  2DHI A;  3CXB B;  2DTC A;  2GCJ A;  4L6E A;  3TVV A;  1E5W A;  3KY9 A;  1XD4 A;  1P6S A;  1V61 A;  2ROV A;  2AEH A;  2DHK A;  4ZRI A;  3SO6 A;  2DLW A;  4IAP A;  2R0D A;  1K5G B;  2GCL A;  1OQN A;  1W1G A;  3ZDT A;  2L2I A;  1U5G A;  3PVL A;  1NI2 A;  2M38 A;  4IOY X;  1K5D B;  5HE3 A;  1H4R A;  1NTV A;  1J0W A;  4H8S A;  3ULC A;  2DYN A;  3TO1 A;  3HQC A;  3MDB C;  2Y8F A;  2MDX A;  2D9Y A;  4ZRK A;  3OAN A;  2UZS A;  4GPT B;  4HAY B;  3WYF B;  4GMX B;  1FGZ A;  1ZM0 A;  5C6R A;  1WI1 A;  2CY4 A;  1UNR A;  1MAI A;  3ODX A;  2XQN M;  2RVB B;  4K2P A;  2NZ8 B;  1WVH A;  5KCV A;  2DHJ A;  5D3V A;  1UPR A;  4HDO A;  3PEG A;  1KZG A;  2D10 A;  1TJ6 A;  3F5R A;  1UPQ A;  1U2B A;  4HB0 B;  4WSF A;  3D8E A;  2EJ8 A;  4WJ7 A;  2KUP A;  1U5E A;  1XCG A;  4HHV A;  5DHF B;  2I1J A;  2J59 M;  5DI9 B;  2D4Q A;  2DA0 A;  1V5U A;  4F7H A;  5C5B A;  1FB8 A;  1WG7 A;  5L81 A;  2I5C A;  4HB4 B;  3SUZ A;  1P3R A;  2LKO A;  5HE1 A;  3M1I B;  1DYN A;  1N3H A;  2EC1 A;  4GZU A;  2YF0 A;  2YS1 A;  2MKR A;  3FEH A;  4HB3 B;  1V5P A;  1XKE A;  3CIK A;  3T06 A;  4P7I A;  1FHO A;  2OQB A;  3PZD A;  4K17 A;  2X18 A;  4ZRJ A;  4KAX B;  1I2H A;  2N0Y A;  2J0K A;  3QBV B;  2Y8G A;  4HAX B;  2D9Z A;  1Q67 A;  2UVM A;  3DXD A;  3D8D A;  1PMS A;  2CRF A;  1ZVR A;  5C79 A;  2K2J A;  2Q13 A;  2LYD A;  3A8P A;  1TXD A;  3P7Z A;  4HAT B;  3IVF A;  2HTH B;  2AL6 A;  2RUK B;  5HE0 A;  1GG3 A;  4D0N B;  2D9W A;  1X86 A;  2D2Q A;  2H7E A;  2ELA A;  3F0W A;  1UNQ A;  4MK0 A;  4HB2 B;  2VKI A;  2QKM A;  1BWN A;  2CY5 A;  2W2X C;  2ROZ B;  2LOX A;  1W1D A;  2V76 A;  3MPX A;  5CLL B;  5J3Q A;  1ZSQ A;  1Y19 B;  1MK7 B;  3AJ4 A;  3G9W A;  4CHM A;  1P5T A;  2R09 A;  3HW2 B;  1WGU A;  3TW1 A;  2QKL A;  5DH9 B;  2D9X A;  2W2W A;  2EMS A;  1KI1 B;  1M7E A;  2YSZ A;  4HAU B;  4GXB A;  1WJ1 A;  4F7G A;  4NY0 A;  1LW3 A;  2FJL A;  2DFK A;  2UZR A;  4A6F B;  1PFJ A;  4K81 A;  3WA0 A;  2YT1 A;  4EJN A;  4MT7 A;  2Z0P A;  3AU4 A;  1W1H A;  2K2U A;  3AU5 A;  5C5B B;  3KRW A;  2HE7 A;  1QQG A;  4HAZ B;  2OTX A;  4A6F A;  1FHW A;  4IFS A;  4KHB B;  2YRY A;  1I7A A;  1Z87 A;  1J19 A;  2ADZ A;  4HAW B;  2W2X D;  4HDQ A;  1V5M A;  3U8Z A;  4WVF B;  2Y7B A;  2DX5 A;  1GC6 A;  1B55 A;  2J0J A;  3ML4 A;  1SHC A;  1FOE A;  2P8V A;  1DRO A;  3U7D A;  1IRS A;  3SV1 A;  1X1F A;  5KQ1 A;  3KRX A;  3X23 A;  3VOQ A;  2P0D A;  2D9V A;  3KZ1 A;  1Y5O A;  2DKQ A;  2COF A;  1TQZ A;  1XOD A;  4PNK A;  1M7R A;  2LG1 A;  2DYQ A;  5D3W A;  4C0A A;  1EAZ A;  2YS3 A;  3D8F A;  1OY2 A;  1FGY A;  3GYO A;  1FAO A;  4DX9 0;  2YT0 A;  5CLQ B;  2RSG A;  1U29 A;  2COD A;  4DBB A;  2GJY A;  5DHA B;  5GOW B;  2IYB A;  4HAV B;  5KQ4 A;  3A98 B;  2RNR B;  2MFQ A;  2I1K A;  2MWN B;  1WGQ A;  1OMW A;  1X05 A;  2J0M A;  3VIA A;  4GN1 A;  1BAK A;  2P0F A;  1MIX A;  1QC6 A;  2JP2 A;  2Z0O A;  3UZT A;  2COC A;  4KVG B;  3SNH A;  2RGN B;  1EVH A;  5D27 A;  2DN6 A;  4Y94 A;  3NSU A;  2IFS A;  3LJU X;  1UNP A;  5EFX A;  2DX1 A;  1FHX A;  1X11 A;  4YL8 A;  1H10 A;  2LOZ A;  3PG7 A;  2ZPY A;  4Z2M B;  2L1C A;  4K2O A;  2YS5 A;  3KSY A;  1GC7 A;  2ELB A;  1EGX A;  3N7C A;  5D3Y A;  4EKU A;  4B6H A;  4CHJ A;  1ISN A;  3QIJ A;  4CYE A;  3DXE A;  1AWE A;  4PQ0 A;  5JHG A;  1MK9 B;  4NSW A;  3FSS A;  3TFM A;  2D11 A;  2PZ1 A;  5J3T A;  1RJ2 A;  1NTY A;  2N23 A;  1DDW A;  4A6H A;  1X1G A;  1NU2 A;  3PP2 A;  4KHO A;  3TCA A;  5JP4 A;  2LUL A;  4DX8 A;  2E2X A;  5D3X A;  1SGH A;  5JLJ B;  4GMV A;  4EMO A;  4XWX A;  2VSZ A;  2KGX B;  1U27 A;  3ZVR A;  2YVC A;  1AQC A;  5HE2 A;  1V88 A;  2COA A;  2H7D A;  1BTK A;  2BCJ A;  1U5D A;  2K00 A;  5FI0 A;  3SYX A;  4DXA B;  5C16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...