2D9YA

Solution structure of the ph domain of pepp-3 from human
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
117
structure length
117
Chain Sequence
b'GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing protein family A membe
publication title Solution structure of the PH domain of PEPP-3 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9yA00
3D8FA 4Z2NA 5EFXA 1WI1A 2KUPA 3P7ZA 4IOYX 1DBHA 1FAOA 1OY2A 3U8ZA 1BTKA 3ODOA 1BWNA 3SYXA 5J3YA 4HAYB 3N7CA 2M14A 1DROA 2N23A 5J3TA 2EJ8A 1U27A 2I1KA 3CIKA 4KHBB 3WYFB 1WJMA 4C0AA 2BCJA 5CLLB 1H4RA 1P6SA 2LULA 4HAVB 1U5DA 1PLSA 3O96A 1TQZA 5C5BB 5D3VA 3AU5A 2E2XA 4CYEA 4CHJA 4GMVA 1U5FA 3MPXA 1GC6A 3U7DA 3QWMA 1RJ2A 4A6KA 3HW2B 3QBVB 1EF1A 4Z2MB 3TVVA 4WSFA 5CLQB 1W1HA 1FGZA 5C79A 3PVWA 1V5PA 5D3XA 2D9VA 2DYNA 4DXAB 1PFJA 2COCA 3DXEA 3VOQA 3D8DA 2QKMA 4MK0A 2L2IA 3AJ4A 2LKOA 3D8EA 1I7AA 5GOWB 4WVFB 2YVCA 3AU4A 4HAUB 1UPRA 3X23A 1ISNA 1XX0A 1WG7A 2D9YA 2D9XA 2OQBA 4KHOA 1QC6A 1NTYA 1MK9B 1FHOA 2CY4A 5C16A 3SO6A 3T06A 4MT7A 4L6EA 1RRPB 2Y8FA 2R0DA 2MKRA 1M7EA 1OQNA 4GZUA 2AEHA 5FI1A 4TYZA 2H7DA 5JP4A 3F5RA 4IFSA 1ZC3B 2Z0QA 1Y5OA 2RNRB 1XD4A 2DHJA 2I1JA 4EMOA 1B55A 2DLWA 2Y8GA 3TO1A 2YF0A 1UNRA 2K2UA 5KQ4A 1LW3A 2VKIA 1DYNA 4D0NB 1FOEA 3DXCA 2ROVA 3F0WA 5DI9B 1V5MA 2Z0OA 2CRFA 1KZGA 4GMXB 3FSSA 2J0KA 3PVUA 1ZSQA 1X1FA 4F7GA 2RVBB 2RUKB 5DHAB 3PVLA 4KAXB 2G35A 5JLJB 4A6FB 4IAPA 2K00A 2W2XC 1ZC4B 1V88A 3HQCA 4WJ7A 2LYDA 4KVGB 5HE2A 5KCVA 1DDMA 1FB8A 2IFSA 3ZVRA 1EAZA 4HDQA 4EJNA 3ULBA 4GPTB 1WJ1A 1NI2A 4ZRKA 4DBBA 5KQ1A 3GYOA 5L81A 2L1CA 2FJLA 2DFKA 2XQNM 1OMWA 5C5BA 5LONB 3PSCA 2W2WA 1K5GB 4P7IA 3IVFA 1BTNA 2LG1A 2GCLA 1UNPA 1FGYA 1EGXA 1MK7B 1MIXA 1ZVRA 3A98B 2ELAA 2QKLA 2YT0A 1XODA 2DHKA 4HB4B 2ZPYA 3M1IB 5D3WA 1FHXA 2CAYA 3FM8C 1XCGA 2GCJA 2I5CA 1U5EA 2MDXA 3PZDA 5JHHA 4A5KA 3LJUX 2GS0A 2NZ8B 4YL8A 4XWXA 3VIAA 2ROZB 2ADZA 2DA0A 2HE7A 2D2QA 3KSYA 3TW1A 2J59M 1BAKA 2D10A 1TXDA 1V61A 4HHVA 2K2JA 1W1DA 1XKEA 2YT1A 3OANA 2VRWB 3GYPA 2GJYA 5D27A 2JP2A 4HB2B 2DTCA 4F7UP 4GN1A 4H8SA 2DX1A 4HAZB 1NTVA 2P8VA 1X1GA 4BBKA 4ZRIA 1H10A 2J0JA 5JHGA 2Y7BA 2N0YA 4KHAA 2CY5A 2DKPA 3P6AA 1W1GA 5D3YA 1XR0B 3HK0A 5FI0A 2EMTA 4HAWB 3ML4A 4NY0A 1AQCA 2UVMA 5DH9B 2MFQA 1V89A 4PQ0A 1PMSA 2D9ZA 1QQGA 3PG7A 3RCPA 1WVHA 4HB3B 2D11A 4B6HA 1K5DB 1SGHA 3DXDA 2KGXB 1M7RA 2VSZA 4HDOA 2V76A 5HE3A 4TKNA 3FEHA 1V5UA 2MWNB 4HAXB 4DX8A 2IYBA 2P0DA 3CXBB 2I5FA 1IRSA 4EKUA 4PNKA 1GC7A 2HTHB 2RSGA 3KRXA 1AWEA 2RLOA 1N3HA 4A6HA 2COFA 1GG3A 4K2PA 4A6FA 4CHMA 1KZ7A 1TJ6A 2OTXA 2EMSA 1P5TA 2UZSA 2YS3A 1KI1B 1I2HA 5J3QA 3ULCA 2RGNB 3NSUA 2ELBA 2UZRA 3SUZA 2M38A 2DKQA 2R09A 4GXBA 3QIJA 1U29A 3SV1A 1J19A 3ODXA 3A8QA 1J0WA 1U2BA 2NMBA 4K2OA 2D4QA 3SNHA 1Y19B 5LOPB 3UZTA 2LOZA 2DYQA 3PP2A 2YSZA 4K81A 2P0FA 1NU2A 1UNQA 1X05A 2Q13A 1MAIA 4F7HA 5DIFB 3V5WA 4ZRJA 2J0MA 1SHCA 3KZ1A 1ZM0A 1Q67A 2KCJA 2YS1A 3ODWA 2PZ1A 1EVHA 2DHIA 2D9WA 5HE1A 3KRWA 3WA0A 1MKEA 1UPQA 1X86A 2YRYA 1WGQA 4HATB 3TCAA 2Z0PA 4K17A 3PEGA 1LB1A 1MIZB 1WGUA 4Y94A 1E5WA 1X11A 4HB0B 2W2XD 1U5GA 2P0HA 3BJIA 1MPHA 1P3RA 4DX90 3KY9A 2COAA 2X18A 4MY6A 5C6RA 2LOXA 3G9WA 3TFMA 3A8PA 1DDWA 4YONA 2AL6A 5HE0A 1UEFA 5DHFB 2YS5A 2EC1A 1FHWA 2CODA 3ZDTA 2DX5A 1Z87A 4NSWA 1DDVA 2H7EA 3BINA 3MDBC 2DN6A
chains in the Genus database with same CATH superfamily
3D8FA 2RRFA 4Z2NA 5EFXA 1WI1A 2KUPA 3P7ZA 4IOYX 4QXAB 1DBHA 1FAOA 1OY2A 3U8ZA 1BTKA 2YT2A 3ODOA 1BWNA 3SYXA 5J3YA 4HAYB 3N7CA 2M14A 1DROA 2N23A 5J3TA 2EJ8A 1U27A 2I1KA 3CIKA 5IRSA 4KHBB 3WYFB 4D6WA 1WJMA 4C0AA 2BCJA 5CLLB 1H4RA 1P6SA 2LULA 4HAVB 1U5DA 4CSQA 1PLSA 3O96A 1TQZA 5C5BB 5D3VA 3AU5A 2E2XA 4CYEA 4CHJA 4GMVA 1U5FA 3MPXA 1GC6A 3U7DA 4GOUA 3QWMA 1RJ2A 4A6KA 3HW2B 3QBVB 1EF1A 4Z2MB 3TVVA 2R2YA 1T77A 4QJ4B 4WSFA 5CLQB 1W1HA 1FGZA 5C79A 3PVWA 1V5PA 5D3XA 2D9VA 2DYNA 4DXAB 1PFJA 2COCA 3DXEA 3VOQA 3D8DA 2QKMA 2K8EA 4MK0A 2L2IA 3AJ4A 2LKOA 3D8EA 1I7AA 5GOWB 4WVFB 2YVCA 3AU4A 4OT1A 4HAUB 1UPRA 3X23A 1ISNA 1XX0A 1WG7A 2D9YA 2D9XA 3DCXA 3FVCA 2OQBA 4KHOA 3NW8A 1QC6A 1NTYA 1MK9B 1FHOA 3A58A 2CY4A 5C16A 3SO6A 3T06A 4MT7A 4L6EA 1RRPB 3HIEA 2Y8FA 2R0DA 2MKRA 1M7EA 1OQNA 4GZUA 2AEHA 5FI1A 4TYZA 2H7DA 5JP4A 3NWFA 3F5RA 4IFSA 1ZC3B 2Z0QA 1Y5OA 2RNRB 1XD4A 2DHJA 2I1JA 4EMOA 1B55A 2DLWA 2Y8GA 3TO1A 2YF0A 1UNRA 2K2UA 5KQ4A 1LW3A 2VKIA 1DYNA 1ZYIA 4D0NB 1FOEA 3DXCA 2ROVA 3F0WA 5DI9B 1V5MA 2Z0OA 2CRFA 1KZGA 4GMXB 3FSSA 2J0KA 2NBVA 3PVUA 1ZSQA 1X1FA 4F7GA 2RVBB 2RUKB 2Z59A 5DHAB 3PVLA 4KAXB 2G35A 5JLJB 4A6FB 4IAPA 2K00A 2W2XC 1ZC4B 1V88A 3HQCA 4KHBA 4WJ7A 2LYDA 4KVGB 5HE2A 5KCVA 1DDMA 1FB8A 2IFSA 3NWDA 3ZVRA 1EAZA 4HDQA 4EJNA 3ULBA 4GPTB 3B77A 1WJ1A 1NI2A 4ZRKA 4DBBA 5KQ1A 3GYOA 5L81A 2L1CA 2FJLA 2DFKA 2XQNM 1OMWA 5C5BA 5LONB 3PSCA 2W2WA 1K5GB 4P7IA 3IVFA 1BTNA 2LG1A 2GCLA 1UNPA 1FGYA 1EGXA 1MK7B 1MIXA 1ZVRA 3A98B 2ELAA 2Z14A 2QKLA 2YT0A 1XODA 2DHKA 4HB4B 2ZPYA 3M1IB 5D3WA 1FHXA 2CAYA 3FM8C 1XCGA 2GCJA 2I5CA 1U5EA 2MDXA 3PZDA 5JHHA 4A5KA 3LJUX 2GS0A 2Z13A 2NZ8B 4YL8A 4XWXA 3VIAA 2ROZB 2ADZA 2DA0A 2HE7A 2D2QA 3KSYA 3TW1A 2J59M 1BAKA 2D10A 1TXDA 1V61A 4HHVA 2K2JA 1W1DA 1XKEA 2YT1A 3OANA 2VRWB 3GYPA 2GJYA 5D27A 2JP2A 4HB2B 2DTCA 4GNKB 4F7UP 4GN1A 1MI1A 4H8SA 2DX1A 4HAZB 1NTVA 2P8VA 2KIGA 1X1GA 4BBKA 4ZRIA 1H10A 2J0JA 5JHGA 2Y7BA 2N0YA 5I2SA 4KHAA 2CY5A 2DKPA 3P6AA 1W1GA 5D3YA 3U12A 1XR0B 3HK0A 5FI0A 2EMTA 4HAWB 3ML4A 4NY0A 1AQCA 2UVMA 5DH9B 2MFQA 1V89A 4PQ0A 1PMSA 2D9ZA 1QQGA 3PG7A 3RCPA 2KIEA 1WVHA 4HB3B 2D11A 4B6HA 1K5DB 1SGHA 3DXDA 2KUQA 2KGXB 1M7RA 2VSZA 4HDOA 2V76A 5HE3A 4TKNA 3FEHA 1V5UA 2MWNB 4HAXB 4DX8A 2IYBA 2P0DA 3CXBB 2I5FA 1IRSA 2KR0A 4EKUA 4DIXA 2ZKMX 3HSAA 4PNKA 1GC7A 2GUMA 2HTHB 2RSGA 3KRXA 1AWEA 2RLOA 5I2MA 1N3HA 4A6HA 2COFA 3NWAA 1GG3A 4K2PA 4A6FA 4CHMA 1KZ7A 1TJ6A 2OTXA 2EMSA 1P5TA 2UZSA 2YS3A 1KI1B 1I2HA 5J3QA 3ULCA 2RGNB 3NSUA 2ELBA 2UZRA 3SUZA 2M38A 2DKQA 2R09A 4GXBA 3QIJA 1U29A 5M4YB 3SV1A 1J19A 3ODXA 3A8QA 1J0WA 1U2BA 2NMBA 4K2OA 2D4QA 3SNHA 1Y19B 4L1RA 4OSNA 5LOPB 3UZTA 2LOZA 2DYQA 3PP2A 2YSZA 4K81A 2P0FA 1NU2A 1UNQA 1X05A 2Q13A 1MAIA 4F7HA 4HSIA 5DIFB 3V5WA 4ZRJA 2J0MA 1SHCA 3KZ1A 5LG4B 1ZM0A 1Q67A 2KCJA 2YS1A 3ODWA 2PZ1A 1EVHA 2DHIA 2D9WA 5HE1A 3KRWA 3WA0A 1MKEA 1UPQA 1X86A 2YRYA 1WGQA 4HATB 3TCAA 2Z0PA 4K17A 3PEGA 1LB1A 1MIZB 1WGUA 4Y94A 1E5WA 1X11A 4QJ5B 4HB0B 2W2XD 1U5GA 2P0HA 3BJIA 1MPHA 1P3RA 4DX90 3KY9A 2COAA 2X18A 4MY6A 5C6RA 2Z4DA 3OHMB 2LOXA 3G9WA 4QJ3B 3TFMA 3A8PA 2K49A 1DDWA 2FJUB 4YONA 2AL6A 5HE0A 1UEFA 5DHFB 2YS5A 2EC1A 1FHWA 2CODA 3ZDTA 2DX5A 1Z87A 4NSWA 1DDVA 2H7EA 3BINA 3MDBC 2DN6A
chains in the Genus database with same CATH topology
3D8FA 4Z2NA 5EFXA 1WI1A 2KUPA 3P7ZA 4IOYX 1DBHA 1FAOA 1OY2A 3U8ZA 1BTKA 3ODOA 1BWNA 3SYXA 5J3YA 4HAYB 3N7CA 2M14A 1DROA 2N23A 5J3TA 2EJ8A 1U27A 2I1KA 3CIKA 4KHBB 3WYFB 1WJMA 4C0AA 2BCJA 5CLLB 1H4RA 1P6SA 2LULA 4HAVB 1U5DA 1PLSA 3O96A 1TQZA 5C5BB 5D3VA 3AU5A 2E2XA 4CYEA 4CHJA 4GMVA 1U5FA 3MPXA 1GC6A 3U7DA 3QWMA 1RJ2A 4A6KA 3HW2B 3QBVB 1EF1A 4Z2MB 3TVVA 4WSFA 5CLQB 1W1HA 1FGZA 5C79A 3PVWA 1V5PA 5D3XA 2D9VA 2DYNA 4DXAB 1PFJA 2COCA 3DXEA 3VOQA 3D8DA 2QKMA 4MK0A 2L2IA 3AJ4A 2LKOA 3D8EA 1I7AA 5GOWB 4WVFB 2YVCA 3AU4A 4HAUB 1UPRA 3X23A 1ISNA 1XX0A 1WG7A 2D9YA 2D9XA 2OQBA 4KHOA 1QC6A 1NTYA 1MK9B 1FHOA 2CY4A 5C16A 3SO6A 3T06A 4MT7A 4L6EA 1RRPB 2Y8FA 2R0DA 2MKRA 1M7EA 1OQNA 4GZUA 2AEHA 5FI1A 4TYZA 2H7DA 5JP4A 3F5RA 4IFSA 1ZC3B 2Z0QA 1Y5OA 2RNRB 1XD4A 2DHJA 2I1JA 4EMOA 1B55A 2DLWA 2Y8GA 3TO1A 2YF0A 1UNRA 2K2UA 5KQ4A 1LW3A 2VKIA 1DYNA 4D0NB 1FOEA 3DXCA 2ROVA 3F0WA 5DI9B 1V5MA 2Z0OA 2CRFA 1KZGA 4GMXB 3FSSA 2J0KA 3PVUA 1ZSQA 1X1FA 4F7GA 2RVBB 2RUKB 5DHAB 3PVLA 4KAXB 2G35A 5JLJB 4A6FB 4IAPA 2K00A 2W2XC 1ZC4B 1V88A 3HQCA 4WJ7A 2LYDA 4KVGB 5HE2A 5KCVA 1DDMA 1FB8A 2IFSA 3ZVRA 1EAZA 4HDQA 4EJNA 3ULBA 4GPTB 1WJ1A 1NI2A 4ZRKA 4DBBA 5KQ1A 3GYOA 5L81A 2L1CA 2FJLA 2DFKA 2XQNM 1OMWA 5C5BA 5LONB 3PSCA 2W2WA 1K5GB 4P7IA 3IVFA 1BTNA 2LG1A 2GCLA 1UNPA 1FGYA 1EGXA 1MK7B 1MIXA 1ZVRA 3A98B 2ELAA 2QKLA 2YT0A 1XODA 2DHKA 4HB4B 2ZPYA 3M1IB 5D3WA 1FHXA 2CAYA 3FM8C 1XCGA 2GCJA 2I5CA 1U5EA 2MDXA 3PZDA 5JHHA 4A5KA 3LJUX 2GS0A 2NZ8B 4YL8A 4XWXA 3VIAA 2ROZB 2ADZA 2DA0A 2HE7A 2D2QA 3KSYA 3TW1A 2J59M 1BAKA 2D10A 1TXDA 1V61A 4HHVA 2K2JA 1W1DA 1XKEA 2YT1A 3OANA 2VRWB 3GYPA 2GJYA 5D27A 2JP2A 4HB2B 2DTCA 4F7UP 4GN1A 4H8SA 2DX1A 4HAZB 1NTVA 2P8VA 1X1GA 4BBKA 4ZRIA 1H10A 2J0JA 5JHGA 2Y7BA 2N0YA 4KHAA 2CY5A 2DKPA 3P6AA 1W1GA 5D3YA 1XR0B 3HK0A 5FI0A 2EMTA 4HAWB 3ML4A 4NY0A 1AQCA 2UVMA 5DH9B 2MFQA 1V89A 4PQ0A 1PMSA 2D9ZA 1QQGA 3PG7A 3RCPA 1WVHA 4HB3B 2D11A 4B6HA 1K5DB 1SGHA 3DXDA 2KGXB 1M7RA 2VSZA 4HDOA 2V76A 5HE3A 4TKNA 3FEHA 1V5UA 2MWNB 4HAXB 4DX8A 2IYBA 2P0DA 3CXBB 2I5FA 1IRSA 4EKUA 4PNKA 1GC7A 2HTHB 2RSGA 3KRXA 1AWEA 2RLOA 1N3HA 4A6HA 2COFA 1GG3A 4K2PA 4A6FA 4CHMA 1KZ7A 1TJ6A 2OTXA 2EMSA 1P5TA 2UZSA 2YS3A 1KI1B 1I2HA 5J3QA 3ULCA 2RGNB 3NSUA 2ELBA 2UZRA 3SUZA 2M38A 2DKQA 2R09A 4GXBA 3QIJA 1U29A 3SV1A 1J19A 3ODXA 3A8QA 1J0WA 1U2BA 2NMBA 4K2OA 2D4QA 3SNHA 1Y19B 5LOPB 3UZTA 2LOZA 2DYQA 3PP2A 2YSZA 4K81A 2P0FA 1NU2A 1UNQA 1X05A 2Q13A 1MAIA 4F7HA 5DIFB 3V5WA 4ZRJA 2J0MA 1SHCA 3KZ1A 1ZM0A 1Q67A 2KCJA 2YS1A 3ODWA 2PZ1A 1EVHA 2DHIA 2D9WA 5HE1A 3KRWA 3WA0A 1MKEA 1UPQA 1X86A 2YRYA 1WGQA 4HATB 3TCAA 2Z0PA 4K17A 3PEGA 1LB1A 1MIZB 1WGUA 4Y94A 1E5WA 1X11A 4HB0B 2W2XD 1U5GA 2P0HA 3BJIA 1MPHA 1P3RA 4DX90 3KY9A 2COAA 2X18A 4MY6A 5C6RA 2LOXA 3G9WA 3TFMA 3A8PA 1DDWA 4YONA 2AL6A 5HE0A 1UEFA 5DHFB 2YS5A 2EC1A 1FHWA 2CODA 3ZDTA 2DX5A 1Z87A 4NSWA 1DDVA 2H7EA 3BINA 3MDBC 2DN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8F A;  4Z2N A;  5EFX A;  1WI1 A;  2KUP A;  3P7Z A;  4IOY X;  1DBH A;  1FAO A;  1OY2 A;  3U8Z A;  1BTK A;  3ODO A;  1BWN A;  3SYX A;  5J3Y A;  4HAY B;  3N7C A;  2M14 A;  1DRO A;  2N23 A;  5J3T A;  2EJ8 A;  1U27 A;  2I1K A;  3CIK A;  4KHB B;  3WYF B;  1WJM A;  4C0A A;  2BCJ A;  5CLL B;  1H4R A;  1P6S A;  2LUL A;  4HAV B;  1U5D A;  1PLS A;  3O96 A;  1TQZ A;  5C5B B;  5D3V A;  3AU5 A;  2E2X A;  4CYE A;  4CHJ A;  4GMV A;  1U5F A;  3MPX A;  1GC6 A;  3U7D A;  3QWM A;  1RJ2 A;  4A6K A;  3HW2 B;  3QBV B;  1EF1 A;  4Z2M B;  3TVV A;  4WSF A;  5CLQ B;  1W1H A;  1FGZ A;  5C79 A;  3PVW A;  1V5P A;  5D3X A;  2D9V A;  2DYN A;  4DXA B;  1PFJ A;  2COC A;  3DXE A;  3VOQ A;  3D8D A;  2QKM A;  4MK0 A;  2L2I A;  3AJ4 A;  2LKO A;  3D8E A;  1I7A A;  5GOW B;  4WVF B;  2YVC A;  3AU4 A;  4HAU B;  1UPR A;  3X23 A;  1ISN A;  1XX0 A;  1WG7 A;  2D9Y A;  2D9X A;  2OQB A;  4KHO A;  1QC6 A;  1NTY A;  1MK9 B;  1FHO A;  2CY4 A;  5C16 A;  3SO6 A;  3T06 A;  4MT7 A;  4L6E A;  1RRP B;  2Y8F A;  2R0D A;  2MKR A;  1M7E A;  1OQN A;  4GZU A;  2AEH A;  5FI1 A;  4TYZ A;  2H7D A;  5JP4 A;  3F5R A;  4IFS A;  1ZC3 B;  2Z0Q A;  1Y5O A;  2RNR B;  1XD4 A;  2DHJ A;  2I1J A;  4EMO A;  1B55 A;  2DLW A;  2Y8G A;  3TO1 A;  2YF0 A;  1UNR A;  2K2U A;  5KQ4 A;  1LW3 A;  2VKI A;  1DYN A;  4D0N B;  1FOE A;  3DXC A;  2ROV A;  3F0W A;  5DI9 B;  1V5M A;  2Z0O A;  2CRF A;  1KZG A;  4GMX B;  3FSS A;  2J0K A;  3PVU A;  1ZSQ A;  1X1F A;  4F7G A;  2RVB B;  2RUK B;  5DHA B;  3PVL A;  4KAX B;  2G35 A;  5JLJ B;  4A6F B;  4IAP A;  2K00 A;  2W2X C;  1ZC4 B;  1V88 A;  3HQC A;  4WJ7 A;  2LYD A;  4KVG B;  5HE2 A;  5KCV A;  1DDM A;  1FB8 A;  2IFS A;  3ZVR A;  1EAZ A;  4HDQ A;  4EJN A;  3ULB A;  4GPT B;  1WJ1 A;  1NI2 A;  4ZRK A;  4DBB A;  5KQ1 A;  3GYO A;  5L81 A;  2L1C A;  2FJL A;  2DFK A;  2XQN M;  1OMW A;  5C5B A;  5LON B;  3PSC A;  2W2W A;  1K5G B;  4P7I A;  3IVF A;  1BTN A;  2LG1 A;  2GCL A;  1UNP A;  1FGY A;  1EGX A;  1MK7 B;  1MIX A;  1ZVR A;  3A98 B;  2ELA A;  2QKL A;  2YT0 A;  1XOD A;  2DHK A;  4HB4 B;  2ZPY A;  3M1I B;  5D3W A;  1FHX A;  2CAY A;  3FM8 C;  1XCG A;  2GCJ A;  2I5C A;  1U5E A;  2MDX A;  3PZD A;  5JHH A;  4A5K A;  3LJU X;  2GS0 A;  2NZ8 B;  4YL8 A;  4XWX A;  3VIA A;  2ROZ B;  2ADZ A;  2DA0 A;  2HE7 A;  2D2Q A;  3KSY A;  3TW1 A;  2J59 M;  1BAK A;  2D10 A;  1TXD A;  1V61 A;  4HHV A;  2K2J A;  1W1D A;  1XKE A;  2YT1 A;  3OAN A;  2VRW B;  3GYP A;  2GJY A;  5D27 A;  2JP2 A;  4HB2 B;  2DTC A;  4F7U P;  4GN1 A;  4H8S A;  2DX1 A;  4HAZ B;  1NTV A;  2P8V A;  1X1G A;  4BBK A;  4ZRI A;  1H10 A;  2J0J A;  5JHG A;  2Y7B A;  2N0Y A;  4KHA A;  2CY5 A;  2DKP A;  3P6A A;  1W1G A;  5D3Y A;  1XR0 B;  3HK0 A;  5FI0 A;  2EMT A;  4HAW B;  3ML4 A;  4NY0 A;  1AQC A;  2UVM A;  5DH9 B;  2MFQ A;  1V89 A;  4PQ0 A;  1PMS A;  2D9Z A;  1QQG A;  3PG7 A;  3RCP A;  1WVH A;  4HB3 B;  2D11 A;  4B6H A;  1K5D B;  1SGH A;  3DXD A;  2KGX B;  1M7R A;  2VSZ A;  4HDO A;  2V76 A;  5HE3 A;  4TKN A;  3FEH A;  1V5U A;  2MWN B;  4HAX B;  4DX8 A;  2IYB A;  2P0D A;  3CXB B;  2I5F A;  1IRS A;  4EKU A;  4PNK A;  1GC7 A;  2HTH B;  2RSG A;  3KRX A;  1AWE A;  2RLO A;  1N3H A;  4A6H A;  2COF A;  1GG3 A;  4K2P A;  4A6F A;  4CHM A;  1KZ7 A;  1TJ6 A;  2OTX A;  2EMS A;  1P5T A;  2UZS A;  2YS3 A;  1KI1 B;  1I2H A;  5J3Q A;  3ULC A;  2RGN B;  3NSU A;  2ELB A;  2UZR A;  3SUZ A;  2M38 A;  2DKQ A;  2R09 A;  4GXB A;  3QIJ A;  1U29 A;  3SV1 A;  1J19 A;  3ODX A;  3A8Q A;  1J0W A;  1U2B A;  2NMB A;  4K2O A;  2D4Q A;  3SNH A;  1Y19 B;  5LOP B;  3UZT A;  2LOZ A;  2DYQ A;  3PP2 A;  2YSZ A;  4K81 A;  2P0F A;  1NU2 A;  1UNQ A;  1X05 A;  2Q13 A;  1MAI A;  4F7H A;  5DIF B;  3V5W A;  4ZRJ A;  2J0M A;  1SHC A;  3KZ1 A;  1ZM0 A;  1Q67 A;  2KCJ A;  2YS1 A;  3ODW A;  2PZ1 A;  1EVH A;  2DHI A;  2D9W A;  5HE1 A;  3KRW A;  3WA0 A;  1MKE A;  1UPQ A;  1X86 A;  2YRY A;  1WGQ A;  4HAT B;  3TCA A;  2Z0P A;  4K17 A;  3PEG A;  1LB1 A;  1MIZ B;  1WGU A;  4Y94 A;  1E5W A;  1X11 A;  4HB0 B;  2W2X D;  1U5G A;  2P0H A;  3BJI A;  1MPH A;  1P3R A;  4DX9 0;  3KY9 A;  2COA A;  2X18 A;  4MY6 A;  5C6R A;  2LOX A;  3G9W A;  3TFM A;  3A8P A;  1DDW A;  4YON A;  2AL6 A;  5HE0 A;  1UEF A;  5DHF B;  2YS5 A;  2EC1 A;  1FHW A;  2COD A;  3ZDT A;  2DX5 A;  1Z87 A;  4NSW A;  1DDV A;  2H7E A;  3BIN A;  3MDB C;  2DN6 A; 
#chains in the Genus database with same CATH topology
 3D8F A;  2RRF A;  4Z2N A;  5EFX A;  1WI1 A;  2KUP A;  3P7Z A;  4IOY X;  4QXA B;  1DBH A;  1FAO A;  1OY2 A;  3U8Z A;  1BTK A;  2YT2 A;  3ODO A;  1BWN A;  3SYX A;  5J3Y A;  4HAY B;  3N7C A;  2M14 A;  1DRO A;  2N23 A;  5J3T A;  2EJ8 A;  1U27 A;  2I1K A;  3CIK A;  5IRS A;  4KHB B;  3WYF B;  4D6W A;  1WJM A;  4C0A A;  2BCJ A;  5CLL B;  1H4R A;  1P6S A;  2LUL A;  4HAV B;  1U5D A;  4CSQ A;  1PLS A;  3O96 A;  1TQZ A;  5C5B B;  5D3V A;  3AU5 A;  2E2X A;  4CYE A;  4CHJ A;  4GMV A;  1U5F A;  3MPX A;  1GC6 A;  3U7D A;  4GOU A;  3QWM A;  1RJ2 A;  4A6K A;  3HW2 B;  3QBV B;  1EF1 A;  4Z2M B;  3TVV A;  2R2Y A;  1T77 A;  4QJ4 B;  4WSF A;  5CLQ B;  1W1H A;  1FGZ A;  5C79 A;  3PVW A;  1V5P A;  5D3X A;  2D9V A;  2DYN A;  4DXA B;  1PFJ A;  2COC A;  3DXE A;  3VOQ A;  3D8D A;  2QKM A;  2K8E A;  4MK0 A;  2L2I A;  3AJ4 A;  2LKO A;  3D8E A;  1I7A A;  5GOW B;  4WVF B;  2YVC A;  3AU4 A;  4OT1 A;  4HAU B;  1UPR A;  3X23 A;  1ISN A;  1XX0 A;  1WG7 A;  2D9Y A;  2D9X A;  3DCX A;  3FVC A;  2OQB A;  4KHO A;  3NW8 A;  1QC6 A;  1NTY A;  1MK9 B;  1FHO A;  3A58 A;  2CY4 A;  5C16 A;  3SO6 A;  3T06 A;  4MT7 A;  4L6E A;  1RRP B;  3HIE A;  2Y8F A;  2R0D A;  2MKR A;  1M7E A;  1OQN A;  4GZU A;  2AEH A;  5FI1 A;  4TYZ A;  2H7D A;  5JP4 A;  3NWF A;  3F5R A;  4IFS A;  1ZC3 B;  2Z0Q A;  1Y5O A;  2RNR B;  1XD4 A;  2DHJ A;  2I1J A;  4EMO A;  1B55 A;  2DLW A;  2Y8G A;  3TO1 A;  2YF0 A;  1UNR A;  2K2U A;  5KQ4 A;  1LW3 A;  2VKI A;  1DYN A;  1ZYI A;  4D0N B;  1FOE A;  3DXC A;  2ROV A;  3F0W A;  5DI9 B;  1V5M A;  2Z0O A;  2CRF A;  1KZG A;  4GMX B;  3FSS A;  2J0K A;  2NBV A;  3PVU A;  1ZSQ A;  1X1F A;  4F7G A;  2RVB B;  2RUK B;  2Z59 A;  5DHA B;  3PVL A;  4KAX B;  2G35 A;  5JLJ B;  4A6F B;  4IAP A;  2K00 A;  2W2X C;  1ZC4 B;  1V88 A;  3HQC A;  4KHB A;  4WJ7 A;  2LYD A;  4KVG B;  5HE2 A;  5KCV A;  1DDM A;  1FB8 A;  2IFS A;  3NWD A;  3ZVR A;  1EAZ A;  4HDQ A;  4EJN A;  3ULB A;  4GPT B;  3B77 A;  1WJ1 A;  1NI2 A;  4ZRK A;  4DBB A;  5KQ1 A;  3GYO A;  5L81 A;  2L1C A;  2FJL A;  2DFK A;  2XQN M;  1OMW A;  5C5B A;  5LON B;  3PSC A;  2W2W A;  1K5G B;  4P7I A;  3IVF A;  1BTN A;  2LG1 A;  2GCL A;  1UNP A;  1FGY A;  1EGX A;  1MK7 B;  1MIX A;  1ZVR A;  3A98 B;  2ELA A;  2Z14 A;  2QKL A;  2YT0 A;  1XOD A;  2DHK A;  4HB4 B;  2ZPY A;  3M1I B;  5D3W A;  1FHX A;  2CAY A;  3FM8 C;  1XCG A;  2GCJ A;  2I5C A;  1U5E A;  2MDX A;  3PZD A;  5JHH A;  4A5K A;  3LJU X;  2GS0 A;  2Z13 A;  2NZ8 B;  4YL8 A;  4XWX A;  3VIA A;  2ROZ B;  2ADZ A;  2DA0 A;  2HE7 A;  2D2Q A;  3KSY A;  3TW1 A;  2J59 M;  1BAK A;  2D10 A;  1TXD A;  1V61 A;  4HHV A;  2K2J A;  1W1D A;  1XKE A;  2YT1 A;  3OAN A;  2VRW B;  3GYP A;  2GJY A;  5D27 A;  2JP2 A;  4HB2 B;  2DTC A;  4GNK B;  4F7U P;  4GN1 A;  1MI1 A;  4H8S A;  2DX1 A;  4HAZ B;  1NTV A;  2P8V A;  2KIG A;  1X1G A;  4BBK A;  4ZRI A;  1H10 A;  2J0J A;  5JHG A;  2Y7B A;  2N0Y A;  5I2S A;  4KHA A;  2CY5 A;  2DKP A;  3P6A A;  1W1G A;  5D3Y A;  3U12 A;  1XR0 B;  3HK0 A;  5FI0 A;  2EMT A;  4HAW B;  3ML4 A;  4NY0 A;  1AQC A;  2UVM A;  5DH9 B;  2MFQ A;  1V89 A;  4PQ0 A;  1PMS A;  2D9Z A;  1QQG A;  3PG7 A;  3RCP A;  2KIE A;  1WVH A;  4HB3 B;  2D11 A;  4B6H A;  1K5D B;  1SGH A;  3DXD A;  2KUQ A;  2KGX B;  1M7R A;  2VSZ A;  4HDO A;  2V76 A;  5HE3 A;  4TKN A;  3FEH A;  1V5U A;  2MWN B;  4HAX B;  4DX8 A;  2IYB A;  2P0D A;  3CXB B;  2I5F A;  1IRS A;  2KR0 A;  4EKU A;  4DIX A;  2ZKM X;  3HSA A;  4PNK A;  1GC7 A;  2GUM A;  2HTH B;  2RSG A;  3KRX A;  1AWE A;  2RLO A;  5I2M A;  1N3H A;  4A6H A;  2COF A;  3NWA A;  1GG3 A;  4K2P A;  4A6F A;  4CHM A;  1KZ7 A;  1TJ6 A;  2OTX A;  2EMS A;  1P5T A;  2UZS A;  2YS3 A;  1KI1 B;  1I2H A;  5J3Q A;  3ULC A;  2RGN B;  3NSU A;  2ELB A;  2UZR A;  3SUZ A;  2M38 A;  2DKQ A;  2R09 A;  4GXB A;  3QIJ A;  1U29 A;  5M4Y B;  3SV1 A;  1J19 A;  3ODX A;  3A8Q A;  1J0W A;  1U2B A;  2NMB A;  4K2O A;  2D4Q A;  3SNH A;  1Y19 B;  4L1R A;  4OSN A;  5LOP B;  3UZT A;  2LOZ A;  2DYQ A;  3PP2 A;  2YSZ A;  4K81 A;  2P0F A;  1NU2 A;  1UNQ A;  1X05 A;  2Q13 A;  1MAI A;  4F7H A;  4HSI A;  5DIF B;  3V5W A;  4ZRJ A;  2J0M A;  1SHC A;  3KZ1 A;  5LG4 B;  1ZM0 A;  1Q67 A;  2KCJ A;  2YS1 A;  3ODW A;  2PZ1 A;  1EVH A;  2DHI A;  2D9W A;  5HE1 A;  3KRW A;  3WA0 A;  1MKE A;  1UPQ A;  1X86 A;  2YRY A;  1WGQ A;  4HAT B;  3TCA A;  2Z0P A;  4K17 A;  3PEG A;  1LB1 A;  1MIZ B;  1WGU A;  4Y94 A;  1E5W A;  1X11 A;  4QJ5 B;  4HB0 B;  2W2X D;  1U5G A;  2P0H A;  3BJI A;  1MPH A;  1P3R A;  4DX9 0;  3KY9 A;  2COA A;  2X18 A;  4MY6 A;  5C6R A;  2Z4D A;  3OHM B;  2LOX A;  3G9W A;  4QJ3 B;  3TFM A;  3A8P A;  2K49 A;  1DDW A;  2FJU B;  4YON A;  2AL6 A;  5HE0 A;  1UEF A;  5DHF B;  2YS5 A;  2EC1 A;  1FHW A;  2COD A;  3ZDT A;  2DX5 A;  1Z87 A;  4NSW A;  1DDV A;  2H7E A;  3BIN A;  3MDB C;  2DN6 A; 
#chains in the Genus database with same CATH homology
 3D8F A;  4Z2N A;  5EFX A;  1WI1 A;  2KUP A;  3P7Z A;  4IOY X;  1DBH A;  1FAO A;  1OY2 A;  3U8Z A;  1BTK A;  3ODO A;  1BWN A;  3SYX A;  5J3Y A;  4HAY B;  3N7C A;  2M14 A;  1DRO A;  2N23 A;  5J3T A;  2EJ8 A;  1U27 A;  2I1K A;  3CIK A;  4KHB B;  3WYF B;  1WJM A;  4C0A A;  2BCJ A;  5CLL B;  1H4R A;  1P6S A;  2LUL A;  4HAV B;  1U5D A;  1PLS A;  3O96 A;  1TQZ A;  5C5B B;  5D3V A;  3AU5 A;  2E2X A;  4CYE A;  4CHJ A;  4GMV A;  1U5F A;  3MPX A;  1GC6 A;  3U7D A;  3QWM A;  1RJ2 A;  4A6K A;  3HW2 B;  3QBV B;  1EF1 A;  4Z2M B;  3TVV A;  4WSF A;  5CLQ B;  1W1H A;  1FGZ A;  5C79 A;  3PVW A;  1V5P A;  5D3X A;  2D9V A;  2DYN A;  4DXA B;  1PFJ A;  2COC A;  3DXE A;  3VOQ A;  3D8D A;  2QKM A;  4MK0 A;  2L2I A;  3AJ4 A;  2LKO A;  3D8E A;  1I7A A;  5GOW B;  4WVF B;  2YVC A;  3AU4 A;  4HAU B;  1UPR A;  3X23 A;  1ISN A;  1XX0 A;  1WG7 A;  2D9Y A;  2D9X A;  2OQB A;  4KHO A;  1QC6 A;  1NTY A;  1MK9 B;  1FHO A;  2CY4 A;  5C16 A;  3SO6 A;  3T06 A;  4MT7 A;  4L6E A;  1RRP B;  2Y8F A;  2R0D A;  2MKR A;  1M7E A;  1OQN A;  4GZU A;  2AEH A;  5FI1 A;  4TYZ A;  2H7D A;  5JP4 A;  3F5R A;  4IFS A;  1ZC3 B;  2Z0Q A;  1Y5O A;  2RNR B;  1XD4 A;  2DHJ A;  2I1J A;  4EMO A;  1B55 A;  2DLW A;  2Y8G A;  3TO1 A;  2YF0 A;  1UNR A;  2K2U A;  5KQ4 A;  1LW3 A;  2VKI A;  1DYN A;  4D0N B;  1FOE A;  3DXC A;  2ROV A;  3F0W A;  5DI9 B;  1V5M A;  2Z0O A;  2CRF A;  1KZG A;  4GMX B;  3FSS A;  2J0K A;  3PVU A;  1ZSQ A;  1X1F A;  4F7G A;  2RVB B;  2RUK B;  5DHA B;  3PVL A;  4KAX B;  2G35 A;  5JLJ B;  4A6F B;  4IAP A;  2K00 A;  2W2X C;  1ZC4 B;  1V88 A;  3HQC A;  4WJ7 A;  2LYD A;  4KVG B;  5HE2 A;  5KCV A;  1DDM A;  1FB8 A;  2IFS A;  3ZVR A;  1EAZ A;  4HDQ A;  4EJN A;  3ULB A;  4GPT B;  1WJ1 A;  1NI2 A;  4ZRK A;  4DBB A;  5KQ1 A;  3GYO A;  5L81 A;  2L1C A;  2FJL A;  2DFK A;  2XQN M;  1OMW A;  5C5B A;  5LON B;  3PSC A;  2W2W A;  1K5G B;  4P7I A;  3IVF A;  1BTN A;  2LG1 A;  2GCL A;  1UNP A;  1FGY A;  1EGX A;  1MK7 B;  1MIX A;  1ZVR A;  3A98 B;  2ELA A;  2QKL A;  2YT0 A;  1XOD A;  2DHK A;  4HB4 B;  2ZPY A;  3M1I B;  5D3W A;  1FHX A;  2CAY A;  3FM8 C;  1XCG A;  2GCJ A;  2I5C A;  1U5E A;  2MDX A;  3PZD A;  5JHH A;  4A5K A;  3LJU X;  2GS0 A;  2NZ8 B;  4YL8 A;  4XWX A;  3VIA A;  2ROZ B;  2ADZ A;  2DA0 A;  2HE7 A;  2D2Q A;  3KSY A;  3TW1 A;  2J59 M;  1BAK A;  2D10 A;  1TXD A;  1V61 A;  4HHV A;  2K2J A;  1W1D A;  1XKE A;  2YT1 A;  3OAN A;  2VRW B;  3GYP A;  2GJY A;  5D27 A;  2JP2 A;  4HB2 B;  2DTC A;  4F7U P;  4GN1 A;  4H8S A;  2DX1 A;  4HAZ B;  1NTV A;  2P8V A;  1X1G A;  4BBK A;  4ZRI A;  1H10 A;  2J0J A;  5JHG A;  2Y7B A;  2N0Y A;  4KHA A;  2CY5 A;  2DKP A;  3P6A A;  1W1G A;  5D3Y A;  1XR0 B;  3HK0 A;  5FI0 A;  2EMT A;  4HAW B;  3ML4 A;  4NY0 A;  1AQC A;  2UVM A;  5DH9 B;  2MFQ A;  1V89 A;  4PQ0 A;  1PMS A;  2D9Z A;  1QQG A;  3PG7 A;  3RCP A;  1WVH A;  4HB3 B;  2D11 A;  4B6H A;  1K5D B;  1SGH A;  3DXD A;  2KGX B;  1M7R A;  2VSZ A;  4HDO A;  2V76 A;  5HE3 A;  4TKN A;  3FEH A;  1V5U A;  2MWN B;  4HAX B;  4DX8 A;  2IYB A;  2P0D A;  3CXB B;  2I5F A;  1IRS A;  4EKU A;  4PNK A;  1GC7 A;  2HTH B;  2RSG A;  3KRX A;  1AWE A;  2RLO A;  1N3H A;  4A6H A;  2COF A;  1GG3 A;  4K2P A;  4A6F A;  4CHM A;  1KZ7 A;  1TJ6 A;  2OTX A;  2EMS A;  1P5T A;  2UZS A;  2YS3 A;  1KI1 B;  1I2H A;  5J3Q A;  3ULC A;  2RGN B;  3NSU A;  2ELB A;  2UZR A;  3SUZ A;  2M38 A;  2DKQ A;  2R09 A;  4GXB A;  3QIJ A;  1U29 A;  3SV1 A;  1J19 A;  3ODX A;  3A8Q A;  1J0W A;  1U2B A;  2NMB A;  4K2O A;  2D4Q A;  3SNH A;  1Y19 B;  5LOP B;  3UZT A;  2LOZ A;  2DYQ A;  3PP2 A;  2YSZ A;  4K81 A;  2P0F A;  1NU2 A;  1UNQ A;  1X05 A;  2Q13 A;  1MAI A;  4F7H A;  5DIF B;  3V5W A;  4ZRJ A;  2J0M A;  1SHC A;  3KZ1 A;  1ZM0 A;  1Q67 A;  2KCJ A;  2YS1 A;  3ODW A;  2PZ1 A;  1EVH A;  2DHI A;  2D9W A;  5HE1 A;  3KRW A;  3WA0 A;  1MKE A;  1UPQ A;  1X86 A;  2YRY A;  1WGQ A;  4HAT B;  3TCA A;  2Z0P A;  4K17 A;  3PEG A;  1LB1 A;  1MIZ B;  1WGU A;  4Y94 A;  1E5W A;  1X11 A;  4HB0 B;  2W2X D;  1U5G A;  2P0H A;  3BJI A;  1MPH A;  1P3R A;  4DX9 0;  3KY9 A;  2COA A;  2X18 A;  4MY6 A;  5C6R A;  2LOX A;  3G9W A;  3TFM A;  3A8P A;  1DDW A;  4YON A;  2AL6 A;  5HE0 A;  1UEF A;  5DHF B;  2YS5 A;  2EC1 A;  1FHW A;  2COD A;  3ZDT A;  2DX5 A;  1Z87 A;  4NSW A;  1DDV A;  2H7E A;  3BIN A;  3MDB C;  2DN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...