2D9YA

Solution structure of the ph domain of pepp-3 from human
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
117
structure length
117
Chain Sequence
GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing protein family A membe
publication title Solution structure of the PH domain of PEPP-3 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9yA00
3HQCA 5GOWB 1UNRA 4GXBA 3TCAA 1RRPB 1RJ2A 1TQZA 5DI9B 2D11A 3WYFB 3MPXA 2YF0A 2COCA 1XKEA 3KRWA 5HE3A 2P0HA 2DA0A 3ULBA 5JHHA 2DX1A 1LW3A 4A5KA 5D3XA 3U7DA 2FJLA 2DYNA 2ROVA 2W2XC 2GS0A 5KQ1A 4CYEA 1MK7B 3BJIA 2LOXA 2RGNB 4KVGB 2LYDA 1FOEA 1AWEA 4Y94A 3QIJA 2K00A 2J0MA 5C16A 4KAXB 1P5TA 5DH9B 4WSFA 4MY6A 4Z2NA 2DHIA 3UZTA 4P7IA 2LOZA 1UNQA 1WI1A 3KY9A 2D9YA 5CLLB 3PG7A 2G35A 2CY4A 3P6AA 1NTVA 1Z87A 2KGXB 1V61A 3CXBB 3F0WA 3ODOA 1I7AA 5J3TA 2LG1A 3X23A 3QBVB 2YS1A 4BBKA 2DHJA 2X18A 3M1IB 4K81A 5J3QA 5CLQB 3TVVA 4K2PA 5J3YA 1ISNA 1M7EA 4CHJA 1SHCA 2EC1A 2DTCA 5DIFB 1TJ6A 4ZRIA 5JHGA 1QC6A 2OQBA 5C6RA 2CRFA 1W1HA 1GC7A 2M38A 2YT1A 4HDOA 1PMSA 1EAZA 4IFSA 1I2HA 3ODWA 3TFMA 5HE0A 1FHWA 3SUZA 2ELAA 2LULA 5D3YA 3N7CA 3VIAA 4XWXA 2AEHA 5LONB 2COAA 1U29A 1UNPA 3D8FA 3ODXA 1OMWA 3ML4A 4HAXB 1J0WA 2BCJA 4NY0A 3LJUX 1U5GA 1DDMA 2D10A 3IVFA 2HTHB 2YRYA 4HAVB 4A6HA 1LB1A 1M7RA 1EGXA 4HATB 4NSWA 2GJYA 1U27A 2QKMA 4L6EA 1X1GA 2MFQA 5HE1A 1X86A 4TKNA 2VRWB 2P8VA 1ZC3B 2L2IA 4K17A 2NZ8B 1H4RA 3KSYA 2GCJA 4F7GA 2Z0OA 1DDWA 3P7ZA 1QQGA 1WG7A 4PNKA 4DX90 5EFXA 3DXCA 4HAWB 1FGYA 4GMVA 1U2BA 1EF1A 2EJ8A 1E5WA 2YS5A 3SV1A 1XODA 1WVHA 1KZ7A 2D4QA 4H8SA 4Z2MB 1J19A 2IYBA 2LKOA 4F7HA 2D9WA 3BINA 1V5UA 2W2WA 1OQNA 1KI1B 1V5MA 1WGUA 3TO1A 2VSZA 3HK0A 2KUPA 3F5RA 1AQCA 2DHKA 2H7EA 3OANA 2R09A 2YT0A 1BAKA 1DBHA 5KQ4A 3A8QA 3RCPA 1WGQA 2COFA 2CODA 1WJMA 2I1KA 2IFSA 5DHFB 3PZDA 4C0AA 1N3HA 4B6HA 1NTYA 4HDQA 3ZVRA 2D9VA 3TW1A 1EVHA 4DBBA 1MIXA 2Z0PA 2QKLA 2W2XD 2Y7BA 2Z0QA 1NI2A 1PLSA 5JP4A 1BTKA 3DXEA 3V5WA 2I5CA 1FAOA 1ZSQA 4HB3B 3O96A 1U5FA 1MIZB 4GPTB 4WVFB 2UZRA 5DHAB 4YL8A 5JLJB 3ZDTA 2I5FA 2OTXA 2MWNB 4TYZA 1UPQA 1Y19B 1FB8A 1U5EA 4HHVA 2NMBA 2P0DA 2J0KA 4YONA 1H10A 5C79A 4HAYB 2ROZB 2N0YA 3PVWA 1FHXA 1GC6A 2H7DA 1XCGA 1XX0A 5D3WA 2GCLA 2MKRA 3G9WA 3A98B 5C5BB 2RNRB 2EMTA 3PSCA 3U8ZA 1MKEA 3VOQA 2XQNM 2R0DA 3PP2A 4GZUA 2DFKA 1K5GB 3FSSA 3WA0A 1PFJA 4A6FB 5FI0A 2JP2A 5D3VA 2RUKB 3SNHA 1SGHA 4PQ0A 1Q67A 4GMXB 4EKUA 1V89A 1KZGA 4EMOA 3T06A 3KZ1A 2HE7A 3HW2B 5KCVA 2UVMA 2MDXA 2L1CA 2J0JA 2PZ1A 1Y5OA 4EJNA 5L81A 2ELBA 3NSUA 1V5PA 3FEHA 1K5DB 1MPHA 4HAZB 2J59M 1P3RA 2AL6A 3FM8C 1DYNA 4CHMA 1X05A 1X11A 3D8DA 3GYPA 4DXAB 2D2QA 1ZM0A 2Y8FA 2Q13A 1BTNA 2RSGA 4A6KA 2DN6A 2P0FA 2ZPYA 1V88A 2EMSA 5FI1A 4ZRJA 3AJ4A 4HB0B 4MT7A 4MK0A 3SYXA 1DDVA 2ADZA 2K2JA 1UPRA 4IAPA 2YSZA 3PVLA 4KHBB 1MK9B 1ZC4B 3PVUA 4D0NB 3D8EA 2K2UA 4HAUB 2VKIA 1X1FA 2D9ZA 2YVCA 2DLWA 2DYQA 4HB2B 3GYOA 4IOYX 4WJ7A 4ZRKA 2CY5A 5HE2A 1W1DA 1B55A 2M14A 1FHOA 3CIKA 3DXDA 2Y8GA 2CAYA 4GN1A 2V76A 1BWNA 4HB4B 1UEFA 1XD4A 3A8PA 2DKQA 4DX8A 2UZSA 5C5BA 1XR0B 2D9XA 4KHOA 4K2OA 3ULCA 1OY2A 1W1GA 1GG3A 2RLOA 2E2XA 1NU2A 3AU5A 1IRSA 5D27A 1MAIA 2I1JA 4A6FA 1U5DA 5LOPB 2DX5A 1P6SA 3AU4A 1TXDA 1FGZA 2KCJA 4F7UP 1DROA 3SO6A 2YS3A 1WJ1A 1ZVRA 4KHAA 2DKPA 3PEGA 3MDBC 3KRXA 3QWMA 2RVBB 2N23A
chains in the Genus database with same CATH superfamily
3HQCA 4QXAB 5GOWB 1UNRA 4GXBA 3TCAA 1RRPB 1RJ2A 1TQZA 5DI9B 2D11A 3WYFB 3MPXA 2YF0A 2COCA 1XKEA 3KRWA 5HE3A 2P0HA 2DA0A 3ULBA 5JHHA 2DX1A 1LW3A 4A5KA 2Z4DA 5D3XA 5I2SA 3U7DA 2FJLA 2DYNA 2ROVA 2W2XC 2GS0A 4QJ5B 5KQ1A 4CYEA 1MK7B 3BJIA 2LOXA 2RGNB 4KVGB 2LYDA 1FOEA 3NW8A 1AWEA 4Y94A 2Z14A 3QIJA 2K00A 4KHBA 2J0MA 5C16A 4KAXB 1P5TA 5DH9B 2Z59A 4WSFA 4MY6A 4Z2NA 2DHIA 3UZTA 4P7IA 2LOZA 1UNQA 1WI1A 3KY9A 2D9YA 5CLLB 3PG7A 2G35A 2CY4A 3P6AA 1NTVA 1Z87A 2KGXB 1V61A 3CXBB 3F0WA 3ODOA 1I7AA 5J3TA 2LG1A 3X23A 3QBVB 2YS1A 4BBKA 2DHJA 2X18A 3M1IB 4K81A 5J3QA 5CLQB 3TVVA 4K2PA 5J3YA 1ISNA 1MI1A 1M7EA 4CHJA 1SHCA 2EC1A 2NBVA 2DTCA 3HSAA 5DIFB 1TJ6A 4ZRIA 5JHGA 1QC6A 2OQBA 5C6RA 2CRFA 1W1HA 1GC7A 3FVCA 2M38A 2YT1A 4HDOA 1PMSA 1EAZA 4IFSA 1I2HA 3ODWA 5I2MA 3TFMA 5HE0A 1FHWA 3SUZA 2ELAA 2LULA 5D3YA 3N7CA 3VIAA 4XWXA 2AEHA 5LONB 2COAA 1U29A 1UNPA 3D8FA 3ODXA 1OMWA 3ML4A 4HAXB 1J0WA 2BCJA 4NY0A 3LJUX 1U5GA 1DDMA 2D10A 3IVFA 2HTHB 2YRYA 4HAVB 4A6HA 4GNKB 1LB1A 1M7RA 1EGXA 4HATB 4NSWA 2GJYA 1U27A 2QKMA 4L6EA 4CSQA 1X1GA 2MFQA 5HE1A 1X86A 4TKNA 2VRWB 2P8VA 1ZC3B 4QJ3B 2L2IA 4K17A 2NZ8B 1H4RA 3HIEA 3KSYA 2GCJA 4F7GA 2Z0OA 1DDWA 3P7ZA 1QQGA 2K8EA 1WG7A 4PNKA 4D6WA 4DX90 5EFXA 3DXCA 4HAWB 1FGYA 4GMVA 1U2BA 1EF1A 2EJ8A 1E5WA 2YS5A 3SV1A 2KR0A 3U12A 1XODA 1WVHA 1KZ7A 2D4QA 4H8SA 4Z2MB 1J19A 4OSNA 2IYBA 2LKOA 4F7HA 2D9WA 3BINA 1V5UA 2W2WA 1OQNA 1KI1B 1V5MA 1WGUA 3TO1A 2VSZA 3HK0A 2KUPA 3F5RA 1AQCA 2DHKA 2H7EA 3OANA 2R09A 2YT0A 1BAKA 1DBHA 5KQ4A 3A8QA 3RCPA 1WGQA 2COFA 2CODA 1WJMA 2I1KA 2IFSA 5DHFB 3PZDA 4C0AA 1N3HA 1ZYIA 4B6HA 1NTYA 4OT1A 4HDQA 3ZVRA 2D9VA 3TW1A 1EVHA 4DBBA 1MIXA 2Z0PA 2QKLA 2W2XD 2Y7BA 2Z0QA 5IRSA 2KUQA 1NI2A 1PLSA 5JP4A 2Z13A 1BTKA 3DXEA 3V5WA 2I5CA 1FAOA 4L1RA 1ZSQA 3DCXA 4HB3B 3O96A 1MIZB 1U5FA 4GPTB 4WVFB 2UZRA 5DHAB 4YL8A 5JLJB 4HSIA 3ZDTA 2I5FA 2OTXA 2GUMA 2MWNB 4DIXA 4TYZA 1UPQA 1Y19B 4QJ4B 1FB8A 1U5EA 4HHVA 2NMBA 2P0DA 2J0KA 4YONA 1H10A 5C79A 4HAYB 2ROZB 2N0YA 3PVWA 2FJUB 1FHXA 1GC6A 2H7DA 1XCGA 1XX0A 5D3WA 2GCLA 2MKRA 3G9WA 3A98B 5C5BB 2RNRB 2EMTA 3PSCA 3U8ZA 1MKEA 3VOQA 2XQNM 2R0DA 3PP2A 4GZUA 2DFKA 1K5GB 2KIGA 3FSSA 1PFJA 3WA0A 4A6FB 5FI0A 3NWAA 2JP2A 5D3VA 2RUKB 3B77A 3SNHA 1SGHA 4PQ0A 1Q67A 4GMXB 3NWDA 4EKUA 1V89A 1KZGA 4EMOA 3T06A 3KZ1A 2HE7A 3HW2B 5KCVA 2UVMA 2MDXA 2L1CA 2J0JA 2PZ1A 1Y5OA 4EJNA 5L81A 2ELBA 3NSUA 1V5PA 3FEHA 1K5DB 1MPHA 4HAZB 2J59M 1P3RA 2AL6A 3FM8C 1DYNA 4CHMA 1X05A 1X11A 2KIEA 3D8DA 3GYPA 4DXAB 2D2QA 1ZM0A 2Y8FA 3A58A 2Q13A 2ZKMX 1BTNA 2RSGA 4A6KA 2DN6A 2P0FA 2ZPYA 1V88A 2EMSA 5FI1A 2R2YA 4ZRJA 3AJ4A 4HB0B 4MT7A 5M4YB 4MK0A 3SYXA 1DDVA 2ADZA 2K2JA 1UPRA 4IAPA 2YSZA 3PVLA 4KHBB 1MK9B 1ZC4B 3PVUA 4D0NB 3D8EA 2K2UA 4HAUB 2VKIA 1X1FA 2D9ZA 2YVCA 2DLWA 2DYQA 4HB2B 2YT2A 3GYOA 4IOYX 4WJ7A 4ZRKA 2CY5A 5HE2A 1W1DA 1B55A 2M14A 1FHOA 3CIKA 3DXDA 4GOUA 2Y8GA 2CAYA 4GN1A 2V76A 1BWNA 4HB4B 1UEFA 1XD4A 3A8PA 2DKQA 4DX8A 2UZSA 5C5BA 1XR0B 2D9XA 3OHMB 4KHOA 4K2OA 3ULCA 2RRFA 1OY2A 1W1GA 1GG3A 2RLOA 2E2XA 1NU2A 3AU5A 1IRSA 5D27A 2K49A 1MAIA 2I1JA 4A6FA 1U5DA 5LOPB 2DX5A 1P6SA 3AU4A 1TXDA 1FGZA 1T77A 3NWFA 2KCJA 4F7UP 1DROA 3SO6A 2YS3A 1WJ1A 1ZVRA 4KHAA 5LG4B 2DKPA 3PEGA 3MDBC 3KRXA 3QWMA 2RVBB 2N23A
chains in the Genus database with same CATH topology
3HQCA 5GOWB 1UNRA 4GXBA 3TCAA 1RRPB 1RJ2A 1TQZA 5DI9B 2D11A 3WYFB 3MPXA 2YF0A 2COCA 1XKEA 3KRWA 5HE3A 2P0HA 2DA0A 3ULBA 5JHHA 2DX1A 1LW3A 4A5KA 5D3XA 3U7DA 2FJLA 2DYNA 2ROVA 2W2XC 2GS0A 5KQ1A 4CYEA 1MK7B 3BJIA 2LOXA 2RGNB 4KVGB 2LYDA 1FOEA 1AWEA 4Y94A 3QIJA 2K00A 2J0MA 5C16A 4KAXB 1P5TA 5DH9B 4WSFA 4MY6A 4Z2NA 2DHIA 3UZTA 4P7IA 2LOZA 1UNQA 1WI1A 3KY9A 2D9YA 5CLLB 3PG7A 2G35A 2CY4A 3P6AA 1NTVA 1Z87A 2KGXB 1V61A 3CXBB 3F0WA 3ODOA 1I7AA 5J3TA 2LG1A 3X23A 3QBVB 2YS1A 4BBKA 2DHJA 2X18A 3M1IB 4K81A 5J3QA 5CLQB 3TVVA 4K2PA 5J3YA 1ISNA 1M7EA 4CHJA 1SHCA 2EC1A 2DTCA 5DIFB 1TJ6A 4ZRIA 5JHGA 1QC6A 2OQBA 5C6RA 2CRFA 1W1HA 1GC7A 2M38A 2YT1A 4HDOA 1PMSA 1EAZA 4IFSA 1I2HA 3ODWA 3TFMA 5HE0A 1FHWA 3SUZA 2ELAA 2LULA 5D3YA 3N7CA 3VIAA 4XWXA 2AEHA 5LONB 2COAA 1U29A 1UNPA 3D8FA 3ODXA 1OMWA 3ML4A 4HAXB 1J0WA 2BCJA 4NY0A 3LJUX 1U5GA 1DDMA 2D10A 3IVFA 2HTHB 2YRYA 4HAVB 4A6HA 1LB1A 1M7RA 1EGXA 4HATB 4NSWA 2GJYA 1U27A 2QKMA 4L6EA 1X1GA 2MFQA 5HE1A 1X86A 4TKNA 2VRWB 2P8VA 1ZC3B 2L2IA 4K17A 2NZ8B 1H4RA 3KSYA 2GCJA 4F7GA 2Z0OA 1DDWA 3P7ZA 1QQGA 1WG7A 4PNKA 4DX90 5EFXA 3DXCA 4HAWB 1FGYA 4GMVA 1U2BA 1EF1A 2EJ8A 1E5WA 2YS5A 3SV1A 1XODA 1WVHA 1KZ7A 2D4QA 4H8SA 4Z2MB 1J19A 2IYBA 2LKOA 4F7HA 2D9WA 3BINA 1V5UA 2W2WA 1OQNA 1KI1B 1V5MA 1WGUA 3TO1A 2VSZA 3HK0A 2KUPA 3F5RA 1AQCA 2DHKA 2H7EA 3OANA 2R09A 2YT0A 1BAKA 1DBHA 5KQ4A 3A8QA 3RCPA 1WGQA 2COFA 2CODA 1WJMA 2I1KA 2IFSA 5DHFB 3PZDA 4C0AA 1N3HA 4B6HA 1NTYA 4HDQA 3ZVRA 2D9VA 3TW1A 1EVHA 4DBBA 1MIXA 2Z0PA 2QKLA 2W2XD 2Y7BA 2Z0QA 1NI2A 1PLSA 5JP4A 1BTKA 3DXEA 3V5WA 2I5CA 1FAOA 1ZSQA 4HB3B 3O96A 1U5FA 1MIZB 4GPTB 4WVFB 2UZRA 5DHAB 4YL8A 5JLJB 3ZDTA 2I5FA 2OTXA 2MWNB 4TYZA 1UPQA 1Y19B 1FB8A 1U5EA 4HHVA 2NMBA 2P0DA 2J0KA 4YONA 1H10A 5C79A 4HAYB 2ROZB 2N0YA 3PVWA 1FHXA 1GC6A 2H7DA 1XCGA 1XX0A 5D3WA 2GCLA 2MKRA 3G9WA 3A98B 5C5BB 2RNRB 2EMTA 3PSCA 3U8ZA 1MKEA 3VOQA 2XQNM 2R0DA 3PP2A 4GZUA 2DFKA 1K5GB 3FSSA 3WA0A 1PFJA 4A6FB 5FI0A 2JP2A 5D3VA 2RUKB 3SNHA 1SGHA 4PQ0A 1Q67A 4GMXB 4EKUA 1V89A 1KZGA 4EMOA 3T06A 3KZ1A 2HE7A 3HW2B 5KCVA 2UVMA 2MDXA 2L1CA 2J0JA 2PZ1A 1Y5OA 4EJNA 5L81A 2ELBA 3NSUA 1V5PA 3FEHA 1K5DB 1MPHA 4HAZB 2J59M 1P3RA 2AL6A 3FM8C 1DYNA 4CHMA 1X05A 1X11A 3D8DA 3GYPA 4DXAB 2D2QA 1ZM0A 2Y8FA 2Q13A 1BTNA 2RSGA 4A6KA 2DN6A 2P0FA 2ZPYA 1V88A 2EMSA 5FI1A 4ZRJA 3AJ4A 4HB0B 4MT7A 4MK0A 3SYXA 1DDVA 2ADZA 2K2JA 1UPRA 4IAPA 2YSZA 3PVLA 4KHBB 1MK9B 1ZC4B 3PVUA 4D0NB 3D8EA 2K2UA 4HAUB 2VKIA 1X1FA 2D9ZA 2YVCA 2DLWA 2DYQA 4HB2B 3GYOA 4IOYX 4WJ7A 4ZRKA 2CY5A 5HE2A 1W1DA 1B55A 2M14A 1FHOA 3CIKA 3DXDA 2Y8GA 2CAYA 4GN1A 2V76A 1BWNA 4HB4B 1UEFA 1XD4A 3A8PA 2DKQA 4DX8A 2UZSA 5C5BA 1XR0B 2D9XA 4KHOA 4K2OA 3ULCA 1OY2A 1W1GA 1GG3A 2RLOA 2E2XA 1NU2A 3AU5A 1IRSA 5D27A 1MAIA 2I1JA 4A6FA 1U5DA 5LOPB 2DX5A 1P6SA 3AU4A 1TXDA 1FGZA 2KCJA 4F7UP 1DROA 3SO6A 2YS3A 1WJ1A 1ZVRA 4KHAA 2DKPA 3PEGA 3MDBC 3KRXA 3QWMA 2RVBB 2N23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQC A;  5GOW B;  1UNR A;  4GXB A;  3TCA A;  1RRP B;  1RJ2 A;  1TQZ A;  5DI9 B;  2D11 A;  3WYF B;  3MPX A;  2YF0 A;  2COC A;  1XKE A;  3KRW A;  5HE3 A;  2P0H A;  2DA0 A;  3ULB A;  5JHH A;  2DX1 A;  1LW3 A;  4A5K A;  5D3X A;  3U7D A;  2FJL A;  2DYN A;  2ROV A;  2W2X C;  2GS0 A;  5KQ1 A;  4CYE A;  1MK7 B;  3BJI A;  2LOX A;  2RGN B;  4KVG B;  2LYD A;  1FOE A;  1AWE A;  4Y94 A;  3QIJ A;  2K00 A;  2J0M A;  5C16 A;  4KAX B;  1P5T A;  5DH9 B;  4WSF A;  4MY6 A;  4Z2N A;  2DHI A;  3UZT A;  4P7I A;  2LOZ A;  1UNQ A;  1WI1 A;  3KY9 A;  2D9Y A;  5CLL B;  3PG7 A;  2G35 A;  2CY4 A;  3P6A A;  1NTV A;  1Z87 A;  2KGX B;  1V61 A;  3CXB B;  3F0W A;  3ODO A;  1I7A A;  5J3T A;  2LG1 A;  3X23 A;  3QBV B;  2YS1 A;  4BBK A;  2DHJ A;  2X18 A;  3M1I B;  4K81 A;  5J3Q A;  5CLQ B;  3TVV A;  4K2P A;  5J3Y A;  1ISN A;  1M7E A;  4CHJ A;  1SHC A;  2EC1 A;  2DTC A;  5DIF B;  1TJ6 A;  4ZRI A;  5JHG A;  1QC6 A;  2OQB A;  5C6R A;  2CRF A;  1W1H A;  1GC7 A;  2M38 A;  2YT1 A;  4HDO A;  1PMS A;  1EAZ A;  4IFS A;  1I2H A;  3ODW A;  3TFM A;  5HE0 A;  1FHW A;  3SUZ A;  2ELA A;  2LUL A;  5D3Y A;  3N7C A;  3VIA A;  4XWX A;  2AEH A;  5LON B;  2COA A;  1U29 A;  1UNP A;  3D8F A;  3ODX A;  1OMW A;  3ML4 A;  4HAX B;  1J0W A;  2BCJ A;  4NY0 A;  3LJU X;  1U5G A;  1DDM A;  2D10 A;  3IVF A;  2HTH B;  2YRY A;  4HAV B;  4A6H A;  1LB1 A;  1M7R A;  1EGX A;  4HAT B;  4NSW A;  2GJY A;  1U27 A;  2QKM A;  4L6E A;  1X1G A;  2MFQ A;  5HE1 A;  1X86 A;  4TKN A;  2VRW B;  2P8V A;  1ZC3 B;  2L2I A;  4K17 A;  2NZ8 B;  1H4R A;  3KSY A;  2GCJ A;  4F7G A;  2Z0O A;  1DDW A;  3P7Z A;  1QQG A;  1WG7 A;  4PNK A;  4DX9 0;  5EFX A;  3DXC A;  4HAW B;  1FGY A;  4GMV A;  1U2B A;  1EF1 A;  2EJ8 A;  1E5W A;  2YS5 A;  3SV1 A;  1XOD A;  1WVH A;  1KZ7 A;  2D4Q A;  4H8S A;  4Z2M B;  1J19 A;  2IYB A;  2LKO A;  4F7H A;  2D9W A;  3BIN A;  1V5U A;  2W2W A;  1OQN A;  1KI1 B;  1V5M A;  1WGU A;  3TO1 A;  2VSZ A;  3HK0 A;  2KUP A;  3F5R A;  1AQC A;  2DHK A;  2H7E A;  3OAN A;  2R09 A;  2YT0 A;  1BAK A;  1DBH A;  5KQ4 A;  3A8Q A;  3RCP A;  1WGQ A;  2COF A;  2COD A;  1WJM A;  2I1K A;  2IFS A;  5DHF B;  3PZD A;  4C0A A;  1N3H A;  4B6H A;  1NTY A;  4HDQ A;  3ZVR A;  2D9V A;  3TW1 A;  1EVH A;  4DBB A;  1MIX A;  2Z0P A;  2QKL A;  2W2X D;  2Y7B A;  2Z0Q A;  1NI2 A;  1PLS A;  5JP4 A;  1BTK A;  3DXE A;  3V5W A;  2I5C A;  1FAO A;  1ZSQ A;  4HB3 B;  3O96 A;  1U5F A;  1MIZ B;  4GPT B;  4WVF B;  2UZR A;  5DHA B;  4YL8 A;  5JLJ B;  3ZDT A;  2I5F A;  2OTX A;  2MWN B;  4TYZ A;  1UPQ A;  1Y19 B;  1FB8 A;  1U5E A;  4HHV A;  2NMB A;  2P0D A;  2J0K A;  4YON A;  1H10 A;  5C79 A;  4HAY B;  2ROZ B;  2N0Y A;  3PVW A;  1FHX A;  1GC6 A;  2H7D A;  1XCG A;  1XX0 A;  5D3W A;  2GCL A;  2MKR A;  3G9W A;  3A98 B;  5C5B B;  2RNR B;  2EMT A;  3PSC A;  3U8Z A;  1MKE A;  3VOQ A;  2XQN M;  2R0D A;  3PP2 A;  4GZU A;  2DFK A;  1K5G B;  3FSS A;  3WA0 A;  1PFJ A;  4A6F B;  5FI0 A;  2JP2 A;  5D3V A;  2RUK B;  3SNH A;  1SGH A;  4PQ0 A;  1Q67 A;  4GMX B;  4EKU A;  1V89 A;  1KZG A;  4EMO A;  3T06 A;  3KZ1 A;  2HE7 A;  3HW2 B;  5KCV A;  2UVM A;  2MDX A;  2L1C A;  2J0J A;  2PZ1 A;  1Y5O A;  4EJN A;  5L81 A;  2ELB A;  3NSU A;  1V5P A;  3FEH A;  1K5D B;  1MPH A;  4HAZ B;  2J59 M;  1P3R A;  2AL6 A;  3FM8 C;  1DYN A;  4CHM A;  1X05 A;  1X11 A;  3D8D A;  3GYP A;  4DXA B;  2D2Q A;  1ZM0 A;  2Y8F A;  2Q13 A;  1BTN A;  2RSG A;  4A6K A;  2DN6 A;  2P0F A;  2ZPY A;  1V88 A;  2EMS A;  5FI1 A;  4ZRJ A;  3AJ4 A;  4HB0 B;  4MT7 A;  4MK0 A;  3SYX A;  1DDV A;  2ADZ A;  2K2J A;  1UPR A;  4IAP A;  2YSZ A;  3PVL A;  4KHB B;  1MK9 B;  1ZC4 B;  3PVU A;  4D0N B;  3D8E A;  2K2U A;  4HAU B;  2VKI A;  1X1F A;  2D9Z A;  2YVC A;  2DLW A;  2DYQ A;  4HB2 B;  3GYO A;  4IOY X;  4WJ7 A;  4ZRK A;  2CY5 A;  5HE2 A;  1W1D A;  1B55 A;  2M14 A;  1FHO A;  3CIK A;  3DXD A;  2Y8G A;  2CAY A;  4GN1 A;  2V76 A;  1BWN A;  4HB4 B;  1UEF A;  1XD4 A;  3A8P A;  2DKQ A;  4DX8 A;  2UZS A;  5C5B A;  1XR0 B;  2D9X A;  4KHO A;  4K2O A;  3ULC A;  1OY2 A;  1W1G A;  1GG3 A;  2RLO A;  2E2X A;  1NU2 A;  3AU5 A;  1IRS A;  5D27 A;  1MAI A;  2I1J A;  4A6F A;  1U5D A;  5LOP B;  2DX5 A;  1P6S A;  3AU4 A;  1TXD A;  1FGZ A;  2KCJ A;  4F7U P;  1DRO A;  3SO6 A;  2YS3 A;  1WJ1 A;  1ZVR A;  4KHA A;  2DKP A;  3PEG A;  3MDB C;  3KRX A;  3QWM A;  2RVB B;  2N23 A; 
#chains in the Genus database with same CATH topology
 3HQC A;  4QXA B;  5GOW B;  1UNR A;  4GXB A;  3TCA A;  1RRP B;  1RJ2 A;  1TQZ A;  5DI9 B;  2D11 A;  3WYF B;  3MPX A;  2YF0 A;  2COC A;  1XKE A;  3KRW A;  5HE3 A;  2P0H A;  2DA0 A;  3ULB A;  5JHH A;  2DX1 A;  1LW3 A;  4A5K A;  2Z4D A;  5D3X A;  5I2S A;  3U7D A;  2FJL A;  2DYN A;  2ROV A;  2W2X C;  2GS0 A;  4QJ5 B;  5KQ1 A;  4CYE A;  1MK7 B;  3BJI A;  2LOX A;  2RGN B;  4KVG B;  2LYD A;  1FOE A;  3NW8 A;  1AWE A;  4Y94 A;  2Z14 A;  3QIJ A;  2K00 A;  4KHB A;  2J0M A;  5C16 A;  4KAX B;  1P5T A;  5DH9 B;  2Z59 A;  4WSF A;  4MY6 A;  4Z2N A;  2DHI A;  3UZT A;  4P7I A;  2LOZ A;  1UNQ A;  1WI1 A;  3KY9 A;  2D9Y A;  5CLL B;  3PG7 A;  2G35 A;  2CY4 A;  3P6A A;  1NTV A;  1Z87 A;  2KGX B;  1V61 A;  3CXB B;  3F0W A;  3ODO A;  1I7A A;  5J3T A;  2LG1 A;  3X23 A;  3QBV B;  2YS1 A;  4BBK A;  2DHJ A;  2X18 A;  3M1I B;  4K81 A;  5J3Q A;  5CLQ B;  3TVV A;  4K2P A;  5J3Y A;  1ISN A;  1MI1 A;  1M7E A;  4CHJ A;  1SHC A;  2EC1 A;  2NBV A;  2DTC A;  3HSA A;  5DIF B;  1TJ6 A;  4ZRI A;  5JHG A;  1QC6 A;  2OQB A;  5C6R A;  2CRF A;  1W1H A;  1GC7 A;  3FVC A;  2M38 A;  2YT1 A;  4HDO A;  1PMS A;  1EAZ A;  4IFS A;  1I2H A;  3ODW A;  5I2M A;  3TFM A;  5HE0 A;  1FHW A;  3SUZ A;  2ELA A;  2LUL A;  5D3Y A;  3N7C A;  3VIA A;  4XWX A;  2AEH A;  5LON B;  2COA A;  1U29 A;  1UNP A;  3D8F A;  3ODX A;  1OMW A;  3ML4 A;  4HAX B;  1J0W A;  2BCJ A;  4NY0 A;  3LJU X;  1U5G A;  1DDM A;  2D10 A;  3IVF A;  2HTH B;  2YRY A;  4HAV B;  4A6H A;  4GNK B;  1LB1 A;  1M7R A;  1EGX A;  4HAT B;  4NSW A;  2GJY A;  1U27 A;  2QKM A;  4L6E A;  4CSQ A;  1X1G A;  2MFQ A;  5HE1 A;  1X86 A;  4TKN A;  2VRW B;  2P8V A;  1ZC3 B;  4QJ3 B;  2L2I A;  4K17 A;  2NZ8 B;  1H4R A;  3HIE A;  3KSY A;  2GCJ A;  4F7G A;  2Z0O A;  1DDW A;  3P7Z A;  1QQG A;  2K8E A;  1WG7 A;  4PNK A;  4D6W A;  4DX9 0;  5EFX A;  3DXC A;  4HAW B;  1FGY A;  4GMV A;  1U2B A;  1EF1 A;  2EJ8 A;  1E5W A;  2YS5 A;  3SV1 A;  2KR0 A;  3U12 A;  1XOD A;  1WVH A;  1KZ7 A;  2D4Q A;  4H8S A;  4Z2M B;  1J19 A;  4OSN A;  2IYB A;  2LKO A;  4F7H A;  2D9W A;  3BIN A;  1V5U A;  2W2W A;  1OQN A;  1KI1 B;  1V5M A;  1WGU A;  3TO1 A;  2VSZ A;  3HK0 A;  2KUP A;  3F5R A;  1AQC A;  2DHK A;  2H7E A;  3OAN A;  2R09 A;  2YT0 A;  1BAK A;  1DBH A;  5KQ4 A;  3A8Q A;  3RCP A;  1WGQ A;  2COF A;  2COD A;  1WJM A;  2I1K A;  2IFS A;  5DHF B;  3PZD A;  4C0A A;  1N3H A;  1ZYI A;  4B6H A;  1NTY A;  4OT1 A;  4HDQ A;  3ZVR A;  2D9V A;  3TW1 A;  1EVH A;  4DBB A;  1MIX A;  2Z0P A;  2QKL A;  2W2X D;  2Y7B A;  2Z0Q A;  5IRS A;  2KUQ A;  1NI2 A;  1PLS A;  5JP4 A;  2Z13 A;  1BTK A;  3DXE A;  3V5W A;  2I5C A;  1FAO A;  4L1R A;  1ZSQ A;  3DCX A;  4HB3 B;  3O96 A;  1MIZ B;  1U5F A;  4GPT B;  4WVF B;  2UZR A;  5DHA B;  4YL8 A;  5JLJ B;  4HSI A;  3ZDT A;  2I5F A;  2OTX A;  2GUM A;  2MWN B;  4DIX A;  4TYZ A;  1UPQ A;  1Y19 B;  4QJ4 B;  1FB8 A;  1U5E A;  4HHV A;  2NMB A;  2P0D A;  2J0K A;  4YON A;  1H10 A;  5C79 A;  4HAY B;  2ROZ B;  2N0Y A;  3PVW A;  2FJU B;  1FHX A;  1GC6 A;  2H7D A;  1XCG A;  1XX0 A;  5D3W A;  2GCL A;  2MKR A;  3G9W A;  3A98 B;  5C5B B;  2RNR B;  2EMT A;  3PSC A;  3U8Z A;  1MKE A;  3VOQ A;  2XQN M;  2R0D A;  3PP2 A;  4GZU A;  2DFK A;  1K5G B;  2KIG A;  3FSS A;  1PFJ A;  3WA0 A;  4A6F B;  5FI0 A;  3NWA A;  2JP2 A;  5D3V A;  2RUK B;  3B77 A;  3SNH A;  1SGH A;  4PQ0 A;  1Q67 A;  4GMX B;  3NWD A;  4EKU A;  1V89 A;  1KZG A;  4EMO A;  3T06 A;  3KZ1 A;  2HE7 A;  3HW2 B;  5KCV A;  2UVM A;  2MDX A;  2L1C A;  2J0J A;  2PZ1 A;  1Y5O A;  4EJN A;  5L81 A;  2ELB A;  3NSU A;  1V5P A;  3FEH A;  1K5D B;  1MPH A;  4HAZ B;  2J59 M;  1P3R A;  2AL6 A;  3FM8 C;  1DYN A;  4CHM A;  1X05 A;  1X11 A;  2KIE A;  3D8D A;  3GYP A;  4DXA B;  2D2Q A;  1ZM0 A;  2Y8F A;  3A58 A;  2Q13 A;  2ZKM X;  1BTN A;  2RSG A;  4A6K A;  2DN6 A;  2P0F A;  2ZPY A;  1V88 A;  2EMS A;  5FI1 A;  2R2Y A;  4ZRJ A;  3AJ4 A;  4HB0 B;  4MT7 A;  5M4Y B;  4MK0 A;  3SYX A;  1DDV A;  2ADZ A;  2K2J A;  1UPR A;  4IAP A;  2YSZ A;  3PVL A;  4KHB B;  1MK9 B;  1ZC4 B;  3PVU A;  4D0N B;  3D8E A;  2K2U A;  4HAU B;  2VKI A;  1X1F A;  2D9Z A;  2YVC A;  2DLW A;  2DYQ A;  4HB2 B;  2YT2 A;  3GYO A;  4IOY X;  4WJ7 A;  4ZRK A;  2CY5 A;  5HE2 A;  1W1D A;  1B55 A;  2M14 A;  1FHO A;  3CIK A;  3DXD A;  4GOU A;  2Y8G A;  2CAY A;  4GN1 A;  2V76 A;  1BWN A;  4HB4 B;  1UEF A;  1XD4 A;  3A8P A;  2DKQ A;  4DX8 A;  2UZS A;  5C5B A;  1XR0 B;  2D9X A;  3OHM B;  4KHO A;  4K2O A;  3ULC A;  2RRF A;  1OY2 A;  1W1G A;  1GG3 A;  2RLO A;  2E2X A;  1NU2 A;  3AU5 A;  1IRS A;  5D27 A;  2K49 A;  1MAI A;  2I1J A;  4A6F A;  1U5D A;  5LOP B;  2DX5 A;  1P6S A;  3AU4 A;  1TXD A;  1FGZ A;  1T77 A;  3NWF A;  2KCJ A;  4F7U P;  1DRO A;  3SO6 A;  2YS3 A;  1WJ1 A;  1ZVR A;  4KHA A;  5LG4 B;  2DKP A;  3PEG A;  3MDB C;  3KRX A;  3QWM A;  2RVB B;  2N23 A; 
#chains in the Genus database with same CATH homology
 3HQC A;  5GOW B;  1UNR A;  4GXB A;  3TCA A;  1RRP B;  1RJ2 A;  1TQZ A;  5DI9 B;  2D11 A;  3WYF B;  3MPX A;  2YF0 A;  2COC A;  1XKE A;  3KRW A;  5HE3 A;  2P0H A;  2DA0 A;  3ULB A;  5JHH A;  2DX1 A;  1LW3 A;  4A5K A;  5D3X A;  3U7D A;  2FJL A;  2DYN A;  2ROV A;  2W2X C;  2GS0 A;  5KQ1 A;  4CYE A;  1MK7 B;  3BJI A;  2LOX A;  2RGN B;  4KVG B;  2LYD A;  1FOE A;  1AWE A;  4Y94 A;  3QIJ A;  2K00 A;  2J0M A;  5C16 A;  4KAX B;  1P5T A;  5DH9 B;  4WSF A;  4MY6 A;  4Z2N A;  2DHI A;  3UZT A;  4P7I A;  2LOZ A;  1UNQ A;  1WI1 A;  3KY9 A;  2D9Y A;  5CLL B;  3PG7 A;  2G35 A;  2CY4 A;  3P6A A;  1NTV A;  1Z87 A;  2KGX B;  1V61 A;  3CXB B;  3F0W A;  3ODO A;  1I7A A;  5J3T A;  2LG1 A;  3X23 A;  3QBV B;  2YS1 A;  4BBK A;  2DHJ A;  2X18 A;  3M1I B;  4K81 A;  5J3Q A;  5CLQ B;  3TVV A;  4K2P A;  5J3Y A;  1ISN A;  1M7E A;  4CHJ A;  1SHC A;  2EC1 A;  2DTC A;  5DIF B;  1TJ6 A;  4ZRI A;  5JHG A;  1QC6 A;  2OQB A;  5C6R A;  2CRF A;  1W1H A;  1GC7 A;  2M38 A;  2YT1 A;  4HDO A;  1PMS A;  1EAZ A;  4IFS A;  1I2H A;  3ODW A;  3TFM A;  5HE0 A;  1FHW A;  3SUZ A;  2ELA A;  2LUL A;  5D3Y A;  3N7C A;  3VIA A;  4XWX A;  2AEH A;  5LON B;  2COA A;  1U29 A;  1UNP A;  3D8F A;  3ODX A;  1OMW A;  3ML4 A;  4HAX B;  1J0W A;  2BCJ A;  4NY0 A;  3LJU X;  1U5G A;  1DDM A;  2D10 A;  3IVF A;  2HTH B;  2YRY A;  4HAV B;  4A6H A;  1LB1 A;  1M7R A;  1EGX A;  4HAT B;  4NSW A;  2GJY A;  1U27 A;  2QKM A;  4L6E A;  1X1G A;  2MFQ A;  5HE1 A;  1X86 A;  4TKN A;  2VRW B;  2P8V A;  1ZC3 B;  2L2I A;  4K17 A;  2NZ8 B;  1H4R A;  3KSY A;  2GCJ A;  4F7G A;  2Z0O A;  1DDW A;  3P7Z A;  1QQG A;  1WG7 A;  4PNK A;  4DX9 0;  5EFX A;  3DXC A;  4HAW B;  1FGY A;  4GMV A;  1U2B A;  1EF1 A;  2EJ8 A;  1E5W A;  2YS5 A;  3SV1 A;  1XOD A;  1WVH A;  1KZ7 A;  2D4Q A;  4H8S A;  4Z2M B;  1J19 A;  2IYB A;  2LKO A;  4F7H A;  2D9W A;  3BIN A;  1V5U A;  2W2W A;  1OQN A;  1KI1 B;  1V5M A;  1WGU A;  3TO1 A;  2VSZ A;  3HK0 A;  2KUP A;  3F5R A;  1AQC A;  2DHK A;  2H7E A;  3OAN A;  2R09 A;  2YT0 A;  1BAK A;  1DBH A;  5KQ4 A;  3A8Q A;  3RCP A;  1WGQ A;  2COF A;  2COD A;  1WJM A;  2I1K A;  2IFS A;  5DHF B;  3PZD A;  4C0A A;  1N3H A;  4B6H A;  1NTY A;  4HDQ A;  3ZVR A;  2D9V A;  3TW1 A;  1EVH A;  4DBB A;  1MIX A;  2Z0P A;  2QKL A;  2W2X D;  2Y7B A;  2Z0Q A;  1NI2 A;  1PLS A;  5JP4 A;  1BTK A;  3DXE A;  3V5W A;  2I5C A;  1FAO A;  1ZSQ A;  4HB3 B;  3O96 A;  1U5F A;  1MIZ B;  4GPT B;  4WVF B;  2UZR A;  5DHA B;  4YL8 A;  5JLJ B;  3ZDT A;  2I5F A;  2OTX A;  2MWN B;  4TYZ A;  1UPQ A;  1Y19 B;  1FB8 A;  1U5E A;  4HHV A;  2NMB A;  2P0D A;  2J0K A;  4YON A;  1H10 A;  5C79 A;  4HAY B;  2ROZ B;  2N0Y A;  3PVW A;  1FHX A;  1GC6 A;  2H7D A;  1XCG A;  1XX0 A;  5D3W A;  2GCL A;  2MKR A;  3G9W A;  3A98 B;  5C5B B;  2RNR B;  2EMT A;  3PSC A;  3U8Z A;  1MKE A;  3VOQ A;  2XQN M;  2R0D A;  3PP2 A;  4GZU A;  2DFK A;  1K5G B;  3FSS A;  3WA0 A;  1PFJ A;  4A6F B;  5FI0 A;  2JP2 A;  5D3V A;  2RUK B;  3SNH A;  1SGH A;  4PQ0 A;  1Q67 A;  4GMX B;  4EKU A;  1V89 A;  1KZG A;  4EMO A;  3T06 A;  3KZ1 A;  2HE7 A;  3HW2 B;  5KCV A;  2UVM A;  2MDX A;  2L1C A;  2J0J A;  2PZ1 A;  1Y5O A;  4EJN A;  5L81 A;  2ELB A;  3NSU A;  1V5P A;  3FEH A;  1K5D B;  1MPH A;  4HAZ B;  2J59 M;  1P3R A;  2AL6 A;  3FM8 C;  1DYN A;  4CHM A;  1X05 A;  1X11 A;  3D8D A;  3GYP A;  4DXA B;  2D2Q A;  1ZM0 A;  2Y8F A;  2Q13 A;  1BTN A;  2RSG A;  4A6K A;  2DN6 A;  2P0F A;  2ZPY A;  1V88 A;  2EMS A;  5FI1 A;  4ZRJ A;  3AJ4 A;  4HB0 B;  4MT7 A;  4MK0 A;  3SYX A;  1DDV A;  2ADZ A;  2K2J A;  1UPR A;  4IAP A;  2YSZ A;  3PVL A;  4KHB B;  1MK9 B;  1ZC4 B;  3PVU A;  4D0N B;  3D8E A;  2K2U A;  4HAU B;  2VKI A;  1X1F A;  2D9Z A;  2YVC A;  2DLW A;  2DYQ A;  4HB2 B;  3GYO A;  4IOY X;  4WJ7 A;  4ZRK A;  2CY5 A;  5HE2 A;  1W1D A;  1B55 A;  2M14 A;  1FHO A;  3CIK A;  3DXD A;  2Y8G A;  2CAY A;  4GN1 A;  2V76 A;  1BWN A;  4HB4 B;  1UEF A;  1XD4 A;  3A8P A;  2DKQ A;  4DX8 A;  2UZS A;  5C5B A;  1XR0 B;  2D9X A;  4KHO A;  4K2O A;  3ULC A;  1OY2 A;  1W1G A;  1GG3 A;  2RLO A;  2E2X A;  1NU2 A;  3AU5 A;  1IRS A;  5D27 A;  1MAI A;  2I1J A;  4A6F A;  1U5D A;  5LOP B;  2DX5 A;  1P6S A;  3AU4 A;  1TXD A;  1FGZ A;  2KCJ A;  4F7U P;  1DRO A;  3SO6 A;  2YS3 A;  1WJ1 A;  1ZVR A;  4KHA A;  2DKP A;  3PEG A;  3MDB C;  3KRX A;  3QWM A;  2RVB B;  2N23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...