2D9YA

Solution structure of the ph domain of pepp-3 from human
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
117
structure length
117
Chain Sequence
GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of PEPP-3 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pleckstrin homology domain-containing protein family A membe
total genus 11
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9yA00
2DA0A 1TXDA 3BINA 2D10A 2CY4A 2DKPA 5JHHA 4HAUB 3D8FA 2DTCA 4DX8A 1MK9B 2GJYA 3FSSA 4KHAA 1DBHA 2CODA 3RCPA 4HB0B 2M38A 1H4RA 1PFJA 1V88A 1U29A 4HB3B 4L6EA 4A5KA 2DHKA 1ZC4B 2MFQA 2L1CA 1W1GA 4BBKA 2ROVA 1RJ2A 2EC1A 4Z2MB 3OANA 2LYDA 1NU2A 3SYXA 2H7EA 3LJUX 2I5FA 3HQCA 3PZDA 2D9YA 2CRFA 1DDWA 2W2XC 2KUPA 4YL8A 2W2XD 3V5WA 4KHOA 2P0FA 1Y5OA 1M7RA 5C79A 3WA0A 3KZ1A 4IAPA 2HTHB 2RNRB 5D3XA 2DHJA 2D9WA 4GN1A 4MT7A 2UZRA 1UPQA 2VKIA 3TW1A 5J3TA 5DIFB 3NSUA 4ZRIA 4HAYB 2UVMA 1RRPB 3DXDA 5D3WA 1FHOA 3FM8C 2Q13A 3A8QA 1M7EA 3F5RA 3G9WA 1NTVA 3DXEA 1IRSA 1QQGA 5DI9B 1V5PA 2CY5A 3ODXA 2DHIA 5LONB 5C5BA 1PLSA 4WVFB 2YSZA 1MK7B 2I5CA 3ML4A 4MY6A 3ULBA 1XX0A 1V5UA 2YF0A 4ZRJA 4Z2NA 4KAXB 2EMSA 1UPRA 4EMOA 2G35A 4IOYX 2LG1A 4K17A 4EKUA 1U5GA 1DDVA 3ULCA 4PNKA 1WG7A 2K2JA 2DX1A 2L2IA 1J19A 1FOEA 2GS0A 1DROA 1FGYA 2COAA 5J3QA 4IFSA 2COCA 2EMTA 3MPXA 1J0WA 2LKOA 1WGQA 1XD4A 1UEFA 1FB8A 2FJLA 2YT0A 5C5BB 4KHBB 4YONA 4GZUA 2LOZA 1GG3A 2I1KA 2K2UA 2RVBB 5C16A 1BTKA 1ZC3B 1XKEA 1ZSQA 3PVWA 2YT1A 1WI1A 3DXCA 3BJIA 3ODOA 5JLJB 3TFMA 1EVHA 3PVLA 4A6FB 1U2BA 3GYPA 2DFKA 4MK0A 1K5GB 3SUZA 2PZ1A 3A98B 5DH9B 2YVCA 4HB4B 2N23A 5JHGA 2D2QA 1OQNA 1V61A 2IFSA 3GYOA 1WVHA 1AWEA 3ZVRA 1MIXA 3X23A 1LB1A 3TCAA 5DHFB 4F7UP 1OMWA 3P7ZA 1BTNA 4NY0A 4D0NB 5HE0A 2D4QA 2V76A 4A6HA 5D27A 2Y8GA 2Z0QA 3HW2B 5HE1A 2I1JA 2P0HA 4F7HA 3PSCA 3SV1A 1W1HA 1LW3A 3U7DA 1X1FA 5J3YA 4TYZA 2YRYA 1GC7A 1P6SA 2HE7A 1X05A 1WJMA 4WSFA 2MKRA 3PG7A 4GMXB 1ISNA 1KZ7A 1H10A 3U8ZA 2X18A 2JP2A 1EF1A 3VOQA 1K5DB 4CYEA 1UNQA 2AEHA 1FAOA 1W1DA 3N7CA 4GXBA 3O96A 2Z0PA 5D3VA 3MDBC 2MDXA 5CLLB 2COFA 2D11A 4B6HA 2DYQA 3T06A 1P5TA 4H8SA 3SNHA 5KQ1A 2AL6A 2E2XA 2J0JA 2KCJA 4K2PA 2DX5A 3HK0A 2VRWB 2K00A 1X86A 2R09A 4PQ0A 2OQBA 5L81A 5LOPB 1WJ1A 3UZTA 2YS3A 4A6FA 3CIKA 2D9ZA 2RLOA 3D8EA 2D9XA 2YS1A 5HE2A 1B55A 2ZPYA 1MKEA 1KZGA 4HDQA 2NZ8B 3PP2A 3QIJA 3PEGA 2NMBA 2RUKB 3KRXA 2MWNB 2ELBA 2QKMA 2GCJA 3A8PA 3QBVB 2P8VA 1BAKA 1V89A 2H7DA 1N3HA 4HAXB 4DX90 1OY2A 3AU5A 1FHWA 3PVUA 4NSWA 2RSGA 4ZRKA 1UNRA 1U5EA 5KCVA 2Y7BA 2P0DA 2IYBA 3WYFB 1WGUA 2N0YA 1Y19B 2RGNB 3IVFA 1GC6A 2ELAA 1UNPA 2Z0OA 3FEHA 1U5DA 1DYNA 1U5FA 3TVVA 4DBBA 1TQZA 3ODWA 3QWMA 2R0DA 1DDMA 2DLWA 2OTXA 4K81A 4GMVA 4K2OA 5EFXA 1I2HA 4KVGB 2QKLA 5DHAB 1X11A 1FHXA 1NTYA 4HHVA 1SHCA 5CLQB 4HATB 2BCJA 5JP4A 3CXBB 1MPHA 2DKQA 3ZDTA 1P3RA 3P6AA 5GOWB 4Y94A 1BWNA 2M14A 2LOXA 4HDOA 1Q67A 5FI1A 2LULA 3D8DA 3KRWA 4CHJA 1TJ6A 4HB2B 5C6RA 2DN6A 3TO1A 3F0WA 1PMSA 1ZM0A 2Y8FA 1MIZB 4GPTB 4HAWB 5HE3A 1MAIA 4TKNA 3KY9A 4P7IA 5FI0A 1U27A 4EJNA 1EGXA 2D9VA 2XQNM 1V5MA 5KQ4A 3M1IB 3VIAA 2EJ8A 1XCGA 2UZSA 4WJ7A 4DXAB 1X1GA 2J59M 1FGZA 1SGHA 2ADZA 4XWXA 5D3YA 1KI1B 3SO6A 1I7AA 4HAVB 2YS5A 3AU4A 4HAZB 2W2WA 2ROZB 3KSYA 1NI2A 1XODA 1QC6A 2GCLA 2VSZA 2J0KA 1E5WA 1ZVRA 4F7GA 4CHMA 2CAYA 2J0MA 3AJ4A 1AQCA 4A6KA 1EAZA 1XR0B 4C0AA 2DYNA 1Z87A 2KGXB
chains in the Genus database with same CATH superfamily
3OHMB 2DA0A 1TXDA 3BINA 2D10A 2CY4A 2DKPA 5JHHA 4HAUB 3D8FA 3NWFA 2DTCA 4DX8A 1MK9B 2GJYA 3FSSA 4KHAA 1DBHA 2CODA 3RCPA 4L1RA 2M38A 1H4RA 1PFJA 4HB0B 1V88A 1U29A 4HB3B 4L6EA 4A5KA 2DHKA 3DCXA 1ZC4B 2MFQA 2L1CA 1W1GA 4BBKA 2ROVA 4D6WA 1RJ2A 2EC1A 4Z2MB 3OANA 2LYDA 1NU2A 3SYXA 2H7EA 3LJUX 2I5FA 3HQCA 3PZDA 2D9YA 2CRFA 1DDWA 2W2XC 2KUPA 4YL8A 2W2XD 3V5WA 4KHOA 2P0FA 1Y5OA 1M7RA 5C79A 3WA0A 2KIGA 3KZ1A 4IAPA 1MI1A 2HTHB 2RNRB 5D3XA 2DHJA 2D9WA 4GN1A 4MT7A 2UZRA 4QXAB 1UPQA 2VKIA 3NWAA 3TW1A 5J3TA 4QJ5B 5DIFB 3NSUA 4ZRIA 2NBVA 4HAYB 2UVMA 1RRPB 3DXDA 5D3WA 1FHOA 3FM8C 2Q13A 3A8QA 1M7EA 3F5RA 3G9WA 1NTVA 3DXEA 1IRSA 1QQGA 5DI9B 1V5PA 4QJ4B 2CY5A 3ODXA 2DHIA 5LONB 5C5BA 1PLSA 4WVFB 2YSZA 1MK7B 2I5CA 3ML4A 4MY6A 3ULBA 1XX0A 1V5UA 2YF0A 4ZRJA 4Z2NA 4KAXB 2EMSA 1UPRA 4EMOA 2G35A 5IRSA 4IOYX 2LG1A 4K17A 4EKUA 1U5GA 1DDVA 3ULCA 4PNKA 1WG7A 2K2JA 2DX1A 2L2IA 1J19A 1FOEA 2GS0A 1DROA 1FGYA 2COAA 5J3QA 4IFSA 2COCA 2EMTA 3MPXA 1J0WA 2LKOA 1WGQA 1XD4A 1UEFA 1FB8A 2FJLA 2YT0A 5C5BB 4KHBB 4YONA 4GZUA 2LOZA 1GG3A 2I1KA 2K2UA 2RVBB 3A58A 5M4YB 5C16A 1BTKA 1ZC3B 1XKEA 1ZSQA 3PVWA 2YT1A 1WI1A 3DXCA 3BJIA 4KHBA 3ODOA 5JLJB 3TFMA 1EVHA 3PVLA 4A6FB 3HSAA 1U2BA 3GYPA 2DFKA 4MK0A 1K5GB 3SUZA 2PZ1A 3A98B 5DH9B 2YVCA 4HB4B 2N23A 5JHGA 2D2QA 1OQNA 1V61A 2IFSA 3GYOA 3NW8A 1WVHA 1AWEA 3B77A 3ZVRA 1MIXA 2Z59A 3X23A 1LB1A 3TCAA 5DHFB 4F7UP 1OMWA 3P7ZA 1BTNA 4NY0A 4D0NB 5HE0A 2D4QA 2V76A 4A6HA 5D27A 2Y8GA 2Z0QA 3HW2B 5HE1A 2I1JA 2P0HA 4F7HA 3PSCA 3SV1A 1W1HA 1LW3A 3U7DA 1X1FA 5J3YA 4TYZA 2YRYA 1GC7A 1P6SA 2HE7A 1X05A 1WJMA 4WSFA 2KIEA 2MKRA 3PG7A 4GMXB 1ISNA 1KZ7A 1H10A 2ZKMX 3U8ZA 2X18A 2JP2A 1EF1A 3VOQA 1K5DB 4CYEA 1UNQA 2AEHA 1FAOA 1W1DA 3N7CA 4GXBA 3O96A 2Z0PA 5D3VA 3MDBC 2MDXA 5CLLB 2COFA 2D11A 3HIEA 4B6HA 2DYQA 3T06A 1P5TA 4H8SA 3SNHA 5KQ1A 2AL6A 2E2XA 2J0JA 2KCJA 4K2PA 2DX5A 3HK0A 2VRWB 1T77A 2K00A 4GOUA 1X86A 3FVCA 2R09A 4PQ0A 2OQBA 5L81A 5LOPB 1WJ1A 3UZTA 2YS3A 4A6FA 3CIKA 2D9ZA 2RLOA 3D8EA 2D9XA 2YS1A 5HE2A 1B55A 2ZPYA 1MKEA 2FJUB 1KZGA 4HDQA 2NZ8B 3PP2A 3QIJA 2Z4DA 3PEGA 2NMBA 2RUKB 5LG4B 3KRXA 2MWNB 2ELBA 2QKMA 2GCJA 3A8PA 3QBVB 2P8VA 1BAKA 1V89A 2H7DA 1N3HA 4HAXB 4DX90 1OY2A 3AU5A 1FHWA 3PVUA 4NSWA 2RSGA 4ZRKA 1UNRA 1U5EA 5KCVA 2Y7BA 2P0DA 2IYBA 3WYFB 2GUMA 1WGUA 2N0YA 4QJ3B 1Y19B 2K8EA 1ZYIA 2RGNB 3IVFA 1GC6A 2ELAA 1UNPA 2Z0OA 3FEHA 1U5DA 1DYNA 1U5FA 3TVVA 4DBBA 1TQZA 3ODWA 3QWMA 2R0DA 1DDMA 2DLWA 2OTXA 3NWDA 4K81A 4GMVA 4K2OA 5EFXA 1I2HA 4KVGB 2QKLA 5DHAB 4HSIA 1X11A 1FHXA 1NTYA 4HHVA 1SHCA 5CLQB 4HATB 2BCJA 5JP4A 3CXBB 1MPHA 2DKQA 3ZDTA 1P3RA 3P6AA 5GOWB 2KUQA 4Y94A 1BWNA 2M14A 2LOXA 4HDOA 2KR0A 1Q67A 5FI1A 2LULA 3D8DA 3U12A 3KRWA 4CHJA 1TJ6A 4HB2B 5C6RA 2DN6A 3TO1A 3F0WA 1PMSA 2K49A 1ZM0A 2Y8FA 1MIZB 4DIXA 4GPTB 4HAWB 5HE3A 1MAIA 4TKNA 3KY9A 4P7IA 5FI0A 4CSQA 1U27A 4EJNA 4OT1A 1EGXA 2D9VA 2Z13A 2XQNM 1V5MA 5KQ4A 3M1IB 3VIAA 2EJ8A 1XCGA 2UZSA 4WJ7A 4DXAB 1X1GA 2J59M 1FGZA 1SGHA 2ADZA 4XWXA 5D3YA 5I2MA 1KI1B 3SO6A 1I7AA 4HAVB 2YS5A 2YT2A 3AU4A 4HAZB 2W2WA 2ROZB 3KSYA 1NI2A 2R2YA 1XODA 1QC6A 2GCLA 2VSZA 2J0KA 1E5WA 1ZVRA 4F7GA 4CHMA 4GNKB 2CAYA 2Z14A 5I2SA 2J0MA 2RRFA 3AJ4A 4OSNA 1AQCA 4A6KA 1EAZA 1XR0B 4C0AA 2DYNA 1Z87A 2KGXB
chains in the Genus database with same CATH topology
2DA0A 1TXDA 3BINA 2D10A 2CY4A 2DKPA 5JHHA 4HAUB 3D8FA 2DTCA 4DX8A 1MK9B 2GJYA 3FSSA 4KHAA 1DBHA 2CODA 3RCPA 4HB0B 2M38A 1H4RA 1PFJA 1V88A 1U29A 4HB3B 4L6EA 4A5KA 2DHKA 1ZC4B 2MFQA 2L1CA 1W1GA 4BBKA 2ROVA 1RJ2A 2EC1A 4Z2MB 3OANA 2LYDA 1NU2A 3SYXA 2H7EA 3LJUX 2I5FA 3HQCA 3PZDA 2D9YA 2CRFA 1DDWA 2W2XC 2KUPA 4YL8A 2W2XD 3V5WA 4KHOA 2P0FA 1Y5OA 1M7RA 5C79A 3WA0A 3KZ1A 4IAPA 2HTHB 2RNRB 5D3XA 2DHJA 2D9WA 4GN1A 4MT7A 2UZRA 1UPQA 2VKIA 3TW1A 5J3TA 5DIFB 3NSUA 4ZRIA 4HAYB 2UVMA 1RRPB 3DXDA 5D3WA 1FHOA 3FM8C 2Q13A 3A8QA 1M7EA 3F5RA 3G9WA 1NTVA 3DXEA 1IRSA 1QQGA 5DI9B 1V5PA 2CY5A 3ODXA 2DHIA 5LONB 5C5BA 1PLSA 4WVFB 2YSZA 1MK7B 2I5CA 3ML4A 4MY6A 3ULBA 1XX0A 1V5UA 2YF0A 4ZRJA 4Z2NA 4KAXB 2EMSA 1UPRA 4EMOA 2G35A 4IOYX 2LG1A 4K17A 4EKUA 1U5GA 1DDVA 3ULCA 4PNKA 1WG7A 2K2JA 2DX1A 2L2IA 1J19A 1FOEA 2GS0A 1DROA 1FGYA 2COAA 5J3QA 4IFSA 2COCA 2EMTA 3MPXA 1J0WA 2LKOA 1WGQA 1XD4A 1UEFA 1FB8A 2FJLA 2YT0A 5C5BB 4KHBB 4YONA 4GZUA 2LOZA 1GG3A 2I1KA 2K2UA 2RVBB 5C16A 1BTKA 1ZC3B 1XKEA 1ZSQA 3PVWA 2YT1A 1WI1A 3DXCA 3BJIA 3ODOA 5JLJB 3TFMA 1EVHA 3PVLA 4A6FB 1U2BA 3GYPA 2DFKA 4MK0A 1K5GB 3SUZA 2PZ1A 3A98B 5DH9B 2YVCA 4HB4B 2N23A 5JHGA 2D2QA 1OQNA 1V61A 2IFSA 3GYOA 1WVHA 1AWEA 3ZVRA 1MIXA 3X23A 1LB1A 3TCAA 5DHFB 4F7UP 1OMWA 3P7ZA 1BTNA 4NY0A 4D0NB 5HE0A 2D4QA 2V76A 4A6HA 5D27A 2Y8GA 2Z0QA 3HW2B 5HE1A 2I1JA 2P0HA 4F7HA 3PSCA 3SV1A 1W1HA 1LW3A 3U7DA 1X1FA 5J3YA 4TYZA 2YRYA 1GC7A 1P6SA 2HE7A 1X05A 1WJMA 4WSFA 2MKRA 3PG7A 4GMXB 1ISNA 1KZ7A 1H10A 3U8ZA 2X18A 2JP2A 1EF1A 3VOQA 1K5DB 4CYEA 1UNQA 2AEHA 1FAOA 1W1DA 3N7CA 4GXBA 3O96A 2Z0PA 5D3VA 3MDBC 2MDXA 5CLLB 2COFA 2D11A 4B6HA 2DYQA 3T06A 1P5TA 4H8SA 3SNHA 5KQ1A 2AL6A 2E2XA 2J0JA 2KCJA 4K2PA 2DX5A 3HK0A 2VRWB 2K00A 1X86A 2R09A 4PQ0A 2OQBA 5L81A 5LOPB 1WJ1A 3UZTA 2YS3A 4A6FA 3CIKA 2D9ZA 2RLOA 3D8EA 2D9XA 2YS1A 5HE2A 1B55A 2ZPYA 1MKEA 1KZGA 4HDQA 2NZ8B 3PP2A 3QIJA 3PEGA 2NMBA 2RUKB 3KRXA 2MWNB 2ELBA 2QKMA 2GCJA 3A8PA 3QBVB 2P8VA 1BAKA 1V89A 2H7DA 1N3HA 4HAXB 4DX90 1OY2A 3AU5A 1FHWA 3PVUA 4NSWA 2RSGA 4ZRKA 1UNRA 1U5EA 5KCVA 2Y7BA 2P0DA 2IYBA 3WYFB 1WGUA 2N0YA 1Y19B 2RGNB 3IVFA 1GC6A 2ELAA 1UNPA 2Z0OA 3FEHA 1U5DA 1DYNA 1U5FA 3TVVA 4DBBA 1TQZA 3ODWA 3QWMA 2R0DA 1DDMA 2DLWA 2OTXA 4K81A 4GMVA 4K2OA 5EFXA 1I2HA 4KVGB 2QKLA 5DHAB 1X11A 1FHXA 1NTYA 4HHVA 1SHCA 5CLQB 4HATB 2BCJA 5JP4A 3CXBB 1MPHA 2DKQA 3ZDTA 1P3RA 3P6AA 5GOWB 4Y94A 1BWNA 2M14A 2LOXA 4HDOA 1Q67A 5FI1A 2LULA 3D8DA 3KRWA 4CHJA 1TJ6A 4HB2B 5C6RA 2DN6A 3TO1A 3F0WA 1PMSA 1ZM0A 2Y8FA 1MIZB 4GPTB 4HAWB 5HE3A 1MAIA 4TKNA 3KY9A 4P7IA 5FI0A 1U27A 4EJNA 1EGXA 2D9VA 2XQNM 1V5MA 5KQ4A 3M1IB 3VIAA 2EJ8A 1XCGA 2UZSA 4WJ7A 4DXAB 1X1GA 2J59M 1FGZA 1SGHA 2ADZA 4XWXA 5D3YA 1KI1B 3SO6A 1I7AA 4HAVB 2YS5A 3AU4A 4HAZB 2W2WA 2ROZB 3KSYA 1NI2A 1XODA 1QC6A 2GCLA 2VSZA 2J0KA 1E5WA 1ZVRA 4F7GA 4CHMA 2CAYA 2J0MA 3AJ4A 1AQCA 4A6KA 1EAZA 1XR0B 4C0AA 2DYNA 1Z87A 2KGXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA0 A;  1TXD A;  3BIN A;  2D10 A;  2CY4 A;  2DKP A;  5JHH A;  4HAU B;  3D8F A;  2DTC A;  4DX8 A;  1MK9 B;  2GJY A;  3FSS A;  4KHA A;  1DBH A;  2COD A;  3RCP A;  4HB0 B;  2M38 A;  1H4R A;  1PFJ A;  1V88 A;  1U29 A;  4HB3 B;  4L6E A;  4A5K A;  2DHK A;  1ZC4 B;  2MFQ A;  2L1C A;  1W1G A;  4BBK A;  2ROV A;  1RJ2 A;  2EC1 A;  4Z2M B;  3OAN A;  2LYD A;  1NU2 A;  3SYX A;  2H7E A;  3LJU X;  2I5F A;  3HQC A;  3PZD A;  2D9Y A;  2CRF A;  1DDW A;  2W2X C;  2KUP A;  4YL8 A;  2W2X D;  3V5W A;  4KHO A;  2P0F A;  1Y5O A;  1M7R A;  5C79 A;  3WA0 A;  3KZ1 A;  4IAP A;  2HTH B;  2RNR B;  5D3X A;  2DHJ A;  2D9W A;  4GN1 A;  4MT7 A;  2UZR A;  1UPQ A;  2VKI A;  3TW1 A;  5J3T A;  5DIF B;  3NSU A;  4ZRI A;  4HAY B;  2UVM A;  1RRP B;  3DXD A;  5D3W A;  1FHO A;  3FM8 C;  2Q13 A;  3A8Q A;  1M7E A;  3F5R A;  3G9W A;  1NTV A;  3DXE A;  1IRS A;  1QQG A;  5DI9 B;  1V5P A;  2CY5 A;  3ODX A;  2DHI A;  5LON B;  5C5B A;  1PLS A;  4WVF B;  2YSZ A;  1MK7 B;  2I5C A;  3ML4 A;  4MY6 A;  3ULB A;  1XX0 A;  1V5U A;  2YF0 A;  4ZRJ A;  4Z2N A;  4KAX B;  2EMS A;  1UPR A;  4EMO A;  2G35 A;  4IOY X;  2LG1 A;  4K17 A;  4EKU A;  1U5G A;  1DDV A;  3ULC A;  4PNK A;  1WG7 A;  2K2J A;  2DX1 A;  2L2I A;  1J19 A;  1FOE A;  2GS0 A;  1DRO A;  1FGY A;  2COA A;  5J3Q A;  4IFS A;  2COC A;  2EMT A;  3MPX A;  1J0W A;  2LKO A;  1WGQ A;  1XD4 A;  1UEF A;  1FB8 A;  2FJL A;  2YT0 A;  5C5B B;  4KHB B;  4YON A;  4GZU A;  2LOZ A;  1GG3 A;  2I1K A;  2K2U A;  2RVB B;  5C16 A;  1BTK A;  1ZC3 B;  1XKE A;  1ZSQ A;  3PVW A;  2YT1 A;  1WI1 A;  3DXC A;  3BJI A;  3ODO A;  5JLJ B;  3TFM A;  1EVH A;  3PVL A;  4A6F B;  1U2B A;  3GYP A;  2DFK A;  4MK0 A;  1K5G B;  3SUZ A;  2PZ1 A;  3A98 B;  5DH9 B;  2YVC A;  4HB4 B;  2N23 A;  5JHG A;  2D2Q A;  1OQN A;  1V61 A;  2IFS A;  3GYO A;  1WVH A;  1AWE A;  3ZVR A;  1MIX A;  3X23 A;  1LB1 A;  3TCA A;  5DHF B;  4F7U P;  1OMW A;  3P7Z A;  1BTN A;  4NY0 A;  4D0N B;  5HE0 A;  2D4Q A;  2V76 A;  4A6H A;  5D27 A;  2Y8G A;  2Z0Q A;  3HW2 B;  5HE1 A;  2I1J A;  2P0H A;  4F7H A;  3PSC A;  3SV1 A;  1W1H A;  1LW3 A;  3U7D A;  1X1F A;  5J3Y A;  4TYZ A;  2YRY A;  1GC7 A;  1P6S A;  2HE7 A;  1X05 A;  1WJM A;  4WSF A;  2MKR A;  3PG7 A;  4GMX B;  1ISN A;  1KZ7 A;  1H10 A;  3U8Z A;  2X18 A;  2JP2 A;  1EF1 A;  3VOQ A;  1K5D B;  4CYE A;  1UNQ A;  2AEH A;  1FAO A;  1W1D A;  3N7C A;  4GXB A;  3O96 A;  2Z0P A;  5D3V A;  3MDB C;  2MDX A;  5CLL B;  2COF A;  2D11 A;  4B6H A;  2DYQ A;  3T06 A;  1P5T A;  4H8S A;  3SNH A;  5KQ1 A;  2AL6 A;  2E2X A;  2J0J A;  2KCJ A;  4K2P A;  2DX5 A;  3HK0 A;  2VRW B;  2K00 A;  1X86 A;  2R09 A;  4PQ0 A;  2OQB A;  5L81 A;  5LOP B;  1WJ1 A;  3UZT A;  2YS3 A;  4A6F A;  3CIK A;  2D9Z A;  2RLO A;  3D8E A;  2D9X A;  2YS1 A;  5HE2 A;  1B55 A;  2ZPY A;  1MKE A;  1KZG A;  4HDQ A;  2NZ8 B;  3PP2 A;  3QIJ A;  3PEG A;  2NMB A;  2RUK B;  3KRX A;  2MWN B;  2ELB A;  2QKM A;  2GCJ A;  3A8P A;  3QBV B;  2P8V A;  1BAK A;  1V89 A;  2H7D A;  1N3H A;  4HAX B;  4DX9 0;  1OY2 A;  3AU5 A;  1FHW A;  3PVU A;  4NSW A;  2RSG A;  4ZRK A;  1UNR A;  1U5E A;  5KCV A;  2Y7B A;  2P0D A;  2IYB A;  3WYF B;  1WGU A;  2N0Y A;  1Y19 B;  2RGN B;  3IVF A;  1GC6 A;  2ELA A;  1UNP A;  2Z0O A;  3FEH A;  1U5D A;  1DYN A;  1U5F A;  3TVV A;  4DBB A;  1TQZ A;  3ODW A;  3QWM A;  2R0D A;  1DDM A;  2DLW A;  2OTX A;  4K81 A;  4GMV A;  4K2O A;  5EFX A;  1I2H A;  4KVG B;  2QKL A;  5DHA B;  1X11 A;  1FHX A;  1NTY A;  4HHV A;  1SHC A;  5CLQ B;  4HAT B;  2BCJ A;  5JP4 A;  3CXB B;  1MPH A;  2DKQ A;  3ZDT A;  1P3R A;  3P6A A;  5GOW B;  4Y94 A;  1BWN A;  2M14 A;  2LOX A;  4HDO A;  1Q67 A;  5FI1 A;  2LUL A;  3D8D A;  3KRW A;  4CHJ A;  1TJ6 A;  4HB2 B;  5C6R A;  2DN6 A;  3TO1 A;  3F0W A;  1PMS A;  1ZM0 A;  2Y8F A;  1MIZ B;  4GPT B;  4HAW B;  5HE3 A;  1MAI A;  4TKN A;  3KY9 A;  4P7I A;  5FI0 A;  1U27 A;  4EJN A;  1EGX A;  2D9V A;  2XQN M;  1V5M A;  5KQ4 A;  3M1I B;  3VIA A;  2EJ8 A;  1XCG A;  2UZS A;  4WJ7 A;  4DXA B;  1X1G A;  2J59 M;  1FGZ A;  1SGH A;  2ADZ A;  4XWX A;  5D3Y A;  1KI1 B;  3SO6 A;  1I7A A;  4HAV B;  2YS5 A;  3AU4 A;  4HAZ B;  2W2W A;  2ROZ B;  3KSY A;  1NI2 A;  1XOD A;  1QC6 A;  2GCL A;  2VSZ A;  2J0K A;  1E5W A;  1ZVR A;  4F7G A;  4CHM A;  2CAY A;  2J0M A;  3AJ4 A;  1AQC A;  4A6K A;  1EAZ A;  1XR0 B;  4C0A A;  2DYN A;  1Z87 A;  2KGX B; 
#chains in the Genus database with same CATH topology
 3OHM B;  2DA0 A;  1TXD A;  3BIN A;  2D10 A;  2CY4 A;  2DKP A;  5JHH A;  4HAU B;  3D8F A;  3NWF A;  2DTC A;  4DX8 A;  1MK9 B;  2GJY A;  3FSS A;  4KHA A;  1DBH A;  2COD A;  3RCP A;  4L1R A;  2M38 A;  1H4R A;  1PFJ A;  4HB0 B;  1V88 A;  1U29 A;  4HB3 B;  4L6E A;  4A5K A;  2DHK A;  3DCX A;  1ZC4 B;  2MFQ A;  2L1C A;  1W1G A;  4BBK A;  2ROV A;  4D6W A;  1RJ2 A;  2EC1 A;  4Z2M B;  3OAN A;  2LYD A;  1NU2 A;  3SYX A;  2H7E A;  3LJU X;  2I5F A;  3HQC A;  3PZD A;  2D9Y A;  2CRF A;  1DDW A;  2W2X C;  2KUP A;  4YL8 A;  2W2X D;  3V5W A;  4KHO A;  2P0F A;  1Y5O A;  1M7R A;  5C79 A;  3WA0 A;  2KIG A;  3KZ1 A;  4IAP A;  1MI1 A;  2HTH B;  2RNR B;  5D3X A;  2DHJ A;  2D9W A;  4GN1 A;  4MT7 A;  2UZR A;  4QXA B;  1UPQ A;  2VKI A;  3NWA A;  3TW1 A;  5J3T A;  4QJ5 B;  5DIF B;  3NSU A;  4ZRI A;  2NBV A;  4HAY B;  2UVM A;  1RRP B;  3DXD A;  5D3W A;  1FHO A;  3FM8 C;  2Q13 A;  3A8Q A;  1M7E A;  3F5R A;  3G9W A;  1NTV A;  3DXE A;  1IRS A;  1QQG A;  5DI9 B;  1V5P A;  4QJ4 B;  2CY5 A;  3ODX A;  2DHI A;  5LON B;  5C5B A;  1PLS A;  4WVF B;  2YSZ A;  1MK7 B;  2I5C A;  3ML4 A;  4MY6 A;  3ULB A;  1XX0 A;  1V5U A;  2YF0 A;  4ZRJ A;  4Z2N A;  4KAX B;  2EMS A;  1UPR A;  4EMO A;  2G35 A;  5IRS A;  4IOY X;  2LG1 A;  4K17 A;  4EKU A;  1U5G A;  1DDV A;  3ULC A;  4PNK A;  1WG7 A;  2K2J A;  2DX1 A;  2L2I A;  1J19 A;  1FOE A;  2GS0 A;  1DRO A;  1FGY A;  2COA A;  5J3Q A;  4IFS A;  2COC A;  2EMT A;  3MPX A;  1J0W A;  2LKO A;  1WGQ A;  1XD4 A;  1UEF A;  1FB8 A;  2FJL A;  2YT0 A;  5C5B B;  4KHB B;  4YON A;  4GZU A;  2LOZ A;  1GG3 A;  2I1K A;  2K2U A;  2RVB B;  3A58 A;  5M4Y B;  5C16 A;  1BTK A;  1ZC3 B;  1XKE A;  1ZSQ A;  3PVW A;  2YT1 A;  1WI1 A;  3DXC A;  3BJI A;  4KHB A;  3ODO A;  5JLJ B;  3TFM A;  1EVH A;  3PVL A;  4A6F B;  3HSA A;  1U2B A;  3GYP A;  2DFK A;  4MK0 A;  1K5G B;  3SUZ A;  2PZ1 A;  3A98 B;  5DH9 B;  2YVC A;  4HB4 B;  2N23 A;  5JHG A;  2D2Q A;  1OQN A;  1V61 A;  2IFS A;  3GYO A;  3NW8 A;  1WVH A;  1AWE A;  3B77 A;  3ZVR A;  1MIX A;  2Z59 A;  3X23 A;  1LB1 A;  3TCA A;  5DHF B;  4F7U P;  1OMW A;  3P7Z A;  1BTN A;  4NY0 A;  4D0N B;  5HE0 A;  2D4Q A;  2V76 A;  4A6H A;  5D27 A;  2Y8G A;  2Z0Q A;  3HW2 B;  5HE1 A;  2I1J A;  2P0H A;  4F7H A;  3PSC A;  3SV1 A;  1W1H A;  1LW3 A;  3U7D A;  1X1F A;  5J3Y A;  4TYZ A;  2YRY A;  1GC7 A;  1P6S A;  2HE7 A;  1X05 A;  1WJM A;  4WSF A;  2KIE A;  2MKR A;  3PG7 A;  4GMX B;  1ISN A;  1KZ7 A;  1H10 A;  2ZKM X;  3U8Z A;  2X18 A;  2JP2 A;  1EF1 A;  3VOQ A;  1K5D B;  4CYE A;  1UNQ A;  2AEH A;  1FAO A;  1W1D A;  3N7C A;  4GXB A;  3O96 A;  2Z0P A;  5D3V A;  3MDB C;  2MDX A;  5CLL B;  2COF A;  2D11 A;  3HIE A;  4B6H A;  2DYQ A;  3T06 A;  1P5T A;  4H8S A;  3SNH A;  5KQ1 A;  2AL6 A;  2E2X A;  2J0J A;  2KCJ A;  4K2P A;  2DX5 A;  3HK0 A;  2VRW B;  1T77 A;  2K00 A;  4GOU A;  1X86 A;  3FVC A;  2R09 A;  4PQ0 A;  2OQB A;  5L81 A;  5LOP B;  1WJ1 A;  3UZT A;  2YS3 A;  4A6F A;  3CIK A;  2D9Z A;  2RLO A;  3D8E A;  2D9X A;  2YS1 A;  5HE2 A;  1B55 A;  2ZPY A;  1MKE A;  2FJU B;  1KZG A;  4HDQ A;  2NZ8 B;  3PP2 A;  3QIJ A;  2Z4D A;  3PEG A;  2NMB A;  2RUK B;  5LG4 B;  3KRX A;  2MWN B;  2ELB A;  2QKM A;  2GCJ A;  3A8P A;  3QBV B;  2P8V A;  1BAK A;  1V89 A;  2H7D A;  1N3H A;  4HAX B;  4DX9 0;  1OY2 A;  3AU5 A;  1FHW A;  3PVU A;  4NSW A;  2RSG A;  4ZRK A;  1UNR A;  1U5E A;  5KCV A;  2Y7B A;  2P0D A;  2IYB A;  3WYF B;  2GUM A;  1WGU A;  2N0Y A;  4QJ3 B;  1Y19 B;  2K8E A;  1ZYI A;  2RGN B;  3IVF A;  1GC6 A;  2ELA A;  1UNP A;  2Z0O A;  3FEH A;  1U5D A;  1DYN A;  1U5F A;  3TVV A;  4DBB A;  1TQZ A;  3ODW A;  3QWM A;  2R0D A;  1DDM A;  2DLW A;  2OTX A;  3NWD A;  4K81 A;  4GMV A;  4K2O A;  5EFX A;  1I2H A;  4KVG B;  2QKL A;  5DHA B;  4HSI A;  1X11 A;  1FHX A;  1NTY A;  4HHV A;  1SHC A;  5CLQ B;  4HAT B;  2BCJ A;  5JP4 A;  3CXB B;  1MPH A;  2DKQ A;  3ZDT A;  1P3R A;  3P6A A;  5GOW B;  2KUQ A;  4Y94 A;  1BWN A;  2M14 A;  2LOX A;  4HDO A;  2KR0 A;  1Q67 A;  5FI1 A;  2LUL A;  3D8D A;  3U12 A;  3KRW A;  4CHJ A;  1TJ6 A;  4HB2 B;  5C6R A;  2DN6 A;  3TO1 A;  3F0W A;  1PMS A;  2K49 A;  1ZM0 A;  2Y8F A;  1MIZ B;  4DIX A;  4GPT B;  4HAW B;  5HE3 A;  1MAI A;  4TKN A;  3KY9 A;  4P7I A;  5FI0 A;  4CSQ A;  1U27 A;  4EJN A;  4OT1 A;  1EGX A;  2D9V A;  2Z13 A;  2XQN M;  1V5M A;  5KQ4 A;  3M1I B;  3VIA A;  2EJ8 A;  1XCG A;  2UZS A;  4WJ7 A;  4DXA B;  1X1G A;  2J59 M;  1FGZ A;  1SGH A;  2ADZ A;  4XWX A;  5D3Y A;  5I2M A;  1KI1 B;  3SO6 A;  1I7A A;  4HAV B;  2YS5 A;  2YT2 A;  3AU4 A;  4HAZ B;  2W2W A;  2ROZ B;  3KSY A;  1NI2 A;  2R2Y A;  1XOD A;  1QC6 A;  2GCL A;  2VSZ A;  2J0K A;  1E5W A;  1ZVR A;  4F7G A;  4CHM A;  4GNK B;  2CAY A;  2Z14 A;  5I2S A;  2J0M A;  2RRF A;  3AJ4 A;  4OSN A;  1AQC A;  4A6K A;  1EAZ A;  1XR0 B;  4C0A A;  2DYN A;  1Z87 A;  2KGX B; 
#chains in the Genus database with same CATH homology
 2DA0 A;  1TXD A;  3BIN A;  2D10 A;  2CY4 A;  2DKP A;  5JHH A;  4HAU B;  3D8F A;  2DTC A;  4DX8 A;  1MK9 B;  2GJY A;  3FSS A;  4KHA A;  1DBH A;  2COD A;  3RCP A;  4HB0 B;  2M38 A;  1H4R A;  1PFJ A;  1V88 A;  1U29 A;  4HB3 B;  4L6E A;  4A5K A;  2DHK A;  1ZC4 B;  2MFQ A;  2L1C A;  1W1G A;  4BBK A;  2ROV A;  1RJ2 A;  2EC1 A;  4Z2M B;  3OAN A;  2LYD A;  1NU2 A;  3SYX A;  2H7E A;  3LJU X;  2I5F A;  3HQC A;  3PZD A;  2D9Y A;  2CRF A;  1DDW A;  2W2X C;  2KUP A;  4YL8 A;  2W2X D;  3V5W A;  4KHO A;  2P0F A;  1Y5O A;  1M7R A;  5C79 A;  3WA0 A;  3KZ1 A;  4IAP A;  2HTH B;  2RNR B;  5D3X A;  2DHJ A;  2D9W A;  4GN1 A;  4MT7 A;  2UZR A;  1UPQ A;  2VKI A;  3TW1 A;  5J3T A;  5DIF B;  3NSU A;  4ZRI A;  4HAY B;  2UVM A;  1RRP B;  3DXD A;  5D3W A;  1FHO A;  3FM8 C;  2Q13 A;  3A8Q A;  1M7E A;  3F5R A;  3G9W A;  1NTV A;  3DXE A;  1IRS A;  1QQG A;  5DI9 B;  1V5P A;  2CY5 A;  3ODX A;  2DHI A;  5LON B;  5C5B A;  1PLS A;  4WVF B;  2YSZ A;  1MK7 B;  2I5C A;  3ML4 A;  4MY6 A;  3ULB A;  1XX0 A;  1V5U A;  2YF0 A;  4ZRJ A;  4Z2N A;  4KAX B;  2EMS A;  1UPR A;  4EMO A;  2G35 A;  4IOY X;  2LG1 A;  4K17 A;  4EKU A;  1U5G A;  1DDV A;  3ULC A;  4PNK A;  1WG7 A;  2K2J A;  2DX1 A;  2L2I A;  1J19 A;  1FOE A;  2GS0 A;  1DRO A;  1FGY A;  2COA A;  5J3Q A;  4IFS A;  2COC A;  2EMT A;  3MPX A;  1J0W A;  2LKO A;  1WGQ A;  1XD4 A;  1UEF A;  1FB8 A;  2FJL A;  2YT0 A;  5C5B B;  4KHB B;  4YON A;  4GZU A;  2LOZ A;  1GG3 A;  2I1K A;  2K2U A;  2RVB B;  5C16 A;  1BTK A;  1ZC3 B;  1XKE A;  1ZSQ A;  3PVW A;  2YT1 A;  1WI1 A;  3DXC A;  3BJI A;  3ODO A;  5JLJ B;  3TFM A;  1EVH A;  3PVL A;  4A6F B;  1U2B A;  3GYP A;  2DFK A;  4MK0 A;  1K5G B;  3SUZ A;  2PZ1 A;  3A98 B;  5DH9 B;  2YVC A;  4HB4 B;  2N23 A;  5JHG A;  2D2Q A;  1OQN A;  1V61 A;  2IFS A;  3GYO A;  1WVH A;  1AWE A;  3ZVR A;  1MIX A;  3X23 A;  1LB1 A;  3TCA A;  5DHF B;  4F7U P;  1OMW A;  3P7Z A;  1BTN A;  4NY0 A;  4D0N B;  5HE0 A;  2D4Q A;  2V76 A;  4A6H A;  5D27 A;  2Y8G A;  2Z0Q A;  3HW2 B;  5HE1 A;  2I1J A;  2P0H A;  4F7H A;  3PSC A;  3SV1 A;  1W1H A;  1LW3 A;  3U7D A;  1X1F A;  5J3Y A;  4TYZ A;  2YRY A;  1GC7 A;  1P6S A;  2HE7 A;  1X05 A;  1WJM A;  4WSF A;  2MKR A;  3PG7 A;  4GMX B;  1ISN A;  1KZ7 A;  1H10 A;  3U8Z A;  2X18 A;  2JP2 A;  1EF1 A;  3VOQ A;  1K5D B;  4CYE A;  1UNQ A;  2AEH A;  1FAO A;  1W1D A;  3N7C A;  4GXB A;  3O96 A;  2Z0P A;  5D3V A;  3MDB C;  2MDX A;  5CLL B;  2COF A;  2D11 A;  4B6H A;  2DYQ A;  3T06 A;  1P5T A;  4H8S A;  3SNH A;  5KQ1 A;  2AL6 A;  2E2X A;  2J0J A;  2KCJ A;  4K2P A;  2DX5 A;  3HK0 A;  2VRW B;  2K00 A;  1X86 A;  2R09 A;  4PQ0 A;  2OQB A;  5L81 A;  5LOP B;  1WJ1 A;  3UZT A;  2YS3 A;  4A6F A;  3CIK A;  2D9Z A;  2RLO A;  3D8E A;  2D9X A;  2YS1 A;  5HE2 A;  1B55 A;  2ZPY A;  1MKE A;  1KZG A;  4HDQ A;  2NZ8 B;  3PP2 A;  3QIJ A;  3PEG A;  2NMB A;  2RUK B;  3KRX A;  2MWN B;  2ELB A;  2QKM A;  2GCJ A;  3A8P A;  3QBV B;  2P8V A;  1BAK A;  1V89 A;  2H7D A;  1N3H A;  4HAX B;  4DX9 0;  1OY2 A;  3AU5 A;  1FHW A;  3PVU A;  4NSW A;  2RSG A;  4ZRK A;  1UNR A;  1U5E A;  5KCV A;  2Y7B A;  2P0D A;  2IYB A;  3WYF B;  1WGU A;  2N0Y A;  1Y19 B;  2RGN B;  3IVF A;  1GC6 A;  2ELA A;  1UNP A;  2Z0O A;  3FEH A;  1U5D A;  1DYN A;  1U5F A;  3TVV A;  4DBB A;  1TQZ A;  3ODW A;  3QWM A;  2R0D A;  1DDM A;  2DLW A;  2OTX A;  4K81 A;  4GMV A;  4K2O A;  5EFX A;  1I2H A;  4KVG B;  2QKL A;  5DHA B;  1X11 A;  1FHX A;  1NTY A;  4HHV A;  1SHC A;  5CLQ B;  4HAT B;  2BCJ A;  5JP4 A;  3CXB B;  1MPH A;  2DKQ A;  3ZDT A;  1P3R A;  3P6A A;  5GOW B;  4Y94 A;  1BWN A;  2M14 A;  2LOX A;  4HDO A;  1Q67 A;  5FI1 A;  2LUL A;  3D8D A;  3KRW A;  4CHJ A;  1TJ6 A;  4HB2 B;  5C6R A;  2DN6 A;  3TO1 A;  3F0W A;  1PMS A;  1ZM0 A;  2Y8F A;  1MIZ B;  4GPT B;  4HAW B;  5HE3 A;  1MAI A;  4TKN A;  3KY9 A;  4P7I A;  5FI0 A;  1U27 A;  4EJN A;  1EGX A;  2D9V A;  2XQN M;  1V5M A;  5KQ4 A;  3M1I B;  3VIA A;  2EJ8 A;  1XCG A;  2UZS A;  4WJ7 A;  4DXA B;  1X1G A;  2J59 M;  1FGZ A;  1SGH A;  2ADZ A;  4XWX A;  5D3Y A;  1KI1 B;  3SO6 A;  1I7A A;  4HAV B;  2YS5 A;  3AU4 A;  4HAZ B;  2W2W A;  2ROZ B;  3KSY A;  1NI2 A;  1XOD A;  1QC6 A;  2GCL A;  2VSZ A;  2J0K A;  1E5W A;  1ZVR A;  4F7G A;  4CHM A;  2CAY A;  2J0M A;  3AJ4 A;  1AQC A;  4A6K A;  1EAZ A;  1XR0 B;  4C0A A;  2DYN A;  1Z87 A;  2KGX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...