2D9ZA

Solution structure of the ph domain of protein kinase c, nu type from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
129
structure length
129
Chain Sequence
GSSGSSGMVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQGSNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of Protein kinase C, nu type from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Protein kinase C, nu type
total genus 13
structure length 129
sequence length 129
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9zA01
3HK0A 1NTYA 3ML4A 4HAYB 1BTKA 3MDBC 1M7EA 3TO1A 4HDOA 1GG3A 2HE7A 4DX90 3OANA 3D8FA 4HAUB 3ZVRA 3ULCA 2R0DA 2CY5A 2DA0A 4HDQA 1FB8A 4PQ0A 1MPHA 1I2HA 5L81A 5JHGA 4DXAB 4KHAA 5D3WA 4K17A 3SO6A 4K81A 2DX5A 3BJIA 3PZDA 1RJ2A 2ADZA 1E5WA 2NMBA 2UVMA 4Y94A 2DX1A 4K2PA 5HE2A 2YT0A 3TCAA 4HAXB 1W1GA 3WYFB 1NTVA 5KQ4A 2YS1A 3U7DA 4P7IA 1U2BA 3DXDA 1J19A 5C5BB 5FI1A 4HATB 4HHVA 3DXCA 3T06A 1GC6A 3M1IB 4Z2NA 2G35A 4IAPA 2Y8GA 1BWNA 1PLSA 3A8QA 1LW3A 2PZ1A 2W2WA 1EAZA 1TQZA 4A5KA 5HE1A 5C5BA 2J59M 2N23A 1WJMA 2DFKA 3X23A 4EJNA 3SNHA 2UZSA 2ROZB 4KVGB 5DI9B 1UNRA 2QKMA 5LOPB 3PSCA 3ODOA 1DDVA 3VIAA 1WGUA 1Z87A 2GCLA 3LJUX 1EVHA 2P0HA 4YONA 3GYPA 4CHMA 4ZRIA 3HW2B 1Q67A 4WJ7A 3KY9A 2JP2A 4HAVB 3VOQA 1X1GA 1XODA 2V76A 5DIFB 4IOYX 2CAYA 1FAOA 1K5GB 4HB3B 5KQ1A 4BBKA 3TFMA 2DHJA 2XQNM 4MT7A 1EGXA 4KAXB 1V5MA 2DHKA 4C0AA 3PVLA 2Y7BA 1DYNA 2LOXA 5JHHA 2J0JA 4WSFA 1W1DA 3KRWA 2ELBA 4XWXA 1DBHA 1DDMA 1K5DB 5J3TA 1XR0B 1U5DA 3KRXA 1GC7A 4B6HA 5JP4A 4GXBA 3AU5A 2D10A 1DDWA 5D27A 3MPXA 2EJ8A 2D9VA 1OQNA 1V5PA 3BINA 3ODXA 5LONB 4IFSA 2VRWB 3CIKA 1RRPB 1FOEA 1X1FA 1Y19B 2GJYA 2YS5A 1MK7B 4F7GA 4F7UP 4ZRJA 1TJ6A 2D9ZA 4EKUA 1V89A 2BCJA 1ISNA 2AEHA 1TXDA 2Q13A 4ZRKA 2I1JA 2Y8FA 4K2OA 2YVCA 1SGHA 2KCJA 1P3RA 5DHAB 1OY2A 1UNQA 3U8ZA 4HB0B 2M38A 2W2XC 3G9WA 4D0NB 2D9YA 2CY4A 5FI0A 2RLOA 1N3HA 1WGQA 2X18A 4GN1A 1H4RA 2MKRA 2L2IA 2UZRA 3PG7A 2MWNB 2P0FA 2DLWA 2VKIA 4A6FA 2YS3A 5EFXA 1WJ1A 2CRFA 1FHOA 4DBBA 2LOZA 2J0MA 2CODA 2P0DA 3IVFA 3N7CA 2DTCA 3A8PA 2K2JA 4H8SA 3QWMA 3WA0A 1UPRA 2MDXA 3ULBA 2OTXA 1AWEA 1ZSQA 4PNKA 1ZC4B 1NU2A 1U5FA 5HE0A 2COAA 3SYXA 1FGZA 1QQGA 1XCGA 5D3YA 1XD4A 3FEHA 5HE3A 3HQCA 3AU4A 1V61A 2YF0A 4GMVA 2IFSA 1P6SA 1V88A 5CLLB 2ZPYA 1U27A 1U29A 2ROVA 2Z0QA 2I5FA 4GMXB 5DHFB 1BTNA 4HB4B 2R09A 2DKPA 2LKOA 2H7EA 1MAIA 1WG7A 4CYEA 3RCPA 2NZ8B 3A98B 3V5WA 2OQBA 4HAZB 2GS0A 2W2XD 1FGYA 2LG1A 2D4QA 4A6FB 4KHBB 3D8EA 5GOWB 2EMSA 4MK0A 3P6AA 1XX0A 3DXEA 2RGNB 1QC6A 4NSWA 2Z0OA 1PMSA 1ZC3B 2DYNA 1J0WA 3FSSA 1OMWA 1BAKA 1U5GA 1H10A 1DROA 1AQCA 5D3VA 2AL6A 1V5UA 3TW1A 1X05A 2LULA 2E2XA 4TYZA 5C16A 1U5EA 4TKNA 3SUZA 1B55A 2RSGA 3QBVB 3QIJA 4HAWB 1EF1A 2D9WA 4GPTB 2COFA 3D8DA 2K00A 4HB2B 4A6KA 5D3XA 2YRYA 2DN6A 4L6EA 2DKQA 2GCJA 3F0WA 2YT1A 2FJLA 2N0YA 5C79A 3UZTA 2COCA 3NSUA 4EMOA 2I1KA 5C6RA 2D9XA 1PFJA 4YL8A 1MK9B 3KZ1A 3GYOA 4DX8A 4MY6A 1UPQA 1MIXA 4NY0A 3AJ4A 5CLQB 3PEGA 1KI1B 2D11A 2M14A 5DH9B 1LB1A 1ZVRA 1IRSA 2D2QA 2QKLA 2KGXB 1WVHA 2Z0PA 2HTHB 5J3YA 2MFQA 1FHWA 3PVWA 2YSZA 2EC1A 1KZ7A 1WI1A 3SV1A 5JLJB 3CXBB 1XKEA 3PP2A 2J0KA 3KSYA 1KZGA 2RVBB 3P7ZA 4KHOA 4CHJA 3O96A 1NI2A 1W1HA 2RNRB 4WVFB 4A6HA 2L1CA 3FM8C 1X86A 1FHXA 4F7HA 1I7AA 1SHCA 1UNPA 2DHIA 2P8VA 1M7RA 2EMTA 3ZDTA 2VSZA 2ELAA 3TVVA 2I5CA 5J3QA 1ZM0A 1Y5OA 2LYDA 2KUPA 3ODWA 4GZUA 2DYQA 1MIZB 2RUKB 5KCVA 1MKEA 4Z2MB 1P5TA 3PVUA 2IYBA 2K2UA 3F5RA 1UEFA 1X11A 2H7DA
chains in the Genus database with same CATH superfamily
3HK0A 1NTYA 3ML4A 4HAYB 1BTKA 3MDBC 1M7EA 3TO1A 4HDOA 4D6WA 1GG3A 2HE7A 4DX90 3OANA 3D8FA 4HAUB 3ZVRA 3ULCA 2R0DA 2CY5A 2DA0A 4HDQA 1FB8A 4PQ0A 1MPHA 1I2HA 5L81A 5JHGA 4DXAB 4KHAA 5D3WA 4K17A 3SO6A 4K81A 3B77A 2DX5A 3DCXA 3BJIA 4L1RA 3PZDA 1RJ2A 2ADZA 1E5WA 2NMBA 2UVMA 4Y94A 2DX1A 4K2PA 5HE2A 2YT0A 3TCAA 4HAXB 5LG4B 1W1GA 2KIGA 3WYFB 2KR0A 5I2MA 1NTVA 5KQ4A 2YS1A 3U7DA 4P7IA 1U2BA 3DXDA 1J19A 5C5BB 5FI1A 4HATB 4HHVA 3DXCA 3T06A 1GC6A 3M1IB 4Z2NA 2G35A 2K49A 4IAPA 2Y8GA 1BWNA 4OSNA 4CSQA 1PLSA 3A8QA 1LW3A 2PZ1A 4GOUA 2W2WA 1EAZA 1TQZA 4A5KA 5HE1A 5C5BA 2J59M 2N23A 1WJMA 2DFKA 3X23A 4EJNA 3SNHA 2UZSA 2ROZB 4KVGB 5DI9B 1UNRA 2QKMA 5LOPB 3PSCA 3ODOA 1DDVA 3VIAA 1WGUA 1Z87A 2ZKMX 2GCLA 3LJUX 1EVHA 2P0HA 4YONA 3GYPA 4CHMA 4ZRIA 2FJUB 3HW2B 1Q67A 4WJ7A 3KY9A 2JP2A 4HAVB 3VOQA 3NWAA 1X1GA 4QXAB 2NBVA 1XODA 2V76A 5DIFB 4IOYX 1MI1A 2CAYA 1FAOA 1K5GB 4HB3B 5KQ1A 4BBKA 2Z14A 3TFMA 2DHJA 2XQNM 4MT7A 1EGXA 4KAXB 1V5MA 2DHKA 4C0AA 3PVLA 2Y7BA 1DYNA 2LOXA 5JHHA 2J0JA 4WSFA 1W1DA 3KRWA 2ELBA 4XWXA 1DBHA 3NWFA 1K5DB 5J3TA 1DDMA 1XR0B 1U5DA 3KRXA 1GC7A 4B6HA 2K8EA 5JP4A 4KHBA 4GXBA 3AU5A 2D10A 1DDWA 5D27A 3MPXA 2EJ8A 2D9VA 1OQNA 1V5PA 3BINA 3ODXA 5LONB 4IFSA 2VRWB 3CIKA 1RRPB 1FOEA 1X1FA 1Y19B 2GJYA 2YS5A 1MK7B 4F7GA 4F7UP 4ZRJA 3OHMB 1TJ6A 2D9ZA 4EKUA 1V89A 2BCJA 1ISNA 2AEHA 1TXDA 2Q13A 4ZRKA 2I1JA 2Y8FA 4K2OA 2YVCA 1SGHA 3A58A 2KCJA 1P3RA 5DHAB 4QJ5B 1OY2A 1UNQA 3U8ZA 4HB0B 2M38A 2W2XC 3G9WA 4D0NB 2D9YA 3NWDA 2CY4A 5FI0A 2RLOA 1N3HA 1WGQA 2KUQA 2X18A 5I2SA 4GN1A 1H4RA 2MKRA 2L2IA 2UZRA 3PG7A 2MWNB 2P0FA 2DLWA 2VKIA 4HSIA 4A6FA 2YS3A 5EFXA 1WJ1A 2CRFA 1FHOA 4DBBA 2LOZA 2J0MA 2CODA 2P0DA 3IVFA 3N7CA 2DTCA 3A8PA 2K2JA 4H8SA 3QWMA 3WA0A 1UPRA 2MDXA 3ULBA 2OTXA 1AWEA 1ZSQA 4PNKA 1ZC4B 1NU2A 1U5FA 5HE0A 2COAA 3SYXA 1FGZA 1QQGA 1XCGA 5D3YA 1XD4A 3FEHA 5HE3A 3HQCA 3AU4A 1V61A 2YF0A 4GMVA 2IFSA 1P6SA 1V88A 5CLLB 2ZPYA 1U27A 4OT1A 1U29A 2ROVA 2Z0QA 2I5FA 4GMXB 5DHFB 1BTNA 4HB4B 2R09A 2DKPA 2LKOA 2H7EA 1MAIA 1WG7A 4CYEA 3RCPA 2NZ8B 3A98B 3V5WA 2OQBA 4HAZB 2GS0A 2W2XD 1FGYA 2LG1A 2D4QA 4A6FB 4KHBB 3D8EA 5GOWB 4DIXA 2EMSA 4MK0A 3P6AA 1XX0A 3DXEA 5M4YB 2RGNB 1QC6A 4NSWA 2Z0OA 1PMSA 1ZC3B 2DYNA 2Z59A 1J0WA 3FSSA 1OMWA 1BAKA 1T77A 1U5GA 1H10A 2Z4DA 1DROA 1AQCA 5D3VA 3U12A 2AL6A 1V5UA 3TW1A 1X05A 2LULA 2E2XA 4TYZA 5C16A 1U5EA 4TKNA 3SUZA 1B55A 2RSGA 3QBVB 3QIJA 4HAWB 1EF1A 2D9WA 4GPTB 2COFA 3D8DA 2K00A 4HB2B 2YT2A 4A6KA 5D3XA 2YRYA 2DN6A 4L6EA 2DKQA 2GCJA 3HSAA 3F0WA 2YT1A 3FVCA 2FJLA 2N0YA 2GUMA 5C79A 3UZTA 2COCA 3NSUA 4EMOA 2I1KA 5C6RA 2D9XA 1PFJA 4YL8A 1MK9B 3KZ1A 3GYOA 4DX8A 4MY6A 1UPQA 1MIXA 4NY0A 3AJ4A 5IRSA 5CLQB 3PEGA 1KI1B 2D11A 2M14A 5DH9B 1LB1A 1ZVRA 1IRSA 2D2QA 2QKLA 2KGXB 1WVHA 2Z0PA 2HTHB 4QJ3B 5J3YA 2MFQA 1FHWA 3PVWA 2YSZA 2KIEA 2EC1A 1KZ7A 1WI1A 3SV1A 5JLJB 2R2YA 3CXBB 1XKEA 3PP2A 2J0KA 3KSYA 1KZGA 2RVBB 3P7ZA 4KHOA 4CHJA 3O96A 1NI2A 1W1HA 2RNRB 4WVFB 4A6HA 2L1CA 3FM8C 1X86A 1FHXA 4QJ4B 4F7HA 1I7AA 1SHCA 1UNPA 2DHIA 2P8VA 1M7RA 4GNKB 2EMTA 3HIEA 3ZDTA 2Z13A 2VSZA 2ELAA 3TVVA 2RRFA 2I5CA 5J3QA 1ZM0A 1Y5OA 2LYDA 2KUPA 3ODWA 4GZUA 2DYQA 1MIZB 2RUKB 5KCVA 1MKEA 1ZYIA 4Z2MB 1P5TA 3PVUA 2IYBA 2K2UA 3F5RA 1UEFA 1X11A 3NW8A 2H7DA
chains in the Genus database with same CATH topology
3HK0A 1NTYA 3ML4A 4HAYB 1BTKA 3MDBC 1M7EA 3TO1A 4HDOA 1GG3A 2HE7A 4DX90 3OANA 3D8FA 4HAUB 3ZVRA 3ULCA 2R0DA 2CY5A 2DA0A 4HDQA 1FB8A 4PQ0A 1MPHA 1I2HA 5L81A 5JHGA 4DXAB 4KHAA 5D3WA 4K17A 3SO6A 4K81A 2DX5A 3BJIA 3PZDA 1RJ2A 2ADZA 1E5WA 2NMBA 2UVMA 4Y94A 2DX1A 4K2PA 5HE2A 2YT0A 3TCAA 4HAXB 1W1GA 3WYFB 1NTVA 5KQ4A 2YS1A 3U7DA 4P7IA 1U2BA 3DXDA 1J19A 5C5BB 5FI1A 4HATB 4HHVA 3DXCA 3T06A 1GC6A 3M1IB 4Z2NA 2G35A 4IAPA 2Y8GA 1BWNA 1PLSA 3A8QA 1LW3A 2PZ1A 2W2WA 1EAZA 1TQZA 4A5KA 5HE1A 5C5BA 2J59M 2N23A 1WJMA 2DFKA 3X23A 4EJNA 3SNHA 2UZSA 2ROZB 4KVGB 5DI9B 1UNRA 2QKMA 5LOPB 3PSCA 3ODOA 1DDVA 3VIAA 1WGUA 1Z87A 2GCLA 3LJUX 1EVHA 2P0HA 4YONA 3GYPA 4CHMA 4ZRIA 3HW2B 1Q67A 4WJ7A 3KY9A 2JP2A 4HAVB 3VOQA 1X1GA 1XODA 2V76A 5DIFB 4IOYX 2CAYA 1FAOA 1K5GB 4HB3B 5KQ1A 4BBKA 3TFMA 2DHJA 2XQNM 4MT7A 1EGXA 4KAXB 1V5MA 2DHKA 4C0AA 3PVLA 2Y7BA 1DYNA 2LOXA 5JHHA 2J0JA 4WSFA 1W1DA 3KRWA 2ELBA 4XWXA 1DBHA 1DDMA 1K5DB 5J3TA 1XR0B 1U5DA 3KRXA 1GC7A 4B6HA 5JP4A 4GXBA 3AU5A 2D10A 1DDWA 5D27A 3MPXA 2EJ8A 2D9VA 1OQNA 1V5PA 3BINA 3ODXA 5LONB 4IFSA 2VRWB 3CIKA 1RRPB 1FOEA 1X1FA 1Y19B 2GJYA 2YS5A 1MK7B 4F7GA 4F7UP 4ZRJA 1TJ6A 2D9ZA 4EKUA 1V89A 2BCJA 1ISNA 2AEHA 1TXDA 2Q13A 4ZRKA 2I1JA 2Y8FA 4K2OA 2YVCA 1SGHA 2KCJA 1P3RA 5DHAB 1OY2A 1UNQA 3U8ZA 4HB0B 2M38A 2W2XC 3G9WA 4D0NB 2D9YA 2CY4A 5FI0A 2RLOA 1N3HA 1WGQA 2X18A 4GN1A 1H4RA 2MKRA 2L2IA 2UZRA 3PG7A 2MWNB 2P0FA 2DLWA 2VKIA 4A6FA 2YS3A 5EFXA 1WJ1A 2CRFA 1FHOA 4DBBA 2LOZA 2J0MA 2CODA 2P0DA 3IVFA 3N7CA 2DTCA 3A8PA 2K2JA 4H8SA 3QWMA 3WA0A 1UPRA 2MDXA 3ULBA 2OTXA 1AWEA 1ZSQA 4PNKA 1ZC4B 1NU2A 1U5FA 5HE0A 2COAA 3SYXA 1FGZA 1QQGA 1XCGA 5D3YA 1XD4A 3FEHA 5HE3A 3HQCA 3AU4A 1V61A 2YF0A 4GMVA 2IFSA 1P6SA 1V88A 5CLLB 2ZPYA 1U27A 1U29A 2ROVA 2Z0QA 2I5FA 4GMXB 5DHFB 1BTNA 4HB4B 2R09A 2DKPA 2LKOA 2H7EA 1MAIA 1WG7A 4CYEA 3RCPA 2NZ8B 3A98B 3V5WA 2OQBA 4HAZB 2GS0A 2W2XD 1FGYA 2LG1A 2D4QA 4A6FB 4KHBB 3D8EA 5GOWB 2EMSA 4MK0A 3P6AA 1XX0A 3DXEA 2RGNB 1QC6A 4NSWA 2Z0OA 1PMSA 1ZC3B 2DYNA 1J0WA 3FSSA 1OMWA 1BAKA 1U5GA 1H10A 1DROA 1AQCA 5D3VA 2AL6A 1V5UA 3TW1A 1X05A 2LULA 2E2XA 4TYZA 5C16A 1U5EA 4TKNA 3SUZA 1B55A 2RSGA 3QBVB 3QIJA 4HAWB 1EF1A 2D9WA 4GPTB 2COFA 3D8DA 2K00A 4HB2B 4A6KA 5D3XA 2YRYA 2DN6A 4L6EA 2DKQA 2GCJA 3F0WA 2YT1A 2FJLA 2N0YA 5C79A 3UZTA 2COCA 3NSUA 4EMOA 2I1KA 5C6RA 2D9XA 1PFJA 4YL8A 1MK9B 3KZ1A 3GYOA 4DX8A 4MY6A 1UPQA 1MIXA 4NY0A 3AJ4A 5CLQB 3PEGA 1KI1B 2D11A 2M14A 5DH9B 1LB1A 1ZVRA 1IRSA 2D2QA 2QKLA 2KGXB 1WVHA 2Z0PA 2HTHB 5J3YA 2MFQA 1FHWA 3PVWA 2YSZA 2EC1A 1KZ7A 1WI1A 3SV1A 5JLJB 3CXBB 1XKEA 3PP2A 2J0KA 3KSYA 1KZGA 2RVBB 3P7ZA 4KHOA 4CHJA 3O96A 1NI2A 1W1HA 2RNRB 4WVFB 4A6HA 2L1CA 3FM8C 1X86A 1FHXA 4F7HA 1I7AA 1SHCA 1UNPA 2DHIA 2P8VA 1M7RA 2EMTA 3ZDTA 2VSZA 2ELAA 3TVVA 2I5CA 5J3QA 1ZM0A 1Y5OA 2LYDA 2KUPA 3ODWA 4GZUA 2DYQA 1MIZB 2RUKB 5KCVA 1MKEA 4Z2MB 1P5TA 3PVUA 2IYBA 2K2UA 3F5RA 1UEFA 1X11A 2H7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HK0 A;  1NTY A;  3ML4 A;  4HAY B;  1BTK A;  3MDB C;  1M7E A;  3TO1 A;  4HDO A;  1GG3 A;  2HE7 A;  4DX9 0;  3OAN A;  3D8F A;  4HAU B;  3ZVR A;  3ULC A;  2R0D A;  2CY5 A;  2DA0 A;  4HDQ A;  1FB8 A;  4PQ0 A;  1MPH A;  1I2H A;  5L81 A;  5JHG A;  4DXA B;  4KHA A;  5D3W A;  4K17 A;  3SO6 A;  4K81 A;  2DX5 A;  3BJI A;  3PZD A;  1RJ2 A;  2ADZ A;  1E5W A;  2NMB A;  2UVM A;  4Y94 A;  2DX1 A;  4K2P A;  5HE2 A;  2YT0 A;  3TCA A;  4HAX B;  1W1G A;  3WYF B;  1NTV A;  5KQ4 A;  2YS1 A;  3U7D A;  4P7I A;  1U2B A;  3DXD A;  1J19 A;  5C5B B;  5FI1 A;  4HAT B;  4HHV A;  3DXC A;  3T06 A;  1GC6 A;  3M1I B;  4Z2N A;  2G35 A;  4IAP A;  2Y8G A;  1BWN A;  1PLS A;  3A8Q A;  1LW3 A;  2PZ1 A;  2W2W A;  1EAZ A;  1TQZ A;  4A5K A;  5HE1 A;  5C5B A;  2J59 M;  2N23 A;  1WJM A;  2DFK A;  3X23 A;  4EJN A;  3SNH A;  2UZS A;  2ROZ B;  4KVG B;  5DI9 B;  1UNR A;  2QKM A;  5LOP B;  3PSC A;  3ODO A;  1DDV A;  3VIA A;  1WGU A;  1Z87 A;  2GCL A;  3LJU X;  1EVH A;  2P0H A;  4YON A;  3GYP A;  4CHM A;  4ZRI A;  3HW2 B;  1Q67 A;  4WJ7 A;  3KY9 A;  2JP2 A;  4HAV B;  3VOQ A;  1X1G A;  1XOD A;  2V76 A;  5DIF B;  4IOY X;  2CAY A;  1FAO A;  1K5G B;  4HB3 B;  5KQ1 A;  4BBK A;  3TFM A;  2DHJ A;  2XQN M;  4MT7 A;  1EGX A;  4KAX B;  1V5M A;  2DHK A;  4C0A A;  3PVL A;  2Y7B A;  1DYN A;  2LOX A;  5JHH A;  2J0J A;  4WSF A;  1W1D A;  3KRW A;  2ELB A;  4XWX A;  1DBH A;  1DDM A;  1K5D B;  5J3T A;  1XR0 B;  1U5D A;  3KRX A;  1GC7 A;  4B6H A;  5JP4 A;  4GXB A;  3AU5 A;  2D10 A;  1DDW A;  5D27 A;  3MPX A;  2EJ8 A;  2D9V A;  1OQN A;  1V5P A;  3BIN A;  3ODX A;  5LON B;  4IFS A;  2VRW B;  3CIK A;  1RRP B;  1FOE A;  1X1F A;  1Y19 B;  2GJY A;  2YS5 A;  1MK7 B;  4F7G A;  4F7U P;  4ZRJ A;  1TJ6 A;  2D9Z A;  4EKU A;  1V89 A;  2BCJ A;  1ISN A;  2AEH A;  1TXD A;  2Q13 A;  4ZRK A;  2I1J A;  2Y8F A;  4K2O A;  2YVC A;  1SGH A;  2KCJ A;  1P3R A;  5DHA B;  1OY2 A;  1UNQ A;  3U8Z A;  4HB0 B;  2M38 A;  2W2X C;  3G9W A;  4D0N B;  2D9Y A;  2CY4 A;  5FI0 A;  2RLO A;  1N3H A;  1WGQ A;  2X18 A;  4GN1 A;  1H4R A;  2MKR A;  2L2I A;  2UZR A;  3PG7 A;  2MWN B;  2P0F A;  2DLW A;  2VKI A;  4A6F A;  2YS3 A;  5EFX A;  1WJ1 A;  2CRF A;  1FHO A;  4DBB A;  2LOZ A;  2J0M A;  2COD A;  2P0D A;  3IVF A;  3N7C A;  2DTC A;  3A8P A;  2K2J A;  4H8S A;  3QWM A;  3WA0 A;  1UPR A;  2MDX A;  3ULB A;  2OTX A;  1AWE A;  1ZSQ A;  4PNK A;  1ZC4 B;  1NU2 A;  1U5F A;  5HE0 A;  2COA A;  3SYX A;  1FGZ A;  1QQG A;  1XCG A;  5D3Y A;  1XD4 A;  3FEH A;  5HE3 A;  3HQC A;  3AU4 A;  1V61 A;  2YF0 A;  4GMV A;  2IFS A;  1P6S A;  1V88 A;  5CLL B;  2ZPY A;  1U27 A;  1U29 A;  2ROV A;  2Z0Q A;  2I5F A;  4GMX B;  5DHF B;  1BTN A;  4HB4 B;  2R09 A;  2DKP A;  2LKO A;  2H7E A;  1MAI A;  1WG7 A;  4CYE A;  3RCP A;  2NZ8 B;  3A98 B;  3V5W A;  2OQB A;  4HAZ B;  2GS0 A;  2W2X D;  1FGY A;  2LG1 A;  2D4Q A;  4A6F B;  4KHB B;  3D8E A;  5GOW B;  2EMS A;  4MK0 A;  3P6A A;  1XX0 A;  3DXE A;  2RGN B;  1QC6 A;  4NSW A;  2Z0O A;  1PMS A;  1ZC3 B;  2DYN A;  1J0W A;  3FSS A;  1OMW A;  1BAK A;  1U5G A;  1H10 A;  1DRO A;  1AQC A;  5D3V A;  2AL6 A;  1V5U A;  3TW1 A;  1X05 A;  2LUL A;  2E2X A;  4TYZ A;  5C16 A;  1U5E A;  4TKN A;  3SUZ A;  1B55 A;  2RSG A;  3QBV B;  3QIJ A;  4HAW B;  1EF1 A;  2D9W A;  4GPT B;  2COF A;  3D8D A;  2K00 A;  4HB2 B;  4A6K A;  5D3X A;  2YRY A;  2DN6 A;  4L6E A;  2DKQ A;  2GCJ A;  3F0W A;  2YT1 A;  2FJL A;  2N0Y A;  5C79 A;  3UZT A;  2COC A;  3NSU A;  4EMO A;  2I1K A;  5C6R A;  2D9X A;  1PFJ A;  4YL8 A;  1MK9 B;  3KZ1 A;  3GYO A;  4DX8 A;  4MY6 A;  1UPQ A;  1MIX A;  4NY0 A;  3AJ4 A;  5CLQ B;  3PEG A;  1KI1 B;  2D11 A;  2M14 A;  5DH9 B;  1LB1 A;  1ZVR A;  1IRS A;  2D2Q A;  2QKL A;  2KGX B;  1WVH A;  2Z0P A;  2HTH B;  5J3Y A;  2MFQ A;  1FHW A;  3PVW A;  2YSZ A;  2EC1 A;  1KZ7 A;  1WI1 A;  3SV1 A;  5JLJ B;  3CXB B;  1XKE A;  3PP2 A;  2J0K A;  3KSY A;  1KZG A;  2RVB B;  3P7Z A;  4KHO A;  4CHJ A;  3O96 A;  1NI2 A;  1W1H A;  2RNR B;  4WVF B;  4A6H A;  2L1C A;  3FM8 C;  1X86 A;  1FHX A;  4F7H A;  1I7A A;  1SHC A;  1UNP A;  2DHI A;  2P8V A;  1M7R A;  2EMT A;  3ZDT A;  2VSZ A;  2ELA A;  3TVV A;  2I5C A;  5J3Q A;  1ZM0 A;  1Y5O A;  2LYD A;  2KUP A;  3ODW A;  4GZU A;  2DYQ A;  1MIZ B;  2RUK B;  5KCV A;  1MKE A;  4Z2M B;  1P5T A;  3PVU A;  2IYB A;  2K2U A;  3F5R A;  1UEF A;  1X11 A;  2H7D A; 
#chains in the Genus database with same CATH topology
 3HK0 A;  1NTY A;  3ML4 A;  4HAY B;  1BTK A;  3MDB C;  1M7E A;  3TO1 A;  4HDO A;  4D6W A;  1GG3 A;  2HE7 A;  4DX9 0;  3OAN A;  3D8F A;  4HAU B;  3ZVR A;  3ULC A;  2R0D A;  2CY5 A;  2DA0 A;  4HDQ A;  1FB8 A;  4PQ0 A;  1MPH A;  1I2H A;  5L81 A;  5JHG A;  4DXA B;  4KHA A;  5D3W A;  4K17 A;  3SO6 A;  4K81 A;  3B77 A;  2DX5 A;  3DCX A;  3BJI A;  4L1R A;  3PZD A;  1RJ2 A;  2ADZ A;  1E5W A;  2NMB A;  2UVM A;  4Y94 A;  2DX1 A;  4K2P A;  5HE2 A;  2YT0 A;  3TCA A;  4HAX B;  5LG4 B;  1W1G A;  2KIG A;  3WYF B;  2KR0 A;  5I2M A;  1NTV A;  5KQ4 A;  2YS1 A;  3U7D A;  4P7I A;  1U2B A;  3DXD A;  1J19 A;  5C5B B;  5FI1 A;  4HAT B;  4HHV A;  3DXC A;  3T06 A;  1GC6 A;  3M1I B;  4Z2N A;  2G35 A;  2K49 A;  4IAP A;  2Y8G A;  1BWN A;  4OSN A;  4CSQ A;  1PLS A;  3A8Q A;  1LW3 A;  2PZ1 A;  4GOU A;  2W2W A;  1EAZ A;  1TQZ A;  4A5K A;  5HE1 A;  5C5B A;  2J59 M;  2N23 A;  1WJM A;  2DFK A;  3X23 A;  4EJN A;  3SNH A;  2UZS A;  2ROZ B;  4KVG B;  5DI9 B;  1UNR A;  2QKM A;  5LOP B;  3PSC A;  3ODO A;  1DDV A;  3VIA A;  1WGU A;  1Z87 A;  2ZKM X;  2GCL A;  3LJU X;  1EVH A;  2P0H A;  4YON A;  3GYP A;  4CHM A;  4ZRI A;  2FJU B;  3HW2 B;  1Q67 A;  4WJ7 A;  3KY9 A;  2JP2 A;  4HAV B;  3VOQ A;  3NWA A;  1X1G A;  4QXA B;  2NBV A;  1XOD A;  2V76 A;  5DIF B;  4IOY X;  1MI1 A;  2CAY A;  1FAO A;  1K5G B;  4HB3 B;  5KQ1 A;  4BBK A;  2Z14 A;  3TFM A;  2DHJ A;  2XQN M;  4MT7 A;  1EGX A;  4KAX B;  1V5M A;  2DHK A;  4C0A A;  3PVL A;  2Y7B A;  1DYN A;  2LOX A;  5JHH A;  2J0J A;  4WSF A;  1W1D A;  3KRW A;  2ELB A;  4XWX A;  1DBH A;  3NWF A;  1K5D B;  5J3T A;  1DDM A;  1XR0 B;  1U5D A;  3KRX A;  1GC7 A;  4B6H A;  2K8E A;  5JP4 A;  4KHB A;  4GXB A;  3AU5 A;  2D10 A;  1DDW A;  5D27 A;  3MPX A;  2EJ8 A;  2D9V A;  1OQN A;  1V5P A;  3BIN A;  3ODX A;  5LON B;  4IFS A;  2VRW B;  3CIK A;  1RRP B;  1FOE A;  1X1F A;  1Y19 B;  2GJY A;  2YS5 A;  1MK7 B;  4F7G A;  4F7U P;  4ZRJ A;  3OHM B;  1TJ6 A;  2D9Z A;  4EKU A;  1V89 A;  2BCJ A;  1ISN A;  2AEH A;  1TXD A;  2Q13 A;  4ZRK A;  2I1J A;  2Y8F A;  4K2O A;  2YVC A;  1SGH A;  3A58 A;  2KCJ A;  1P3R A;  5DHA B;  4QJ5 B;  1OY2 A;  1UNQ A;  3U8Z A;  4HB0 B;  2M38 A;  2W2X C;  3G9W A;  4D0N B;  2D9Y A;  3NWD A;  2CY4 A;  5FI0 A;  2RLO A;  1N3H A;  1WGQ A;  2KUQ A;  2X18 A;  5I2S A;  4GN1 A;  1H4R A;  2MKR A;  2L2I A;  2UZR A;  3PG7 A;  2MWN B;  2P0F A;  2DLW A;  2VKI A;  4HSI A;  4A6F A;  2YS3 A;  5EFX A;  1WJ1 A;  2CRF A;  1FHO A;  4DBB A;  2LOZ A;  2J0M A;  2COD A;  2P0D A;  3IVF A;  3N7C A;  2DTC A;  3A8P A;  2K2J A;  4H8S A;  3QWM A;  3WA0 A;  1UPR A;  2MDX A;  3ULB A;  2OTX A;  1AWE A;  1ZSQ A;  4PNK A;  1ZC4 B;  1NU2 A;  1U5F A;  5HE0 A;  2COA A;  3SYX A;  1FGZ A;  1QQG A;  1XCG A;  5D3Y A;  1XD4 A;  3FEH A;  5HE3 A;  3HQC A;  3AU4 A;  1V61 A;  2YF0 A;  4GMV A;  2IFS A;  1P6S A;  1V88 A;  5CLL B;  2ZPY A;  1U27 A;  4OT1 A;  1U29 A;  2ROV A;  2Z0Q A;  2I5F A;  4GMX B;  5DHF B;  1BTN A;  4HB4 B;  2R09 A;  2DKP A;  2LKO A;  2H7E A;  1MAI A;  1WG7 A;  4CYE A;  3RCP A;  2NZ8 B;  3A98 B;  3V5W A;  2OQB A;  4HAZ B;  2GS0 A;  2W2X D;  1FGY A;  2LG1 A;  2D4Q A;  4A6F B;  4KHB B;  3D8E A;  5GOW B;  4DIX A;  2EMS A;  4MK0 A;  3P6A A;  1XX0 A;  3DXE A;  5M4Y B;  2RGN B;  1QC6 A;  4NSW A;  2Z0O A;  1PMS A;  1ZC3 B;  2DYN A;  2Z59 A;  1J0W A;  3FSS A;  1OMW A;  1BAK A;  1T77 A;  1U5G A;  1H10 A;  2Z4D A;  1DRO A;  1AQC A;  5D3V A;  3U12 A;  2AL6 A;  1V5U A;  3TW1 A;  1X05 A;  2LUL A;  2E2X A;  4TYZ A;  5C16 A;  1U5E A;  4TKN A;  3SUZ A;  1B55 A;  2RSG A;  3QBV B;  3QIJ A;  4HAW B;  1EF1 A;  2D9W A;  4GPT B;  2COF A;  3D8D A;  2K00 A;  4HB2 B;  2YT2 A;  4A6K A;  5D3X A;  2YRY A;  2DN6 A;  4L6E A;  2DKQ A;  2GCJ A;  3HSA A;  3F0W A;  2YT1 A;  3FVC A;  2FJL A;  2N0Y A;  2GUM A;  5C79 A;  3UZT A;  2COC A;  3NSU A;  4EMO A;  2I1K A;  5C6R A;  2D9X A;  1PFJ A;  4YL8 A;  1MK9 B;  3KZ1 A;  3GYO A;  4DX8 A;  4MY6 A;  1UPQ A;  1MIX A;  4NY0 A;  3AJ4 A;  5IRS A;  5CLQ B;  3PEG A;  1KI1 B;  2D11 A;  2M14 A;  5DH9 B;  1LB1 A;  1ZVR A;  1IRS A;  2D2Q A;  2QKL A;  2KGX B;  1WVH A;  2Z0P A;  2HTH B;  4QJ3 B;  5J3Y A;  2MFQ A;  1FHW A;  3PVW A;  2YSZ A;  2KIE A;  2EC1 A;  1KZ7 A;  1WI1 A;  3SV1 A;  5JLJ B;  2R2Y A;  3CXB B;  1XKE A;  3PP2 A;  2J0K A;  3KSY A;  1KZG A;  2RVB B;  3P7Z A;  4KHO A;  4CHJ A;  3O96 A;  1NI2 A;  1W1H A;  2RNR B;  4WVF B;  4A6H A;  2L1C A;  3FM8 C;  1X86 A;  1FHX A;  4QJ4 B;  4F7H A;  1I7A A;  1SHC A;  1UNP A;  2DHI A;  2P8V A;  1M7R A;  4GNK B;  2EMT A;  3HIE A;  3ZDT A;  2Z13 A;  2VSZ A;  2ELA A;  3TVV A;  2RRF A;  2I5C A;  5J3Q A;  1ZM0 A;  1Y5O A;  2LYD A;  2KUP A;  3ODW A;  4GZU A;  2DYQ A;  1MIZ B;  2RUK B;  5KCV A;  1MKE A;  1ZYI A;  4Z2M B;  1P5T A;  3PVU A;  2IYB A;  2K2U A;  3F5R A;  1UEF A;  1X11 A;  3NW8 A;  2H7D A; 
#chains in the Genus database with same CATH homology
 3HK0 A;  1NTY A;  3ML4 A;  4HAY B;  1BTK A;  3MDB C;  1M7E A;  3TO1 A;  4HDO A;  1GG3 A;  2HE7 A;  4DX9 0;  3OAN A;  3D8F A;  4HAU B;  3ZVR A;  3ULC A;  2R0D A;  2CY5 A;  2DA0 A;  4HDQ A;  1FB8 A;  4PQ0 A;  1MPH A;  1I2H A;  5L81 A;  5JHG A;  4DXA B;  4KHA A;  5D3W A;  4K17 A;  3SO6 A;  4K81 A;  2DX5 A;  3BJI A;  3PZD A;  1RJ2 A;  2ADZ A;  1E5W A;  2NMB A;  2UVM A;  4Y94 A;  2DX1 A;  4K2P A;  5HE2 A;  2YT0 A;  3TCA A;  4HAX B;  1W1G A;  3WYF B;  1NTV A;  5KQ4 A;  2YS1 A;  3U7D A;  4P7I A;  1U2B A;  3DXD A;  1J19 A;  5C5B B;  5FI1 A;  4HAT B;  4HHV A;  3DXC A;  3T06 A;  1GC6 A;  3M1I B;  4Z2N A;  2G35 A;  4IAP A;  2Y8G A;  1BWN A;  1PLS A;  3A8Q A;  1LW3 A;  2PZ1 A;  2W2W A;  1EAZ A;  1TQZ A;  4A5K A;  5HE1 A;  5C5B A;  2J59 M;  2N23 A;  1WJM A;  2DFK A;  3X23 A;  4EJN A;  3SNH A;  2UZS A;  2ROZ B;  4KVG B;  5DI9 B;  1UNR A;  2QKM A;  5LOP B;  3PSC A;  3ODO A;  1DDV A;  3VIA A;  1WGU A;  1Z87 A;  2GCL A;  3LJU X;  1EVH A;  2P0H A;  4YON A;  3GYP A;  4CHM A;  4ZRI A;  3HW2 B;  1Q67 A;  4WJ7 A;  3KY9 A;  2JP2 A;  4HAV B;  3VOQ A;  1X1G A;  1XOD A;  2V76 A;  5DIF B;  4IOY X;  2CAY A;  1FAO A;  1K5G B;  4HB3 B;  5KQ1 A;  4BBK A;  3TFM A;  2DHJ A;  2XQN M;  4MT7 A;  1EGX A;  4KAX B;  1V5M A;  2DHK A;  4C0A A;  3PVL A;  2Y7B A;  1DYN A;  2LOX A;  5JHH A;  2J0J A;  4WSF A;  1W1D A;  3KRW A;  2ELB A;  4XWX A;  1DBH A;  1DDM A;  1K5D B;  5J3T A;  1XR0 B;  1U5D A;  3KRX A;  1GC7 A;  4B6H A;  5JP4 A;  4GXB A;  3AU5 A;  2D10 A;  1DDW A;  5D27 A;  3MPX A;  2EJ8 A;  2D9V A;  1OQN A;  1V5P A;  3BIN A;  3ODX A;  5LON B;  4IFS A;  2VRW B;  3CIK A;  1RRP B;  1FOE A;  1X1F A;  1Y19 B;  2GJY A;  2YS5 A;  1MK7 B;  4F7G A;  4F7U P;  4ZRJ A;  1TJ6 A;  2D9Z A;  4EKU A;  1V89 A;  2BCJ A;  1ISN A;  2AEH A;  1TXD A;  2Q13 A;  4ZRK A;  2I1J A;  2Y8F A;  4K2O A;  2YVC A;  1SGH A;  2KCJ A;  1P3R A;  5DHA B;  1OY2 A;  1UNQ A;  3U8Z A;  4HB0 B;  2M38 A;  2W2X C;  3G9W A;  4D0N B;  2D9Y A;  2CY4 A;  5FI0 A;  2RLO A;  1N3H A;  1WGQ A;  2X18 A;  4GN1 A;  1H4R A;  2MKR A;  2L2I A;  2UZR A;  3PG7 A;  2MWN B;  2P0F A;  2DLW A;  2VKI A;  4A6F A;  2YS3 A;  5EFX A;  1WJ1 A;  2CRF A;  1FHO A;  4DBB A;  2LOZ A;  2J0M A;  2COD A;  2P0D A;  3IVF A;  3N7C A;  2DTC A;  3A8P A;  2K2J A;  4H8S A;  3QWM A;  3WA0 A;  1UPR A;  2MDX A;  3ULB A;  2OTX A;  1AWE A;  1ZSQ A;  4PNK A;  1ZC4 B;  1NU2 A;  1U5F A;  5HE0 A;  2COA A;  3SYX A;  1FGZ A;  1QQG A;  1XCG A;  5D3Y A;  1XD4 A;  3FEH A;  5HE3 A;  3HQC A;  3AU4 A;  1V61 A;  2YF0 A;  4GMV A;  2IFS A;  1P6S A;  1V88 A;  5CLL B;  2ZPY A;  1U27 A;  1U29 A;  2ROV A;  2Z0Q A;  2I5F A;  4GMX B;  5DHF B;  1BTN A;  4HB4 B;  2R09 A;  2DKP A;  2LKO A;  2H7E A;  1MAI A;  1WG7 A;  4CYE A;  3RCP A;  2NZ8 B;  3A98 B;  3V5W A;  2OQB A;  4HAZ B;  2GS0 A;  2W2X D;  1FGY A;  2LG1 A;  2D4Q A;  4A6F B;  4KHB B;  3D8E A;  5GOW B;  2EMS A;  4MK0 A;  3P6A A;  1XX0 A;  3DXE A;  2RGN B;  1QC6 A;  4NSW A;  2Z0O A;  1PMS A;  1ZC3 B;  2DYN A;  1J0W A;  3FSS A;  1OMW A;  1BAK A;  1U5G A;  1H10 A;  1DRO A;  1AQC A;  5D3V A;  2AL6 A;  1V5U A;  3TW1 A;  1X05 A;  2LUL A;  2E2X A;  4TYZ A;  5C16 A;  1U5E A;  4TKN A;  3SUZ A;  1B55 A;  2RSG A;  3QBV B;  3QIJ A;  4HAW B;  1EF1 A;  2D9W A;  4GPT B;  2COF A;  3D8D A;  2K00 A;  4HB2 B;  4A6K A;  5D3X A;  2YRY A;  2DN6 A;  4L6E A;  2DKQ A;  2GCJ A;  3F0W A;  2YT1 A;  2FJL A;  2N0Y A;  5C79 A;  3UZT A;  2COC A;  3NSU A;  4EMO A;  2I1K A;  5C6R A;  2D9X A;  1PFJ A;  4YL8 A;  1MK9 B;  3KZ1 A;  3GYO A;  4DX8 A;  4MY6 A;  1UPQ A;  1MIX A;  4NY0 A;  3AJ4 A;  5CLQ B;  3PEG A;  1KI1 B;  2D11 A;  2M14 A;  5DH9 B;  1LB1 A;  1ZVR A;  1IRS A;  2D2Q A;  2QKL A;  2KGX B;  1WVH A;  2Z0P A;  2HTH B;  5J3Y A;  2MFQ A;  1FHW A;  3PVW A;  2YSZ A;  2EC1 A;  1KZ7 A;  1WI1 A;  3SV1 A;  5JLJ B;  3CXB B;  1XKE A;  3PP2 A;  2J0K A;  3KSY A;  1KZG A;  2RVB B;  3P7Z A;  4KHO A;  4CHJ A;  3O96 A;  1NI2 A;  1W1H A;  2RNR B;  4WVF B;  4A6H A;  2L1C A;  3FM8 C;  1X86 A;  1FHX A;  4F7H A;  1I7A A;  1SHC A;  1UNP A;  2DHI A;  2P8V A;  1M7R A;  2EMT A;  3ZDT A;  2VSZ A;  2ELA A;  3TVV A;  2I5C A;  5J3Q A;  1ZM0 A;  1Y5O A;  2LYD A;  2KUP A;  3ODW A;  4GZU A;  2DYQ A;  1MIZ B;  2RUK B;  5KCV A;  1MKE A;  4Z2M B;  1P5T A;  3PVU A;  2IYB A;  2K2U A;  3F5R A;  1UEF A;  1X11 A;  2H7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...