2D9ZA

Solution structure of the ph domain of protein kinase c, nu type from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
129
structure length
129
Chain Sequence
b'GSSGSSGMVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQGSNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, nu type
publication title Solution structure of the PH domain of Protein kinase C, nu type from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 129
sequence length 129
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9zA01
2I5CA 3ODXA 1KI1B 3TCAA 2LOXA 3QWMA 1NI2A 5J3TA 2OTXA 2FJLA 1PMSA 2MKRA 1WI1A 5JHGA 5DI9B 2UZSA 2D9VA 3HK0A 1UNRA 2CY4A 3QBVB 3FSSA 5D3YA 5J3QA 2DTCA 2IYBA 4PQ0A 2GCJA 1PLSA 2N0YA 3PVWA 2DKPA 2HE7A 3A98B 4HDQA 4GMVA 1TJ6A 3PVLA 1RRPB 5DIFB 2UVMA 1Y19B 5DHAB 4ZRIA 2NZ8B 2Y8GA 3M1IB 3V5WA 4K17A 1V88A 4MK0A 3QIJA 1MK9B 1AWEA 4ZRJA 2LG1A 4YL8A 3NSUA 2GCLA 2L2IA 3PSCA 3A8QA 5HE1A 3BINA 1EAZA 1MIXA 1P3RA 2QKMA 3HW2B 1UPRA 1U5GA 4P7IA 1WGUA 1N3HA 1TQZA 2DYQA 5DH9B 4A6FB 2D9ZA 2NMBA 1WVHA 4GPTB 4IOYX 2YS5A 2MWNB 2RGNB 2E2XA 3PP2A 2V76A 4HATB 2W2WA 2YSZA 3PZDA 5HE0A 3MPXA 2AEHA 1P6SA 1GC6A 2COAA 1WJMA 4HAYB 1Y5OA 4KVGB 2YT0A 1DDMA 2ROVA 2JP2A 4WJ7A 1NTYA 2RUKB 1AQCA 2YT1A 1MIZB 1DROA 4DBBA 5HE2A 5GOWB 2EMSA 2D4QA 3GYOA 2VSZA 2YS3A 3CIKA 2LOZA 1X05A 1KZGA 1BTNA 3TVVA 1ZVRA 4HB4B 4ZRKA 5JP4A 1FHWA 1BWNA 2K00A 3ML4A 4MY6A 3VOQA 2KGXB 3F0WA 2P0HA 4D0NB 1U29A 2COFA 5FI1A 4TYZA 1X11A 3HQCA 4K81A 2D9WA 3WYFB 1MK7B 2MDXA 1XR0B 3U8ZA 1LW3A 4PNKA 1X86A 3PVUA 1MAIA 4EJNA 1FHXA 2RLOA 1W1HA 4F7HA 5C6RA 2LYDA 4Z2NA 3N7CA 2CY5A 2YF0A 4C0AA 3DXEA 2N23A 1IRSA 2H7DA 1WG7A 1X1GA 3ULBA 1ZM0A 5J3YA 1GC7A 4XWXA 3TFMA 1DBHA 2YRYA 3SO6A 5C5BA 2KCJA 2J59M 5KQ1A 1GG3A 1OY2A 4IAPA 2KUPA 2Z0QA 5D3XA 1QC6A 1UEFA 2ELBA 2D9YA 1DDVA 2UZRA 5L81A 2Y8FA 3KRXA 4Z2MB 4HDOA 1SHCA 1UNPA 1BTKA 4MT7A 3U7DA 1XCGA 1DYNA 3F5RA 2Q13A 2X18A 1U27A 2VKIA 3P7ZA 1J19A 2Z0OA 5FI0A 5KQ4A 2DYNA 1ZC4B 2DHKA 1U5EA 1FOEA 3ZVRA 2P8VA 3PG7A 1WGQA 1PFJA 4KHBB 1FGYA 1XX0A 3UZTA 4WSFA 3G9WA 1V61A 4KHOA 4NY0A 1B55A 2ROZB 4GN1A 1W1DA 4GXBA 2D9XA 4A5KA 5HE3A 2D2QA 5EFXA 1TXDA 3SNHA 4HAUB 4KHAA 2GS0A 1P5TA 4K2PA 2RSGA 2EC1A 1V5MA 2K2JA 2CODA 5CLQB 1OQNA 4NSWA 1V5PA 5DHFB 2ZPYA 3CXBB 4HAXB 2RVBB 3TO1A 2D11A 1K5DB 2R09A 2J0MA 4KAXB 3IVFA 2GJYA 2CAYA 2DX1A 3A8PA 3TW1A 4CHMA 4HAWB 1EVHA 4BBKA 2Z0PA 3OANA 3PEGA 2AL6A 3BJIA 2L1CA 4YONA 3D8FA 3LJUX 1UPQA 3DXDA 2YS1A 2P0FA 2XQNM 4Y94A 2LULA 5JHHA 1FAOA 5LOPB 1MPHA 1WJ1A 1SGHA 1I2HA 3WA0A 4A6KA 4HAZB 3KSYA 4A6FA 3D8DA 2W2XD 2D10A 4DX90 4F7UP 3RCPA 2DLWA 4TKNA 1NU2A 1QQGA 2CRFA 5LONB 2YVCA 3KZ1A 1E5WA 4B6HA 4DXAB 3X23A 1ZC3B 3DXCA 2EMTA 4HAVB 3SV1A 5D27A 4GMXB 3AU5A 3FEHA 1KZ7A 1V5UA 2DFKA 2VRWB 4A6HA 5CLLB 5D3VA 2J0KA 5D3WA 2LKOA 2COCA 1XKEA 1M7RA 2DN6A 1U5DA 5KCVA 2R0DA 4IFSA 4HHVA 1V89A 2BCJA 2DKQA 2ELAA 3T06A 4H8SA 1EF1A 1H10A 1BAKA 1ZSQA 2M14A 1EGXA 3ULCA 1ISNA 1UNQA 2HTHB 1OMWA 2DA0A 1DDWA 2J0JA 4GZUA 3MDBC 4EKUA 4HB3B 2IFSA 2P0DA 2K2UA 3P6AA 4K2OA 1K5GB 3D8EA 3VIAA 5C16A 1U2BA 2OQBA 3ZDTA 5JLJB 1X1FA 4F7GA 2ADZA 3ODOA 1XODA 4CYEA 1I7AA 1RJ2A 2DHJA 4DX8A 3AJ4A 1XD4A 2G35A 2Y7BA 3AU4A 5C5BB 3KY9A 3GYPA 2W2XC 4WVFB 2QKLA 1Q67A 3O96A 2DHIA 4HB2B 1M7EA 1U5FA 1H4RA 3KRWA 1LB1A 1FB8A 3SYXA 1Z87A 2EJ8A 2MFQA 2I1JA 4CHJA 1FHOA 4L6EA 4HB0B 1NTVA 3FM8C 3ODWA 2I1KA 2I5FA 4EMOA 2H7EA 2RNRB 1J0WA 1MKEA 3SUZA 5C79A 2DX5A 2M38A 2PZ1A 1FGZA 1W1GA
chains in the Genus database with same CATH superfamily
2I5CA 3ODXA 1KI1B 3TCAA 2LOXA 3QWMA 1NI2A 5J3TA 2OTXA 2FJLA 1PMSA 2MKRA 1WI1A 5JHGA 5DI9B 2UZSA 2D9VA 3HK0A 1UNRA 2CY4A 3QBVB 3FSSA 5D3YA 4CSQA 5J3QA 2DTCA 2IYBA 4PQ0A 2GCJA 1PLSA 2N0YA 3PVWA 2DKPA 2HE7A 3A98B 4HDQA 4GMVA 1TJ6A 3PVLA 1RRPB 5DIFB 2UVMA 1Y19B 5DHAB 4ZRIA 3NW8A 2NZ8B 3OHMB 2Y8GA 3M1IB 3V5WA 4K17A 1V88A 3NWFA 4OSNA 4MK0A 3QIJA 5IRSA 1MK9B 2NBVA 1AWEA 4ZRJA 2LG1A 4QJ5B 4YL8A 3NSUA 2GCLA 2L2IA 3PSCA 3A8QA 5HE1A 3BINA 1EAZA 1MIXA 1P3RA 3NWDA 2QKMA 3HW2B 1UPRA 1U5GA 4P7IA 1WGUA 1N3HA 1TQZA 2DYQA 4OT1A 5DH9B 4A6FB 2D9ZA 2NMBA 2K8EA 1WVHA 4GPTB 4IOYX 2YS5A 2MWNB 2RGNB 2E2XA 3PP2A 2R2YA 2V76A 4HATB 2W2WA 2YSZA 3PZDA 5HE0A 3MPXA 2AEHA 1P6SA 1GC6A 2GUMA 2COAA 1WJMA 4HAYB 1Y5OA 4KVGB 2YT0A 3HIEA 1DDMA 2ROVA 2JP2A 4WJ7A 1NTYA 2RUKB 1AQCA 2YT1A 1MIZB 1DROA 4DBBA 5HE2A 5GOWB 2EMSA 2D4QA 3GYOA 2VSZA 2YS3A 3CIKA 2LOZA 1X05A 1KZGA 2KR0A 1BTNA 3TVVA 1ZVRA 4HB4B 4ZRKA 5JP4A 1FHWA 1BWNA 2K00A 3ML4A 4MY6A 3VOQA 2KGXB 3F0WA 2P0HA 4D0NB 1U29A 2COFA 5FI1A 4TYZA 1X11A 3HQCA 4K81A 2D9WA 3WYFB 1MK7B 2MDXA 1XR0B 4GNKB 1LW3A 3U8ZA 4PNKA 1X86A 3PVUA 1MAIA 4EJNA 1FHXA 2RLOA 1W1HA 4F7HA 5C6RA 2LYDA 4Z2NA 3N7CA 2CY5A 2YF0A 4C0AA 3DXEA 2N23A 1IRSA 2H7DA 1WG7A 1X1GA 3ULBA 1ZM0A 5J3YA 1GC7A 4XWXA 3TFMA 1DBHA 2YRYA 3SO6A 5C5BA 2KCJA 2J59M 5KQ1A 1GG3A 1OY2A 4IAPA 2KUPA 2Z0QA 5D3XA 1QC6A 1UEFA 2ELBA 2D9YA 1DDVA 2UZRA 5L81A 2Y8FA 3KRXA 4Z2MB 4HDOA 1SHCA 1UNPA 1BTKA 4MT7A 3U7DA 3A58A 1XCGA 1DYNA 2KIEA 3F5RA 2Q13A 2X18A 1U27A 2VKIA 3P7ZA 1J19A 2Z0OA 5FI0A 5KQ4A 1MI1A 2DYNA 1ZC4B 2DHKA 1U5EA 1FOEA 3ZVRA 2P8VA 3PG7A 1WGQA 1PFJA 4KHBB 1FGYA 1XX0A 3UZTA 4WSFA 3G9WA 1V61A 4KHOA 4NY0A 1B55A 2ROZB 4GN1A 1W1DA 4GXBA 2D9XA 4A5KA 5HE3A 4HSIA 5M4YB 2D2QA 5EFXA 1TXDA 3SNHA 4HAUB 5I2SA 4KHAA 2GS0A 1P5TA 4K2PA 2RSGA 3DCXA 2EC1A 1V5MA 2K2JA 2CODA 4D6WA 5CLQB 1OQNA 4NSWA 3FVCA 1V5PA 5DHFB 2ZPYA 3CXBB 4HAXB 2RVBB 3TO1A 2Z59A 2D11A 1K5DB 2R09A 2J0MA 4KAXB 3IVFA 2GJYA 2CAYA 2DX1A 3A8PA 3TW1A 4CHMA 2ZKMX 4HAWB 1EVHA 4BBKA 2Z0PA 3OANA 3PEGA 3NWAA 2AL6A 3BJIA 2L1CA 2YT2A 4YONA 3D8FA 3LJUX 1UPQA 3DXDA 2YS1A 2P0FA 2XQNM 4Y94A 2LULA 5JHHA 1FAOA 5I2MA 5LOPB 1MPHA 1WJ1A 1SGHA 1I2HA 3WA0A 4A6KA 1ZYIA 4HAZB 3KSYA 4A6FA 3D8DA 2W2XD 2D10A 4DX90 4F7UP 3RCPA 2DLWA 4TKNA 1NU2A 1QQGA 2CRFA 2Z14A 4L1RA 5LONB 2YVCA 3KZ1A 1E5WA 4B6HA 4DXAB 3X23A 1ZC3B 3DXCA 2EMTA 4HAVB 3SV1A 5D27A 4GMXB 3AU5A 4QJ4B 3FEHA 1KZ7A 1V5UA 2DFKA 2VRWB 4A6HA 5CLLB 5D3VA 2KIGA 2Z4DA 2J0KA 5D3WA 2RRFA 2LKOA 2COCA 1XKEA 1M7RA 3U12A 2DN6A 1U5DA 5KCVA 2R0DA 4IFSA 4HHVA 1V89A 2BCJA 2DKQA 2ELAA 3T06A 4H8SA 1EF1A 1H10A 1BAKA 1ZSQA 2M14A 1EGXA 3ULCA 1ISNA 1UNQA 2HTHB 4DIXA 1OMWA 2DA0A 1DDWA 2J0JA 4GZUA 3MDBC 4EKUA 1T77A 4HB3B 2FJUB 2IFSA 2P0DA 2K2UA 3P6AA 4K2OA 1K5GB 3D8EA 3VIAA 5C16A 1U2BA 2OQBA 4QJ3B 3ZDTA 5JLJB 1X1FA 4F7GA 4QXAB 2ADZA 3ODOA 1XODA 4CYEA 1I7AA 1RJ2A 2DHJA 4DX8A 3AJ4A 1XD4A 2G35A 2Y7BA 3AU4A 5C5BB 3KY9A 3GYPA 2W2XC 4GOUA 4WVFB 2QKLA 1Q67A 3O96A 3HSAA 2DHIA 4HB2B 1M7EA 1U5FA 1H4RA 3KRWA 1LB1A 1FB8A 3SYXA 1Z87A 2EJ8A 2MFQA 2I1JA 2K49A 4CHJA 1FHOA 4L6EA 4HB0B 2Z13A 1NTVA 3FM8C 3ODWA 2I1KA 2I5FA 4EMOA 2H7EA 3B77A 2KUQA 2RNRB 1J0WA 1MKEA 3SUZA 4KHBA 5C79A 2DX5A 2M38A 2PZ1A 1FGZA 5LG4B 1W1GA
chains in the Genus database with same CATH topology
2I5CA 3ODXA 1KI1B 3TCAA 2LOXA 3QWMA 1NI2A 5J3TA 2OTXA 2FJLA 1PMSA 2MKRA 1WI1A 5JHGA 5DI9B 2UZSA 2D9VA 3HK0A 1UNRA 2CY4A 3QBVB 3FSSA 5D3YA 5J3QA 2DTCA 2IYBA 4PQ0A 2GCJA 1PLSA 2N0YA 3PVWA 2DKPA 2HE7A 3A98B 4HDQA 4GMVA 1TJ6A 3PVLA 1RRPB 5DIFB 2UVMA 1Y19B 5DHAB 4ZRIA 2NZ8B 2Y8GA 3M1IB 3V5WA 4K17A 1V88A 4MK0A 3QIJA 1MK9B 1AWEA 4ZRJA 2LG1A 4YL8A 3NSUA 2GCLA 2L2IA 3PSCA 3A8QA 5HE1A 3BINA 1EAZA 1MIXA 1P3RA 2QKMA 3HW2B 1UPRA 1U5GA 4P7IA 1WGUA 1N3HA 1TQZA 2DYQA 5DH9B 4A6FB 2D9ZA 2NMBA 1WVHA 4GPTB 4IOYX 2YS5A 2MWNB 2RGNB 2E2XA 3PP2A 2V76A 4HATB 2W2WA 2YSZA 3PZDA 5HE0A 3MPXA 2AEHA 1P6SA 1GC6A 2COAA 1WJMA 4HAYB 1Y5OA 4KVGB 2YT0A 1DDMA 2ROVA 2JP2A 4WJ7A 1NTYA 2RUKB 1AQCA 2YT1A 1MIZB 1DROA 4DBBA 5HE2A 5GOWB 2EMSA 2D4QA 3GYOA 2VSZA 2YS3A 3CIKA 2LOZA 1X05A 1KZGA 1BTNA 3TVVA 1ZVRA 4HB4B 4ZRKA 5JP4A 1FHWA 1BWNA 2K00A 3ML4A 4MY6A 3VOQA 2KGXB 3F0WA 2P0HA 4D0NB 1U29A 2COFA 5FI1A 4TYZA 1X11A 3HQCA 4K81A 2D9WA 3WYFB 1MK7B 2MDXA 1XR0B 3U8ZA 1LW3A 4PNKA 1X86A 3PVUA 1MAIA 4EJNA 1FHXA 2RLOA 1W1HA 4F7HA 5C6RA 2LYDA 4Z2NA 3N7CA 2CY5A 2YF0A 4C0AA 3DXEA 2N23A 1IRSA 2H7DA 1WG7A 1X1GA 3ULBA 1ZM0A 5J3YA 1GC7A 4XWXA 3TFMA 1DBHA 2YRYA 3SO6A 5C5BA 2KCJA 2J59M 5KQ1A 1GG3A 1OY2A 4IAPA 2KUPA 2Z0QA 5D3XA 1QC6A 1UEFA 2ELBA 2D9YA 1DDVA 2UZRA 5L81A 2Y8FA 3KRXA 4Z2MB 4HDOA 1SHCA 1UNPA 1BTKA 4MT7A 3U7DA 1XCGA 1DYNA 3F5RA 2Q13A 2X18A 1U27A 2VKIA 3P7ZA 1J19A 2Z0OA 5FI0A 5KQ4A 2DYNA 1ZC4B 2DHKA 1U5EA 1FOEA 3ZVRA 2P8VA 3PG7A 1WGQA 1PFJA 4KHBB 1FGYA 1XX0A 3UZTA 4WSFA 3G9WA 1V61A 4KHOA 4NY0A 1B55A 2ROZB 4GN1A 1W1DA 4GXBA 2D9XA 4A5KA 5HE3A 2D2QA 5EFXA 1TXDA 3SNHA 4HAUB 4KHAA 2GS0A 1P5TA 4K2PA 2RSGA 2EC1A 1V5MA 2K2JA 2CODA 5CLQB 1OQNA 4NSWA 1V5PA 5DHFB 2ZPYA 3CXBB 4HAXB 2RVBB 3TO1A 2D11A 1K5DB 2R09A 2J0MA 4KAXB 3IVFA 2GJYA 2CAYA 2DX1A 3A8PA 3TW1A 4CHMA 4HAWB 1EVHA 4BBKA 2Z0PA 3OANA 3PEGA 2AL6A 3BJIA 2L1CA 4YONA 3D8FA 3LJUX 1UPQA 3DXDA 2YS1A 2P0FA 2XQNM 4Y94A 2LULA 5JHHA 1FAOA 5LOPB 1MPHA 1WJ1A 1SGHA 1I2HA 3WA0A 4A6KA 4HAZB 3KSYA 4A6FA 3D8DA 2W2XD 2D10A 4DX90 4F7UP 3RCPA 2DLWA 4TKNA 1NU2A 1QQGA 2CRFA 5LONB 2YVCA 3KZ1A 1E5WA 4B6HA 4DXAB 3X23A 1ZC3B 3DXCA 2EMTA 4HAVB 3SV1A 5D27A 4GMXB 3AU5A 3FEHA 1KZ7A 1V5UA 2DFKA 2VRWB 4A6HA 5CLLB 5D3VA 2J0KA 5D3WA 2LKOA 2COCA 1XKEA 1M7RA 2DN6A 1U5DA 5KCVA 2R0DA 4IFSA 4HHVA 1V89A 2BCJA 2DKQA 2ELAA 3T06A 4H8SA 1EF1A 1H10A 1BAKA 1ZSQA 2M14A 1EGXA 3ULCA 1ISNA 1UNQA 2HTHB 1OMWA 2DA0A 1DDWA 2J0JA 4GZUA 3MDBC 4EKUA 4HB3B 2IFSA 2P0DA 2K2UA 3P6AA 4K2OA 1K5GB 3D8EA 3VIAA 5C16A 1U2BA 2OQBA 3ZDTA 5JLJB 1X1FA 4F7GA 2ADZA 3ODOA 1XODA 4CYEA 1I7AA 1RJ2A 2DHJA 4DX8A 3AJ4A 1XD4A 2G35A 2Y7BA 3AU4A 5C5BB 3KY9A 3GYPA 2W2XC 4WVFB 2QKLA 1Q67A 3O96A 2DHIA 4HB2B 1M7EA 1U5FA 1H4RA 3KRWA 1LB1A 1FB8A 3SYXA 1Z87A 2EJ8A 2MFQA 2I1JA 4CHJA 1FHOA 4L6EA 4HB0B 1NTVA 3FM8C 3ODWA 2I1KA 2I5FA 4EMOA 2H7EA 2RNRB 1J0WA 1MKEA 3SUZA 5C79A 2DX5A 2M38A 2PZ1A 1FGZA 1W1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5C A;  3ODX A;  1KI1 B;  3TCA A;  2LOX A;  3QWM A;  1NI2 A;  5J3T A;  2OTX A;  2FJL A;  1PMS A;  2MKR A;  1WI1 A;  5JHG A;  5DI9 B;  2UZS A;  2D9V A;  3HK0 A;  1UNR A;  2CY4 A;  3QBV B;  3FSS A;  5D3Y A;  5J3Q A;  2DTC A;  2IYB A;  4PQ0 A;  2GCJ A;  1PLS A;  2N0Y A;  3PVW A;  2DKP A;  2HE7 A;  3A98 B;  4HDQ A;  4GMV A;  1TJ6 A;  3PVL A;  1RRP B;  5DIF B;  2UVM A;  1Y19 B;  5DHA B;  4ZRI A;  2NZ8 B;  2Y8G A;  3M1I B;  3V5W A;  4K17 A;  1V88 A;  4MK0 A;  3QIJ A;  1MK9 B;  1AWE A;  4ZRJ A;  2LG1 A;  4YL8 A;  3NSU A;  2GCL A;  2L2I A;  3PSC A;  3A8Q A;  5HE1 A;  3BIN A;  1EAZ A;  1MIX A;  1P3R A;  2QKM A;  3HW2 B;  1UPR A;  1U5G A;  4P7I A;  1WGU A;  1N3H A;  1TQZ A;  2DYQ A;  5DH9 B;  4A6F B;  2D9Z A;  2NMB A;  1WVH A;  4GPT B;  4IOY X;  2YS5 A;  2MWN B;  2RGN B;  2E2X A;  3PP2 A;  2V76 A;  4HAT B;  2W2W A;  2YSZ A;  3PZD A;  5HE0 A;  3MPX A;  2AEH A;  1P6S A;  1GC6 A;  2COA A;  1WJM A;  4HAY B;  1Y5O A;  4KVG B;  2YT0 A;  1DDM A;  2ROV A;  2JP2 A;  4WJ7 A;  1NTY A;  2RUK B;  1AQC A;  2YT1 A;  1MIZ B;  1DRO A;  4DBB A;  5HE2 A;  5GOW B;  2EMS A;  2D4Q A;  3GYO A;  2VSZ A;  2YS3 A;  3CIK A;  2LOZ A;  1X05 A;  1KZG A;  1BTN A;  3TVV A;  1ZVR A;  4HB4 B;  4ZRK A;  5JP4 A;  1FHW A;  1BWN A;  2K00 A;  3ML4 A;  4MY6 A;  3VOQ A;  2KGX B;  3F0W A;  2P0H A;  4D0N B;  1U29 A;  2COF A;  5FI1 A;  4TYZ A;  1X11 A;  3HQC A;  4K81 A;  2D9W A;  3WYF B;  1MK7 B;  2MDX A;  1XR0 B;  3U8Z A;  1LW3 A;  4PNK A;  1X86 A;  3PVU A;  1MAI A;  4EJN A;  1FHX A;  2RLO A;  1W1H A;  4F7H A;  5C6R A;  2LYD A;  4Z2N A;  3N7C A;  2CY5 A;  2YF0 A;  4C0A A;  3DXE A;  2N23 A;  1IRS A;  2H7D A;  1WG7 A;  1X1G A;  3ULB A;  1ZM0 A;  5J3Y A;  1GC7 A;  4XWX A;  3TFM A;  1DBH A;  2YRY A;  3SO6 A;  5C5B A;  2KCJ A;  2J59 M;  5KQ1 A;  1GG3 A;  1OY2 A;  4IAP A;  2KUP A;  2Z0Q A;  5D3X A;  1QC6 A;  1UEF A;  2ELB A;  2D9Y A;  1DDV A;  2UZR A;  5L81 A;  2Y8F A;  3KRX A;  4Z2M B;  4HDO A;  1SHC A;  1UNP A;  1BTK A;  4MT7 A;  3U7D A;  1XCG A;  1DYN A;  3F5R A;  2Q13 A;  2X18 A;  1U27 A;  2VKI A;  3P7Z A;  1J19 A;  2Z0O A;  5FI0 A;  5KQ4 A;  2DYN A;  1ZC4 B;  2DHK A;  1U5E A;  1FOE A;  3ZVR A;  2P8V A;  3PG7 A;  1WGQ A;  1PFJ A;  4KHB B;  1FGY A;  1XX0 A;  3UZT A;  4WSF A;  3G9W A;  1V61 A;  4KHO A;  4NY0 A;  1B55 A;  2ROZ B;  4GN1 A;  1W1D A;  4GXB A;  2D9X A;  4A5K A;  5HE3 A;  2D2Q A;  5EFX A;  1TXD A;  3SNH A;  4HAU B;  4KHA A;  2GS0 A;  1P5T A;  4K2P A;  2RSG A;  2EC1 A;  1V5M A;  2K2J A;  2COD A;  5CLQ B;  1OQN A;  4NSW A;  1V5P A;  5DHF B;  2ZPY A;  3CXB B;  4HAX B;  2RVB B;  3TO1 A;  2D11 A;  1K5D B;  2R09 A;  2J0M A;  4KAX B;  3IVF A;  2GJY A;  2CAY A;  2DX1 A;  3A8P A;  3TW1 A;  4CHM A;  4HAW B;  1EVH A;  4BBK A;  2Z0P A;  3OAN A;  3PEG A;  2AL6 A;  3BJI A;  2L1C A;  4YON A;  3D8F A;  3LJU X;  1UPQ A;  3DXD A;  2YS1 A;  2P0F A;  2XQN M;  4Y94 A;  2LUL A;  5JHH A;  1FAO A;  5LOP B;  1MPH A;  1WJ1 A;  1SGH A;  1I2H A;  3WA0 A;  4A6K A;  4HAZ B;  3KSY A;  4A6F A;  3D8D A;  2W2X D;  2D10 A;  4DX9 0;  4F7U P;  3RCP A;  2DLW A;  4TKN A;  1NU2 A;  1QQG A;  2CRF A;  5LON B;  2YVC A;  3KZ1 A;  1E5W A;  4B6H A;  4DXA B;  3X23 A;  1ZC3 B;  3DXC A;  2EMT A;  4HAV B;  3SV1 A;  5D27 A;  4GMX B;  3AU5 A;  3FEH A;  1KZ7 A;  1V5U A;  2DFK A;  2VRW B;  4A6H A;  5CLL B;  5D3V A;  2J0K A;  5D3W A;  2LKO A;  2COC A;  1XKE A;  1M7R A;  2DN6 A;  1U5D A;  5KCV A;  2R0D A;  4IFS A;  4HHV A;  1V89 A;  2BCJ A;  2DKQ A;  2ELA A;  3T06 A;  4H8S A;  1EF1 A;  1H10 A;  1BAK A;  1ZSQ A;  2M14 A;  1EGX A;  3ULC A;  1ISN A;  1UNQ A;  2HTH B;  1OMW A;  2DA0 A;  1DDW A;  2J0J A;  4GZU A;  3MDB C;  4EKU A;  4HB3 B;  2IFS A;  2P0D A;  2K2U A;  3P6A A;  4K2O A;  1K5G B;  3D8E A;  3VIA A;  5C16 A;  1U2B A;  2OQB A;  3ZDT A;  5JLJ B;  1X1F A;  4F7G A;  2ADZ A;  3ODO A;  1XOD A;  4CYE A;  1I7A A;  1RJ2 A;  2DHJ A;  4DX8 A;  3AJ4 A;  1XD4 A;  2G35 A;  2Y7B A;  3AU4 A;  5C5B B;  3KY9 A;  3GYP A;  2W2X C;  4WVF B;  2QKL A;  1Q67 A;  3O96 A;  2DHI A;  4HB2 B;  1M7E A;  1U5F A;  1H4R A;  3KRW A;  1LB1 A;  1FB8 A;  3SYX A;  1Z87 A;  2EJ8 A;  2MFQ A;  2I1J A;  4CHJ A;  1FHO A;  4L6E A;  4HB0 B;  1NTV A;  3FM8 C;  3ODW A;  2I1K A;  2I5F A;  4EMO A;  2H7E A;  2RNR B;  1J0W A;  1MKE A;  3SUZ A;  5C79 A;  2DX5 A;  2M38 A;  2PZ1 A;  1FGZ A;  1W1G A; 
#chains in the Genus database with same CATH topology
 2I5C A;  3ODX A;  1KI1 B;  3TCA A;  2LOX A;  3QWM A;  1NI2 A;  5J3T A;  2OTX A;  2FJL A;  1PMS A;  2MKR A;  1WI1 A;  5JHG A;  5DI9 B;  2UZS A;  2D9V A;  3HK0 A;  1UNR A;  2CY4 A;  3QBV B;  3FSS A;  5D3Y A;  4CSQ A;  5J3Q A;  2DTC A;  2IYB A;  4PQ0 A;  2GCJ A;  1PLS A;  2N0Y A;  3PVW A;  2DKP A;  2HE7 A;  3A98 B;  4HDQ A;  4GMV A;  1TJ6 A;  3PVL A;  1RRP B;  5DIF B;  2UVM A;  1Y19 B;  5DHA B;  4ZRI A;  3NW8 A;  2NZ8 B;  3OHM B;  2Y8G A;  3M1I B;  3V5W A;  4K17 A;  1V88 A;  3NWF A;  4OSN A;  4MK0 A;  3QIJ A;  5IRS A;  1MK9 B;  2NBV A;  1AWE A;  4ZRJ A;  2LG1 A;  4QJ5 B;  4YL8 A;  3NSU A;  2GCL A;  2L2I A;  3PSC A;  3A8Q A;  5HE1 A;  3BIN A;  1EAZ A;  1MIX A;  1P3R A;  3NWD A;  2QKM A;  3HW2 B;  1UPR A;  1U5G A;  4P7I A;  1WGU A;  1N3H A;  1TQZ A;  2DYQ A;  4OT1 A;  5DH9 B;  4A6F B;  2D9Z A;  2NMB A;  2K8E A;  1WVH A;  4GPT B;  4IOY X;  2YS5 A;  2MWN B;  2RGN B;  2E2X A;  3PP2 A;  2R2Y A;  2V76 A;  4HAT B;  2W2W A;  2YSZ A;  3PZD A;  5HE0 A;  3MPX A;  2AEH A;  1P6S A;  1GC6 A;  2GUM A;  2COA A;  1WJM A;  4HAY B;  1Y5O A;  4KVG B;  2YT0 A;  3HIE A;  1DDM A;  2ROV A;  2JP2 A;  4WJ7 A;  1NTY A;  2RUK B;  1AQC A;  2YT1 A;  1MIZ B;  1DRO A;  4DBB A;  5HE2 A;  5GOW B;  2EMS A;  2D4Q A;  3GYO A;  2VSZ A;  2YS3 A;  3CIK A;  2LOZ A;  1X05 A;  1KZG A;  2KR0 A;  1BTN A;  3TVV A;  1ZVR A;  4HB4 B;  4ZRK A;  5JP4 A;  1FHW A;  1BWN A;  2K00 A;  3ML4 A;  4MY6 A;  3VOQ A;  2KGX B;  3F0W A;  2P0H A;  4D0N B;  1U29 A;  2COF A;  5FI1 A;  4TYZ A;  1X11 A;  3HQC A;  4K81 A;  2D9W A;  3WYF B;  1MK7 B;  2MDX A;  1XR0 B;  4GNK B;  1LW3 A;  3U8Z A;  4PNK A;  1X86 A;  3PVU A;  1MAI A;  4EJN A;  1FHX A;  2RLO A;  1W1H A;  4F7H A;  5C6R A;  2LYD A;  4Z2N A;  3N7C A;  2CY5 A;  2YF0 A;  4C0A A;  3DXE A;  2N23 A;  1IRS A;  2H7D A;  1WG7 A;  1X1G A;  3ULB A;  1ZM0 A;  5J3Y A;  1GC7 A;  4XWX A;  3TFM A;  1DBH A;  2YRY A;  3SO6 A;  5C5B A;  2KCJ A;  2J59 M;  5KQ1 A;  1GG3 A;  1OY2 A;  4IAP A;  2KUP A;  2Z0Q A;  5D3X A;  1QC6 A;  1UEF A;  2ELB A;  2D9Y A;  1DDV A;  2UZR A;  5L81 A;  2Y8F A;  3KRX A;  4Z2M B;  4HDO A;  1SHC A;  1UNP A;  1BTK A;  4MT7 A;  3U7D A;  3A58 A;  1XCG A;  1DYN A;  2KIE A;  3F5R A;  2Q13 A;  2X18 A;  1U27 A;  2VKI A;  3P7Z A;  1J19 A;  2Z0O A;  5FI0 A;  5KQ4 A;  1MI1 A;  2DYN A;  1ZC4 B;  2DHK A;  1U5E A;  1FOE A;  3ZVR A;  2P8V A;  3PG7 A;  1WGQ A;  1PFJ A;  4KHB B;  1FGY A;  1XX0 A;  3UZT A;  4WSF A;  3G9W A;  1V61 A;  4KHO A;  4NY0 A;  1B55 A;  2ROZ B;  4GN1 A;  1W1D A;  4GXB A;  2D9X A;  4A5K A;  5HE3 A;  4HSI A;  5M4Y B;  2D2Q A;  5EFX A;  1TXD A;  3SNH A;  4HAU B;  5I2S A;  4KHA A;  2GS0 A;  1P5T A;  4K2P A;  2RSG A;  3DCX A;  2EC1 A;  1V5M A;  2K2J A;  2COD A;  4D6W A;  5CLQ B;  1OQN A;  4NSW A;  3FVC A;  1V5P A;  5DHF B;  2ZPY A;  3CXB B;  4HAX B;  2RVB B;  3TO1 A;  2Z59 A;  2D11 A;  1K5D B;  2R09 A;  2J0M A;  4KAX B;  3IVF A;  2GJY A;  2CAY A;  2DX1 A;  3A8P A;  3TW1 A;  4CHM A;  2ZKM X;  4HAW B;  1EVH A;  4BBK A;  2Z0P A;  3OAN A;  3PEG A;  3NWA A;  2AL6 A;  3BJI A;  2L1C A;  2YT2 A;  4YON A;  3D8F A;  3LJU X;  1UPQ A;  3DXD A;  2YS1 A;  2P0F A;  2XQN M;  4Y94 A;  2LUL A;  5JHH A;  1FAO A;  5I2M A;  5LOP B;  1MPH A;  1WJ1 A;  1SGH A;  1I2H A;  3WA0 A;  4A6K A;  1ZYI A;  4HAZ B;  3KSY A;  4A6F A;  3D8D A;  2W2X D;  2D10 A;  4DX9 0;  4F7U P;  3RCP A;  2DLW A;  4TKN A;  1NU2 A;  1QQG A;  2CRF A;  2Z14 A;  4L1R A;  5LON B;  2YVC A;  3KZ1 A;  1E5W A;  4B6H A;  4DXA B;  3X23 A;  1ZC3 B;  3DXC A;  2EMT A;  4HAV B;  3SV1 A;  5D27 A;  4GMX B;  3AU5 A;  4QJ4 B;  3FEH A;  1KZ7 A;  1V5U A;  2DFK A;  2VRW B;  4A6H A;  5CLL B;  5D3V A;  2KIG A;  2Z4D A;  2J0K A;  5D3W A;  2RRF A;  2LKO A;  2COC A;  1XKE A;  1M7R A;  3U12 A;  2DN6 A;  1U5D A;  5KCV A;  2R0D A;  4IFS A;  4HHV A;  1V89 A;  2BCJ A;  2DKQ A;  2ELA A;  3T06 A;  4H8S A;  1EF1 A;  1H10 A;  1BAK A;  1ZSQ A;  2M14 A;  1EGX A;  3ULC A;  1ISN A;  1UNQ A;  2HTH B;  4DIX A;  1OMW A;  2DA0 A;  1DDW A;  2J0J A;  4GZU A;  3MDB C;  4EKU A;  1T77 A;  4HB3 B;  2FJU B;  2IFS A;  2P0D A;  2K2U A;  3P6A A;  4K2O A;  1K5G B;  3D8E A;  3VIA A;  5C16 A;  1U2B A;  2OQB A;  4QJ3 B;  3ZDT A;  5JLJ B;  1X1F A;  4F7G A;  4QXA B;  2ADZ A;  3ODO A;  1XOD A;  4CYE A;  1I7A A;  1RJ2 A;  2DHJ A;  4DX8 A;  3AJ4 A;  1XD4 A;  2G35 A;  2Y7B A;  3AU4 A;  5C5B B;  3KY9 A;  3GYP A;  2W2X C;  4GOU A;  4WVF B;  2QKL A;  1Q67 A;  3O96 A;  3HSA A;  2DHI A;  4HB2 B;  1M7E A;  1U5F A;  1H4R A;  3KRW A;  1LB1 A;  1FB8 A;  3SYX A;  1Z87 A;  2EJ8 A;  2MFQ A;  2I1J A;  2K49 A;  4CHJ A;  1FHO A;  4L6E A;  4HB0 B;  2Z13 A;  1NTV A;  3FM8 C;  3ODW A;  2I1K A;  2I5F A;  4EMO A;  2H7E A;  3B77 A;  2KUQ A;  2RNR B;  1J0W A;  1MKE A;  3SUZ A;  4KHB A;  5C79 A;  2DX5 A;  2M38 A;  2PZ1 A;  1FGZ A;  5LG4 B;  1W1G A; 
#chains in the Genus database with same CATH homology
 2I5C A;  3ODX A;  1KI1 B;  3TCA A;  2LOX A;  3QWM A;  1NI2 A;  5J3T A;  2OTX A;  2FJL A;  1PMS A;  2MKR A;  1WI1 A;  5JHG A;  5DI9 B;  2UZS A;  2D9V A;  3HK0 A;  1UNR A;  2CY4 A;  3QBV B;  3FSS A;  5D3Y A;  5J3Q A;  2DTC A;  2IYB A;  4PQ0 A;  2GCJ A;  1PLS A;  2N0Y A;  3PVW A;  2DKP A;  2HE7 A;  3A98 B;  4HDQ A;  4GMV A;  1TJ6 A;  3PVL A;  1RRP B;  5DIF B;  2UVM A;  1Y19 B;  5DHA B;  4ZRI A;  2NZ8 B;  2Y8G A;  3M1I B;  3V5W A;  4K17 A;  1V88 A;  4MK0 A;  3QIJ A;  1MK9 B;  1AWE A;  4ZRJ A;  2LG1 A;  4YL8 A;  3NSU A;  2GCL A;  2L2I A;  3PSC A;  3A8Q A;  5HE1 A;  3BIN A;  1EAZ A;  1MIX A;  1P3R A;  2QKM A;  3HW2 B;  1UPR A;  1U5G A;  4P7I A;  1WGU A;  1N3H A;  1TQZ A;  2DYQ A;  5DH9 B;  4A6F B;  2D9Z A;  2NMB A;  1WVH A;  4GPT B;  4IOY X;  2YS5 A;  2MWN B;  2RGN B;  2E2X A;  3PP2 A;  2V76 A;  4HAT B;  2W2W A;  2YSZ A;  3PZD A;  5HE0 A;  3MPX A;  2AEH A;  1P6S A;  1GC6 A;  2COA A;  1WJM A;  4HAY B;  1Y5O A;  4KVG B;  2YT0 A;  1DDM A;  2ROV A;  2JP2 A;  4WJ7 A;  1NTY A;  2RUK B;  1AQC A;  2YT1 A;  1MIZ B;  1DRO A;  4DBB A;  5HE2 A;  5GOW B;  2EMS A;  2D4Q A;  3GYO A;  2VSZ A;  2YS3 A;  3CIK A;  2LOZ A;  1X05 A;  1KZG A;  1BTN A;  3TVV A;  1ZVR A;  4HB4 B;  4ZRK A;  5JP4 A;  1FHW A;  1BWN A;  2K00 A;  3ML4 A;  4MY6 A;  3VOQ A;  2KGX B;  3F0W A;  2P0H A;  4D0N B;  1U29 A;  2COF A;  5FI1 A;  4TYZ A;  1X11 A;  3HQC A;  4K81 A;  2D9W A;  3WYF B;  1MK7 B;  2MDX A;  1XR0 B;  3U8Z A;  1LW3 A;  4PNK A;  1X86 A;  3PVU A;  1MAI A;  4EJN A;  1FHX A;  2RLO A;  1W1H A;  4F7H A;  5C6R A;  2LYD A;  4Z2N A;  3N7C A;  2CY5 A;  2YF0 A;  4C0A A;  3DXE A;  2N23 A;  1IRS A;  2H7D A;  1WG7 A;  1X1G A;  3ULB A;  1ZM0 A;  5J3Y A;  1GC7 A;  4XWX A;  3TFM A;  1DBH A;  2YRY A;  3SO6 A;  5C5B A;  2KCJ A;  2J59 M;  5KQ1 A;  1GG3 A;  1OY2 A;  4IAP A;  2KUP A;  2Z0Q A;  5D3X A;  1QC6 A;  1UEF A;  2ELB A;  2D9Y A;  1DDV A;  2UZR A;  5L81 A;  2Y8F A;  3KRX A;  4Z2M B;  4HDO A;  1SHC A;  1UNP A;  1BTK A;  4MT7 A;  3U7D A;  1XCG A;  1DYN A;  3F5R A;  2Q13 A;  2X18 A;  1U27 A;  2VKI A;  3P7Z A;  1J19 A;  2Z0O A;  5FI0 A;  5KQ4 A;  2DYN A;  1ZC4 B;  2DHK A;  1U5E A;  1FOE A;  3ZVR A;  2P8V A;  3PG7 A;  1WGQ A;  1PFJ A;  4KHB B;  1FGY A;  1XX0 A;  3UZT A;  4WSF A;  3G9W A;  1V61 A;  4KHO A;  4NY0 A;  1B55 A;  2ROZ B;  4GN1 A;  1W1D A;  4GXB A;  2D9X A;  4A5K A;  5HE3 A;  2D2Q A;  5EFX A;  1TXD A;  3SNH A;  4HAU B;  4KHA A;  2GS0 A;  1P5T A;  4K2P A;  2RSG A;  2EC1 A;  1V5M A;  2K2J A;  2COD A;  5CLQ B;  1OQN A;  4NSW A;  1V5P A;  5DHF B;  2ZPY A;  3CXB B;  4HAX B;  2RVB B;  3TO1 A;  2D11 A;  1K5D B;  2R09 A;  2J0M A;  4KAX B;  3IVF A;  2GJY A;  2CAY A;  2DX1 A;  3A8P A;  3TW1 A;  4CHM A;  4HAW B;  1EVH A;  4BBK A;  2Z0P A;  3OAN A;  3PEG A;  2AL6 A;  3BJI A;  2L1C A;  4YON A;  3D8F A;  3LJU X;  1UPQ A;  3DXD A;  2YS1 A;  2P0F A;  2XQN M;  4Y94 A;  2LUL A;  5JHH A;  1FAO A;  5LOP B;  1MPH A;  1WJ1 A;  1SGH A;  1I2H A;  3WA0 A;  4A6K A;  4HAZ B;  3KSY A;  4A6F A;  3D8D A;  2W2X D;  2D10 A;  4DX9 0;  4F7U P;  3RCP A;  2DLW A;  4TKN A;  1NU2 A;  1QQG A;  2CRF A;  5LON B;  2YVC A;  3KZ1 A;  1E5W A;  4B6H A;  4DXA B;  3X23 A;  1ZC3 B;  3DXC A;  2EMT A;  4HAV B;  3SV1 A;  5D27 A;  4GMX B;  3AU5 A;  3FEH A;  1KZ7 A;  1V5U A;  2DFK A;  2VRW B;  4A6H A;  5CLL B;  5D3V A;  2J0K A;  5D3W A;  2LKO A;  2COC A;  1XKE A;  1M7R A;  2DN6 A;  1U5D A;  5KCV A;  2R0D A;  4IFS A;  4HHV A;  1V89 A;  2BCJ A;  2DKQ A;  2ELA A;  3T06 A;  4H8S A;  1EF1 A;  1H10 A;  1BAK A;  1ZSQ A;  2M14 A;  1EGX A;  3ULC A;  1ISN A;  1UNQ A;  2HTH B;  1OMW A;  2DA0 A;  1DDW A;  2J0J A;  4GZU A;  3MDB C;  4EKU A;  4HB3 B;  2IFS A;  2P0D A;  2K2U A;  3P6A A;  4K2O A;  1K5G B;  3D8E A;  3VIA A;  5C16 A;  1U2B A;  2OQB A;  3ZDT A;  5JLJ B;  1X1F A;  4F7G A;  2ADZ A;  3ODO A;  1XOD A;  4CYE A;  1I7A A;  1RJ2 A;  2DHJ A;  4DX8 A;  3AJ4 A;  1XD4 A;  2G35 A;  2Y7B A;  3AU4 A;  5C5B B;  3KY9 A;  3GYP A;  2W2X C;  4WVF B;  2QKL A;  1Q67 A;  3O96 A;  2DHI A;  4HB2 B;  1M7E A;  1U5F A;  1H4R A;  3KRW A;  1LB1 A;  1FB8 A;  3SYX A;  1Z87 A;  2EJ8 A;  2MFQ A;  2I1J A;  4CHJ A;  1FHO A;  4L6E A;  4HB0 B;  1NTV A;  3FM8 C;  3ODW A;  2I1K A;  2I5F A;  4EMO A;  2H7E A;  2RNR B;  1J0W A;  1MKE A;  3SUZ A;  5C79 A;  2DX5 A;  2M38 A;  2PZ1 A;  1FGZ A;  1W1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...