2D9ZA

Solution structure of the ph domain of protein kinase c, nu type from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
129
structure length
129
Chain Sequence
GSSGSSGMVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQGSNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, nu type
publication title Solution structure of the PH domain of Protein kinase C, nu type from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 129
sequence length 129
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9zA01
4Z2NA 2LULA 1UNRA 1FB8A 3T06A 1EAZA 5DHAB 3DXCA 1V5MA 3ODWA 3FEHA 4H8SA 3GYOA 1W1DA 4HDOA 3ZDTA 2CY5A 2D10A 2OTXA 4K2PA 1WJMA 3D8EA 3KY9A 2D11A 2XQNM 2K2UA 4IAPA 4MY6A 3DXEA 2NZ8B 5D3VA 2DHKA 2UZSA 1FAOA 1SHCA 2N0YA 2R0DA 2EJ8A 2YRYA 3PVLA 5JHHA 5C79A 1WJ1A 3FM8C 4ZRIA 2GCJA 3V5WA 5KCVA 3PSCA 1ZVRA 4GN1A 2CODA 4F7UP 4F7GA 2D4QA 4KHOA 1X11A 1E5WA 3IVFA 4A6KA 1X05A 1M7RA 1MK9B 3WA0A 1ZC4B 1KZGA 1V61A 1XX0A 1U5DA 1N3HA 2DKQA 2J59M 2VSZA 5DHFB 3LJUX 1MK7B 4GXBA 3SV1A 2RGNB 1XD4A 1KI1B 4KHAA 2AL6A 2DN6A 2D9WA 3D8FA 2PZ1A 1GC7A 2D9YA 2D9ZA 1ZC3B 1U5GA 3BJIA 2DTCA 2LOXA 1J0WA 1X1GA 2EMSA 5HE3A 1GG3A 1V5UA 3KRXA 3ML4A 2VKIA 2CRFA 4L6EA 3P7ZA 3PP2A 4Y94A 2EMTA 1DDMA 1V89A 3AU4A 3TW1A 4PNKA 1X1FA 2Y8GA 1DDVA 4HDQA 2RSGA 1W1HA 2CAYA 2P0HA 5DH9B 3TVVA 4HB0B 2LKOA 4F7HA 4HAXB 4A6HA 3TCAA 5CLLB 4HB2B 1PLSA 4DBBA 5C5BB 4CHMA 4XWXA 2K2JA 4HB3B 3RCPA 2I1KA 4A6FB 1FHOA 3NSUA 2JP2A 1V88A 4GZUA 5HE1A 2GJYA 4EMOA 2KCJA 2FJLA 2H7DA 1DDWA 1QQGA 4K17A 4DX90 4A5KA 1ZSQA 3MDBC 2KGXB 5JLJB 3TFMA 5L81A 2Y7BA 4K81A 5KQ4A 5C16A 3CIKA 1NU2A 3SO6A 3AU5A 5LONB 2HTHB 1W1GA 1I7AA 1SGHA 2YT0A 4GPTB 1WGQA 5D3WA 4K2OA 4WJ7A 3QIJA 1BTNA 3DXDA 3VIAA 4GMVA 1DBHA 4HAVB 1EF1A 2RUKB 3KRWA 2DYNA 1U27A 1OQNA 1H10A 4P7IA 4ZRKA 2COCA 1B55A 1MIXA 2X18A 2YS3A 2N23A 2ELAA 3VOQA 1P5TA 3BINA 1NTVA 1Z87A 1U2BA 5C6RA 2UZRA 4HAUB 1H4RA 2CY4A 2D9XA 1OY2A 1AWEA 4GMXB 1I2HA 3TO1A 3ODOA 3HK0A 1XR0B 4C0AA 2G35A 1Y19B 2YF0A 1PFJA 2Z0PA 4EKUA 1J19A 2COAA 2DYQA 2W2XC 3HQCA 1XCGA 2MKRA 1U5FA 1MAIA 1M7EA 1FGZA 3PVUA 3AJ4A 1XODA 3KSYA 2DFKA 2VRWB 3O96A 2QKLA 2Z0OA 2MWNB 4NY0A 3N7CA 4TYZA 2YS5A 4YONA 4B6HA 2COFA 2YSZA 3F0WA 1NI2A 3U8ZA 3SUZA 3WYFB 2AEHA 5D27A 2DX1A 5D3YA 4IOYX 1U5EA 4MT7A 3SYXA 3ZVRA 1UPQA 2I5CA 1U29A 5C5BA 3UZTA 2ADZA 1TXDA 2ROZB 3M1IB 1V5PA 2MDXA 1LB1A 2DA0A 4Z2MB 4YL8A 1TJ6A 1FOEA 2I1JA 2J0KA 2DHIA 2E2XA 1TQZA 2P8VA 1WGUA 5D3XA 4KHBB 2DKPA 4KVGB 3PG7A 4EJNA 2W2XD 2P0FA 3D8DA 1GC6A 1Q67A 2MFQA 2LOZA 2DHJA 3G9WA 1IRSA 2Z0QA 1FHXA 2P0DA 2ZPYA 1LW3A 2OQBA 5J3TA 4CYEA 1K5DB 2DX5A 2HE7A 3CXBB 4MK0A 2Q13A 3PEGA 2IFSA 3ULBA 2RVBB 4WVFB 2V76A 2ROVA 3A98B 4DXAB 1EGXA 2Y8FA 1BAKA 2QKMA 3FSSA 2I5FA 5LOPB 4HATB 4TKNA 3SNHA 5KQ1A 2UVMA 4HAWB 4DX8A 4HAYB 1UNQA 3X23A 1Y5OA 2RLOA 4BBKA 2YT1A 2EC1A 3P6AA 2D2QA 1WI1A 2NMBA 2H7EA 4ZRJA 1UPRA 4NSWA 5HE0A 1UEFA 1RRPB 3PZDA 3MPXA 1P3RA 1X86A 1BTKA 2GS0A 2LYDA 1BWNA 5JHGA 5EFXA 3U7DA 1WVHA 3F5RA 2W2WA 2LG1A 2L2IA 4WSFA 4CHJA 1EVHA 1PMSA 2DLWA 1KZ7A 1FHWA 1K5GB 1AQCA 3HW2B 1OMWA 2GCLA 2BCJA 1FGYA 4IFSA 5CLQB 2YS1A 1DYNA 3PVWA 3GYPA 2ELBA 4KAXB 2J0MA 1P6SA 2R09A 1MIZB 3KZ1A 3ULCA 3QBVB 1XKEA 2IYBA 2M38A 2KUPA 5GOWB 1RJ2A 3QWMA 2M14A 1UNPA 3ODXA 3OANA 4HHVA 1NTYA 1DROA 2D9VA 5FI0A 2RNRB 2YVCA 5DI9B 5J3YA 5DIFB 1WG7A 4A6FA 5J3QA 5HE2A 1ISNA 1ZM0A 5JP4A 1MKEA 2K00A 2J0JA 3A8QA 4HB4B 1QC6A 4PQ0A 3A8PA 5FI1A 4D0NB 1MPHA 2L1CA 4HAZB
chains in the Genus database with same CATH superfamily
4Z2NA 2LULA 1UNRA 1FB8A 3T06A 1EAZA 5DHAB 3DXCA 1V5MA 3ODWA 2Z13A 3FEHA 4H8SA 3GYOA 4GOUA 1W1DA 4HDOA 3ZDTA 2CY5A 2D10A 2OTXA 2Z59A 4K2PA 1WJMA 3D8EA 3KY9A 2D11A 2XQNM 2K2UA 4IAPA 4MY6A 3DXEA 2NZ8B 5D3VA 2DHKA 2UZSA 1FAOA 1SHCA 2N0YA 2R0DA 2EJ8A 2R2YA 2YRYA 3PVLA 5JHHA 5C79A 4HSIA 1WJ1A 3FM8C 4ZRIA 2GCJA 3V5WA 5KCVA 3PSCA 1ZVRA 4GN1A 2CODA 4F7UP 4F7GA 2D4QA 4KHOA 1X11A 1E5WA 3IVFA 4A6KA 1X05A 1M7RA 1MK9B 3WA0A 1ZC4B 1KZGA 1V61A 3NWFA 1XX0A 1U5DA 1N3HA 2DKQA 2J59M 2VSZA 4OT1A 5DHFB 3LJUX 1MK7B 4GXBA 3SV1A 2RGNB 1XD4A 1KI1B 4KHAA 2AL6A 2DN6A 2D9WA 3D8FA 2PZ1A 3B77A 2NBVA 1GC7A 2D9YA 2D9ZA 1ZC3B 1U5GA 3BJIA 2DTCA 2LOXA 1J0WA 1X1GA 2EMSA 5HE3A 1GG3A 1V5UA 3KRXA 3ML4A 2K8EA 2CRFA 2KIEA 2VKIA 4L6EA 3P7ZA 3PP2A 4Y94A 2EMTA 1DDMA 1V89A 3AU4A 3TW1A 4PNKA 1X1FA 2KUQA 2Y8GA 1DDVA 4HDQA 4CSQA 2RSGA 4QXAB 4QJ5B 1W1HA 2CAYA 2P0HA 5DH9B 3TVVA 4HB0B 2LKOA 4F7HA 4HAXB 4A6HA 3TCAA 5CLLB 4HB2B 1PLSA 4DBBA 3FVCA 5C5BB 4CHMA 4XWXA 2K2JA 4HB3B 3RCPA 2I1KA 4A6FB 1FHOA 3NSUA 2JP2A 1V88A 4GZUA 5HE1A 2GJYA 4EMOA 2KCJA 2FJLA 2H7DA 1DDWA 1QQGA 4K17A 4DX90 4A5KA 1ZSQA 3HIEA 3MDBC 2KGXB 5JLJB 3TFMA 5L81A 2Y7BA 4QJ3B 4K81A 5KQ4A 4KHBA 5C16A 3CIKA 1NU2A 3SO6A 3AU5A 5LONB 2HTHB 2Z14A 1W1GA 1I7AA 3NWDA 1SGHA 2YT0A 5I2SA 2KIGA 1WGQA 3DCXA 4GPTB 5D3WA 4K2OA 4WJ7A 3QIJA 1BTNA 3DXDA 3VIAA 4GMVA 1DBHA 4HAVB 1EF1A 2RUKB 3KRWA 4L1RA 2DYNA 1U27A 1OQNA 1H10A 5IRSA 3OHMB 4P7IA 3NW8A 4ZRKA 2COCA 1B55A 1MIXA 2X18A 2YS3A 2N23A 2ELAA 4D6WA 3A58A 3VOQA 1P5TA 3BINA 1NTVA 1Z87A 1U2BA 5C6RA 2UZRA 4HAUB 1H4RA 2CY4A 2D9XA 1OY2A 1AWEA 4GMXB 1I2HA 3TO1A 2ZKMX 3ODOA 3HK0A 1XR0B 4C0AA 2G35A 1Y19B 2YF0A 1PFJA 2Z0PA 4EKUA 1J19A 2COAA 2DYQA 2K49A 3U12A 1MI1A 2W2XC 3HQCA 1XCGA 2MKRA 1U5FA 1MAIA 1M7EA 1FGZA 3PVUA 3AJ4A 1XODA 3KSYA 2DFKA 2VRWB 3O96A 2QKLA 2Z0OA 2MWNB 4NY0A 3N7CA 4TYZA 2YS5A 4YONA 4B6HA 2COFA 2YSZA 3F0WA 1NI2A 3U8ZA 3SUZA 1T77A 3WYFB 2AEHA 5D27A 2DX1A 5D3YA 4IOYX 1U5EA 4MT7A 3SYXA 3ZVRA 1UPQA 2I5CA 1U29A 1ZYIA 5C5BA 3UZTA 2ADZA 1TXDA 2ROZB 3M1IB 1V5PA 2MDXA 1LB1A 2DA0A 4Z2MB 4YL8A 1TJ6A 1FOEA 2I1JA 3HSAA 2J0KA 2DHIA 2E2XA 1TQZA 2P8VA 1WGUA 2Z4DA 5D3XA 4KHBB 2DKPA 4KVGB 3PG7A 4EJNA 2W2XD 2P0FA 3D8DA 1GC6A 1Q67A 2MFQA 2LOZA 2DHJA 4GNKB 3G9WA 1IRSA 2Z0QA 1FHXA 2P0DA 2ZPYA 5LG4B 1LW3A 2OQBA 5J3TA 4CYEA 1K5DB 2DX5A 2HE7A 3CXBB 2RRFA 4MK0A 2Q13A 3PEGA 2IFSA 3ULBA 2RVBB 4WVFB 2V76A 2ROVA 3A98B 4DXAB 1EGXA 2YT2A 2Y8FA 1BAKA 2QKMA 3FSSA 2KR0A 2I5FA 5LOPB 4OSNA 4HATB 4TKNA 3SNHA 5KQ1A 2UVMA 4HAWB 4DX8A 4HAYB 1UNQA 3X23A 1Y5OA 2RLOA 4BBKA 2YT1A 2FJUB 2EC1A 2GUMA 3P6AA 2D2QA 1WI1A 2NMBA 2H7EA 4ZRJA 1UPRA 4NSWA 5HE0A 1UEFA 1RRPB 3PZDA 3MPXA 1P3RA 1X86A 1BTKA 2GS0A 2LYDA 1BWNA 5JHGA 5EFXA 3U7DA 1WVHA 3F5RA 2W2WA 2LG1A 5I2MA 2L2IA 4WSFA 4CHJA 1EVHA 1PMSA 2DLWA 1KZ7A 1FHWA 1K5GB 1AQCA 3HW2B 1OMWA 2GCLA 2BCJA 1FGYA 4IFSA 5CLQB 2YS1A 1DYNA 3PVWA 5M4YB 3GYPA 2ELBA 4KAXB 2J0MA 1P6SA 2R09A 1MIZB 3KZ1A 3ULCA 3QBVB 1XKEA 2IYBA 2M38A 2KUPA 5GOWB 1RJ2A 3QWMA 2M14A 1UNPA 3ODXA 3OANA 4HHVA 4DIXA 1NTYA 1DROA 2D9VA 5FI0A 2RNRB 2YVCA 5DI9B 5J3YA 5DIFB 1WG7A 4A6FA 5J3QA 3NWAA 5HE2A 1ISNA 1ZM0A 4QJ4B 5JP4A 1MKEA 2K00A 2J0JA 3A8QA 4HB4B 1QC6A 4PQ0A 3A8PA 5FI1A 4D0NB 1MPHA 2L1CA 4HAZB
chains in the Genus database with same CATH topology
4Z2NA 2LULA 1UNRA 1FB8A 3T06A 1EAZA 5DHAB 3DXCA 1V5MA 3ODWA 3FEHA 4H8SA 3GYOA 1W1DA 4HDOA 3ZDTA 2CY5A 2D10A 2OTXA 4K2PA 1WJMA 3D8EA 3KY9A 2D11A 2XQNM 2K2UA 4IAPA 4MY6A 3DXEA 2NZ8B 5D3VA 2DHKA 2UZSA 1FAOA 1SHCA 2N0YA 2R0DA 2EJ8A 2YRYA 3PVLA 5JHHA 5C79A 1WJ1A 3FM8C 4ZRIA 2GCJA 3V5WA 5KCVA 3PSCA 1ZVRA 4GN1A 2CODA 4F7UP 4F7GA 2D4QA 4KHOA 1X11A 1E5WA 3IVFA 4A6KA 1X05A 1M7RA 1MK9B 3WA0A 1ZC4B 1KZGA 1V61A 1XX0A 1U5DA 1N3HA 2DKQA 2J59M 2VSZA 5DHFB 3LJUX 1MK7B 4GXBA 3SV1A 2RGNB 1XD4A 1KI1B 4KHAA 2AL6A 2DN6A 2D9WA 3D8FA 2PZ1A 1GC7A 2D9YA 2D9ZA 1ZC3B 1U5GA 3BJIA 2DTCA 2LOXA 1J0WA 1X1GA 2EMSA 5HE3A 1GG3A 1V5UA 3KRXA 3ML4A 2VKIA 2CRFA 4L6EA 3P7ZA 3PP2A 4Y94A 2EMTA 1DDMA 1V89A 3AU4A 3TW1A 4PNKA 1X1FA 2Y8GA 1DDVA 4HDQA 2RSGA 1W1HA 2CAYA 2P0HA 5DH9B 3TVVA 4HB0B 2LKOA 4F7HA 4HAXB 4A6HA 3TCAA 5CLLB 4HB2B 1PLSA 4DBBA 5C5BB 4CHMA 4XWXA 2K2JA 4HB3B 3RCPA 2I1KA 4A6FB 1FHOA 3NSUA 2JP2A 1V88A 4GZUA 5HE1A 2GJYA 4EMOA 2KCJA 2FJLA 2H7DA 1DDWA 1QQGA 4K17A 4DX90 4A5KA 1ZSQA 3MDBC 2KGXB 5JLJB 3TFMA 5L81A 2Y7BA 4K81A 5KQ4A 5C16A 3CIKA 1NU2A 3SO6A 3AU5A 5LONB 2HTHB 1W1GA 1I7AA 1SGHA 2YT0A 4GPTB 1WGQA 5D3WA 4K2OA 4WJ7A 3QIJA 1BTNA 3DXDA 3VIAA 4GMVA 1DBHA 4HAVB 1EF1A 2RUKB 3KRWA 2DYNA 1U27A 1OQNA 1H10A 4P7IA 4ZRKA 2COCA 1B55A 1MIXA 2X18A 2YS3A 2N23A 2ELAA 3VOQA 1P5TA 3BINA 1NTVA 1Z87A 1U2BA 5C6RA 2UZRA 4HAUB 1H4RA 2CY4A 2D9XA 1OY2A 1AWEA 4GMXB 1I2HA 3TO1A 3ODOA 3HK0A 1XR0B 4C0AA 2G35A 1Y19B 2YF0A 1PFJA 2Z0PA 4EKUA 1J19A 2COAA 2DYQA 2W2XC 3HQCA 1XCGA 2MKRA 1U5FA 1MAIA 1M7EA 1FGZA 3PVUA 3AJ4A 1XODA 3KSYA 2DFKA 2VRWB 3O96A 2QKLA 2Z0OA 2MWNB 4NY0A 3N7CA 4TYZA 2YS5A 4YONA 4B6HA 2COFA 2YSZA 3F0WA 1NI2A 3U8ZA 3SUZA 3WYFB 2AEHA 5D27A 2DX1A 5D3YA 4IOYX 1U5EA 4MT7A 3SYXA 3ZVRA 1UPQA 2I5CA 1U29A 5C5BA 3UZTA 2ADZA 1TXDA 2ROZB 3M1IB 1V5PA 2MDXA 1LB1A 2DA0A 4Z2MB 4YL8A 1TJ6A 1FOEA 2I1JA 2J0KA 2DHIA 2E2XA 1TQZA 2P8VA 1WGUA 5D3XA 4KHBB 2DKPA 4KVGB 3PG7A 4EJNA 2W2XD 2P0FA 3D8DA 1GC6A 1Q67A 2MFQA 2LOZA 2DHJA 3G9WA 1IRSA 2Z0QA 1FHXA 2P0DA 2ZPYA 1LW3A 2OQBA 5J3TA 4CYEA 1K5DB 2DX5A 2HE7A 3CXBB 4MK0A 2Q13A 3PEGA 2IFSA 3ULBA 2RVBB 4WVFB 2V76A 2ROVA 3A98B 4DXAB 1EGXA 2Y8FA 1BAKA 2QKMA 3FSSA 2I5FA 5LOPB 4HATB 4TKNA 3SNHA 5KQ1A 2UVMA 4HAWB 4DX8A 4HAYB 1UNQA 3X23A 1Y5OA 2RLOA 4BBKA 2YT1A 2EC1A 3P6AA 2D2QA 1WI1A 2NMBA 2H7EA 4ZRJA 1UPRA 4NSWA 5HE0A 1UEFA 1RRPB 3PZDA 3MPXA 1P3RA 1X86A 1BTKA 2GS0A 2LYDA 1BWNA 5JHGA 5EFXA 3U7DA 1WVHA 3F5RA 2W2WA 2LG1A 2L2IA 4WSFA 4CHJA 1EVHA 1PMSA 2DLWA 1KZ7A 1FHWA 1K5GB 1AQCA 3HW2B 1OMWA 2GCLA 2BCJA 1FGYA 4IFSA 5CLQB 2YS1A 1DYNA 3PVWA 3GYPA 2ELBA 4KAXB 2J0MA 1P6SA 2R09A 1MIZB 3KZ1A 3ULCA 3QBVB 1XKEA 2IYBA 2M38A 2KUPA 5GOWB 1RJ2A 3QWMA 2M14A 1UNPA 3ODXA 3OANA 4HHVA 1NTYA 1DROA 2D9VA 5FI0A 2RNRB 2YVCA 5DI9B 5J3YA 5DIFB 1WG7A 4A6FA 5J3QA 5HE2A 1ISNA 1ZM0A 5JP4A 1MKEA 2K00A 2J0JA 3A8QA 4HB4B 1QC6A 4PQ0A 3A8PA 5FI1A 4D0NB 1MPHA 2L1CA 4HAZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2N A;  2LUL A;  1UNR A;  1FB8 A;  3T06 A;  1EAZ A;  5DHA B;  3DXC A;  1V5M A;  3ODW A;  3FEH A;  4H8S A;  3GYO A;  1W1D A;  4HDO A;  3ZDT A;  2CY5 A;  2D10 A;  2OTX A;  4K2P A;  1WJM A;  3D8E A;  3KY9 A;  2D11 A;  2XQN M;  2K2U A;  4IAP A;  4MY6 A;  3DXE A;  2NZ8 B;  5D3V A;  2DHK A;  2UZS A;  1FAO A;  1SHC A;  2N0Y A;  2R0D A;  2EJ8 A;  2YRY A;  3PVL A;  5JHH A;  5C79 A;  1WJ1 A;  3FM8 C;  4ZRI A;  2GCJ A;  3V5W A;  5KCV A;  3PSC A;  1ZVR A;  4GN1 A;  2COD A;  4F7U P;  4F7G A;  2D4Q A;  4KHO A;  1X11 A;  1E5W A;  3IVF A;  4A6K A;  1X05 A;  1M7R A;  1MK9 B;  3WA0 A;  1ZC4 B;  1KZG A;  1V61 A;  1XX0 A;  1U5D A;  1N3H A;  2DKQ A;  2J59 M;  2VSZ A;  5DHF B;  3LJU X;  1MK7 B;  4GXB A;  3SV1 A;  2RGN B;  1XD4 A;  1KI1 B;  4KHA A;  2AL6 A;  2DN6 A;  2D9W A;  3D8F A;  2PZ1 A;  1GC7 A;  2D9Y A;  2D9Z A;  1ZC3 B;  1U5G A;  3BJI A;  2DTC A;  2LOX A;  1J0W A;  1X1G A;  2EMS A;  5HE3 A;  1GG3 A;  1V5U A;  3KRX A;  3ML4 A;  2VKI A;  2CRF A;  4L6E A;  3P7Z A;  3PP2 A;  4Y94 A;  2EMT A;  1DDM A;  1V89 A;  3AU4 A;  3TW1 A;  4PNK A;  1X1F A;  2Y8G A;  1DDV A;  4HDQ A;  2RSG A;  1W1H A;  2CAY A;  2P0H A;  5DH9 B;  3TVV A;  4HB0 B;  2LKO A;  4F7H A;  4HAX B;  4A6H A;  3TCA A;  5CLL B;  4HB2 B;  1PLS A;  4DBB A;  5C5B B;  4CHM A;  4XWX A;  2K2J A;  4HB3 B;  3RCP A;  2I1K A;  4A6F B;  1FHO A;  3NSU A;  2JP2 A;  1V88 A;  4GZU A;  5HE1 A;  2GJY A;  4EMO A;  2KCJ A;  2FJL A;  2H7D A;  1DDW A;  1QQG A;  4K17 A;  4DX9 0;  4A5K A;  1ZSQ A;  3MDB C;  2KGX B;  5JLJ B;  3TFM A;  5L81 A;  2Y7B A;  4K81 A;  5KQ4 A;  5C16 A;  3CIK A;  1NU2 A;  3SO6 A;  3AU5 A;  5LON B;  2HTH B;  1W1G A;  1I7A A;  1SGH A;  2YT0 A;  4GPT B;  1WGQ A;  5D3W A;  4K2O A;  4WJ7 A;  3QIJ A;  1BTN A;  3DXD A;  3VIA A;  4GMV A;  1DBH A;  4HAV B;  1EF1 A;  2RUK B;  3KRW A;  2DYN A;  1U27 A;  1OQN A;  1H10 A;  4P7I A;  4ZRK A;  2COC A;  1B55 A;  1MIX A;  2X18 A;  2YS3 A;  2N23 A;  2ELA A;  3VOQ A;  1P5T A;  3BIN A;  1NTV A;  1Z87 A;  1U2B A;  5C6R A;  2UZR A;  4HAU B;  1H4R A;  2CY4 A;  2D9X A;  1OY2 A;  1AWE A;  4GMX B;  1I2H A;  3TO1 A;  3ODO A;  3HK0 A;  1XR0 B;  4C0A A;  2G35 A;  1Y19 B;  2YF0 A;  1PFJ A;  2Z0P A;  4EKU A;  1J19 A;  2COA A;  2DYQ A;  2W2X C;  3HQC A;  1XCG A;  2MKR A;  1U5F A;  1MAI A;  1M7E A;  1FGZ A;  3PVU A;  3AJ4 A;  1XOD A;  3KSY A;  2DFK A;  2VRW B;  3O96 A;  2QKL A;  2Z0O A;  2MWN B;  4NY0 A;  3N7C A;  4TYZ A;  2YS5 A;  4YON A;  4B6H A;  2COF A;  2YSZ A;  3F0W A;  1NI2 A;  3U8Z A;  3SUZ A;  3WYF B;  2AEH A;  5D27 A;  2DX1 A;  5D3Y A;  4IOY X;  1U5E A;  4MT7 A;  3SYX A;  3ZVR A;  1UPQ A;  2I5C A;  1U29 A;  5C5B A;  3UZT A;  2ADZ A;  1TXD A;  2ROZ B;  3M1I B;  1V5P A;  2MDX A;  1LB1 A;  2DA0 A;  4Z2M B;  4YL8 A;  1TJ6 A;  1FOE A;  2I1J A;  2J0K A;  2DHI A;  2E2X A;  1TQZ A;  2P8V A;  1WGU A;  5D3X A;  4KHB B;  2DKP A;  4KVG B;  3PG7 A;  4EJN A;  2W2X D;  2P0F A;  3D8D A;  1GC6 A;  1Q67 A;  2MFQ A;  2LOZ A;  2DHJ A;  3G9W A;  1IRS A;  2Z0Q A;  1FHX A;  2P0D A;  2ZPY A;  1LW3 A;  2OQB A;  5J3T A;  4CYE A;  1K5D B;  2DX5 A;  2HE7 A;  3CXB B;  4MK0 A;  2Q13 A;  3PEG A;  2IFS A;  3ULB A;  2RVB B;  4WVF B;  2V76 A;  2ROV A;  3A98 B;  4DXA B;  1EGX A;  2Y8F A;  1BAK A;  2QKM A;  3FSS A;  2I5F A;  5LOP B;  4HAT B;  4TKN A;  3SNH A;  5KQ1 A;  2UVM A;  4HAW B;  4DX8 A;  4HAY B;  1UNQ A;  3X23 A;  1Y5O A;  2RLO A;  4BBK A;  2YT1 A;  2EC1 A;  3P6A A;  2D2Q A;  1WI1 A;  2NMB A;  2H7E A;  4ZRJ A;  1UPR A;  4NSW A;  5HE0 A;  1UEF A;  1RRP B;  3PZD A;  3MPX A;  1P3R A;  1X86 A;  1BTK A;  2GS0 A;  2LYD A;  1BWN A;  5JHG A;  5EFX A;  3U7D A;  1WVH A;  3F5R A;  2W2W A;  2LG1 A;  2L2I A;  4WSF A;  4CHJ A;  1EVH A;  1PMS A;  2DLW A;  1KZ7 A;  1FHW A;  1K5G B;  1AQC A;  3HW2 B;  1OMW A;  2GCL A;  2BCJ A;  1FGY A;  4IFS A;  5CLQ B;  2YS1 A;  1DYN A;  3PVW A;  3GYP A;  2ELB A;  4KAX B;  2J0M A;  1P6S A;  2R09 A;  1MIZ B;  3KZ1 A;  3ULC A;  3QBV B;  1XKE A;  2IYB A;  2M38 A;  2KUP A;  5GOW B;  1RJ2 A;  3QWM A;  2M14 A;  1UNP A;  3ODX A;  3OAN A;  4HHV A;  1NTY A;  1DRO A;  2D9V A;  5FI0 A;  2RNR B;  2YVC A;  5DI9 B;  5J3Y A;  5DIF B;  1WG7 A;  4A6F A;  5J3Q A;  5HE2 A;  1ISN A;  1ZM0 A;  5JP4 A;  1MKE A;  2K00 A;  2J0J A;  3A8Q A;  4HB4 B;  1QC6 A;  4PQ0 A;  3A8P A;  5FI1 A;  4D0N B;  1MPH A;  2L1C A;  4HAZ B; 
#chains in the Genus database with same CATH topology
 4Z2N A;  2LUL A;  1UNR A;  1FB8 A;  3T06 A;  1EAZ A;  5DHA B;  3DXC A;  1V5M A;  3ODW A;  2Z13 A;  3FEH A;  4H8S A;  3GYO A;  4GOU A;  1W1D A;  4HDO A;  3ZDT A;  2CY5 A;  2D10 A;  2OTX A;  2Z59 A;  4K2P A;  1WJM A;  3D8E A;  3KY9 A;  2D11 A;  2XQN M;  2K2U A;  4IAP A;  4MY6 A;  3DXE A;  2NZ8 B;  5D3V A;  2DHK A;  2UZS A;  1FAO A;  1SHC A;  2N0Y A;  2R0D A;  2EJ8 A;  2R2Y A;  2YRY A;  3PVL A;  5JHH A;  5C79 A;  4HSI A;  1WJ1 A;  3FM8 C;  4ZRI A;  2GCJ A;  3V5W A;  5KCV A;  3PSC A;  1ZVR A;  4GN1 A;  2COD A;  4F7U P;  4F7G A;  2D4Q A;  4KHO A;  1X11 A;  1E5W A;  3IVF A;  4A6K A;  1X05 A;  1M7R A;  1MK9 B;  3WA0 A;  1ZC4 B;  1KZG A;  1V61 A;  3NWF A;  1XX0 A;  1U5D A;  1N3H A;  2DKQ A;  2J59 M;  2VSZ A;  4OT1 A;  5DHF B;  3LJU X;  1MK7 B;  4GXB A;  3SV1 A;  2RGN B;  1XD4 A;  1KI1 B;  4KHA A;  2AL6 A;  2DN6 A;  2D9W A;  3D8F A;  2PZ1 A;  3B77 A;  2NBV A;  1GC7 A;  2D9Y A;  2D9Z A;  1ZC3 B;  1U5G A;  3BJI A;  2DTC A;  2LOX A;  1J0W A;  1X1G A;  2EMS A;  5HE3 A;  1GG3 A;  1V5U A;  3KRX A;  3ML4 A;  2K8E A;  2CRF A;  2KIE A;  2VKI A;  4L6E A;  3P7Z A;  3PP2 A;  4Y94 A;  2EMT A;  1DDM A;  1V89 A;  3AU4 A;  3TW1 A;  4PNK A;  1X1F A;  2KUQ A;  2Y8G A;  1DDV A;  4HDQ A;  4CSQ A;  2RSG A;  4QXA B;  4QJ5 B;  1W1H A;  2CAY A;  2P0H A;  5DH9 B;  3TVV A;  4HB0 B;  2LKO A;  4F7H A;  4HAX B;  4A6H A;  3TCA A;  5CLL B;  4HB2 B;  1PLS A;  4DBB A;  3FVC A;  5C5B B;  4CHM A;  4XWX A;  2K2J A;  4HB3 B;  3RCP A;  2I1K A;  4A6F B;  1FHO A;  3NSU A;  2JP2 A;  1V88 A;  4GZU A;  5HE1 A;  2GJY A;  4EMO A;  2KCJ A;  2FJL A;  2H7D A;  1DDW A;  1QQG A;  4K17 A;  4DX9 0;  4A5K A;  1ZSQ A;  3HIE A;  3MDB C;  2KGX B;  5JLJ B;  3TFM A;  5L81 A;  2Y7B A;  4QJ3 B;  4K81 A;  5KQ4 A;  4KHB A;  5C16 A;  3CIK A;  1NU2 A;  3SO6 A;  3AU5 A;  5LON B;  2HTH B;  2Z14 A;  1W1G A;  1I7A A;  3NWD A;  1SGH A;  2YT0 A;  5I2S A;  2KIG A;  1WGQ A;  3DCX A;  4GPT B;  5D3W A;  4K2O A;  4WJ7 A;  3QIJ A;  1BTN A;  3DXD A;  3VIA A;  4GMV A;  1DBH A;  4HAV B;  1EF1 A;  2RUK B;  3KRW A;  4L1R A;  2DYN A;  1U27 A;  1OQN A;  1H10 A;  5IRS A;  3OHM B;  4P7I A;  3NW8 A;  4ZRK A;  2COC A;  1B55 A;  1MIX A;  2X18 A;  2YS3 A;  2N23 A;  2ELA A;  4D6W A;  3A58 A;  3VOQ A;  1P5T A;  3BIN A;  1NTV A;  1Z87 A;  1U2B A;  5C6R A;  2UZR A;  4HAU B;  1H4R A;  2CY4 A;  2D9X A;  1OY2 A;  1AWE A;  4GMX B;  1I2H A;  3TO1 A;  2ZKM X;  3ODO A;  3HK0 A;  1XR0 B;  4C0A A;  2G35 A;  1Y19 B;  2YF0 A;  1PFJ A;  2Z0P A;  4EKU A;  1J19 A;  2COA A;  2DYQ A;  2K49 A;  3U12 A;  1MI1 A;  2W2X C;  3HQC A;  1XCG A;  2MKR A;  1U5F A;  1MAI A;  1M7E A;  1FGZ A;  3PVU A;  3AJ4 A;  1XOD A;  3KSY A;  2DFK A;  2VRW B;  3O96 A;  2QKL A;  2Z0O A;  2MWN B;  4NY0 A;  3N7C A;  4TYZ A;  2YS5 A;  4YON A;  4B6H A;  2COF A;  2YSZ A;  3F0W A;  1NI2 A;  3U8Z A;  3SUZ A;  1T77 A;  3WYF B;  2AEH A;  5D27 A;  2DX1 A;  5D3Y A;  4IOY X;  1U5E A;  4MT7 A;  3SYX A;  3ZVR A;  1UPQ A;  2I5C A;  1U29 A;  1ZYI A;  5C5B A;  3UZT A;  2ADZ A;  1TXD A;  2ROZ B;  3M1I B;  1V5P A;  2MDX A;  1LB1 A;  2DA0 A;  4Z2M B;  4YL8 A;  1TJ6 A;  1FOE A;  2I1J A;  3HSA A;  2J0K A;  2DHI A;  2E2X A;  1TQZ A;  2P8V A;  1WGU A;  2Z4D A;  5D3X A;  4KHB B;  2DKP A;  4KVG B;  3PG7 A;  4EJN A;  2W2X D;  2P0F A;  3D8D A;  1GC6 A;  1Q67 A;  2MFQ A;  2LOZ A;  2DHJ A;  4GNK B;  3G9W A;  1IRS A;  2Z0Q A;  1FHX A;  2P0D A;  2ZPY A;  5LG4 B;  1LW3 A;  2OQB A;  5J3T A;  4CYE A;  1K5D B;  2DX5 A;  2HE7 A;  3CXB B;  2RRF A;  4MK0 A;  2Q13 A;  3PEG A;  2IFS A;  3ULB A;  2RVB B;  4WVF B;  2V76 A;  2ROV A;  3A98 B;  4DXA B;  1EGX A;  2YT2 A;  2Y8F A;  1BAK A;  2QKM A;  3FSS A;  2KR0 A;  2I5F A;  5LOP B;  4OSN A;  4HAT B;  4TKN A;  3SNH A;  5KQ1 A;  2UVM A;  4HAW B;  4DX8 A;  4HAY B;  1UNQ A;  3X23 A;  1Y5O A;  2RLO A;  4BBK A;  2YT1 A;  2FJU B;  2EC1 A;  2GUM A;  3P6A A;  2D2Q A;  1WI1 A;  2NMB A;  2H7E A;  4ZRJ A;  1UPR A;  4NSW A;  5HE0 A;  1UEF A;  1RRP B;  3PZD A;  3MPX A;  1P3R A;  1X86 A;  1BTK A;  2GS0 A;  2LYD A;  1BWN A;  5JHG A;  5EFX A;  3U7D A;  1WVH A;  3F5R A;  2W2W A;  2LG1 A;  5I2M A;  2L2I A;  4WSF A;  4CHJ A;  1EVH A;  1PMS A;  2DLW A;  1KZ7 A;  1FHW A;  1K5G B;  1AQC A;  3HW2 B;  1OMW A;  2GCL A;  2BCJ A;  1FGY A;  4IFS A;  5CLQ B;  2YS1 A;  1DYN A;  3PVW A;  5M4Y B;  3GYP A;  2ELB A;  4KAX B;  2J0M A;  1P6S A;  2R09 A;  1MIZ B;  3KZ1 A;  3ULC A;  3QBV B;  1XKE A;  2IYB A;  2M38 A;  2KUP A;  5GOW B;  1RJ2 A;  3QWM A;  2M14 A;  1UNP A;  3ODX A;  3OAN A;  4HHV A;  4DIX A;  1NTY A;  1DRO A;  2D9V A;  5FI0 A;  2RNR B;  2YVC A;  5DI9 B;  5J3Y A;  5DIF B;  1WG7 A;  4A6F A;  5J3Q A;  3NWA A;  5HE2 A;  1ISN A;  1ZM0 A;  4QJ4 B;  5JP4 A;  1MKE A;  2K00 A;  2J0J A;  3A8Q A;  4HB4 B;  1QC6 A;  4PQ0 A;  3A8P A;  5FI1 A;  4D0N B;  1MPH A;  2L1C A;  4HAZ B; 
#chains in the Genus database with same CATH homology
 4Z2N A;  2LUL A;  1UNR A;  1FB8 A;  3T06 A;  1EAZ A;  5DHA B;  3DXC A;  1V5M A;  3ODW A;  3FEH A;  4H8S A;  3GYO A;  1W1D A;  4HDO A;  3ZDT A;  2CY5 A;  2D10 A;  2OTX A;  4K2P A;  1WJM A;  3D8E A;  3KY9 A;  2D11 A;  2XQN M;  2K2U A;  4IAP A;  4MY6 A;  3DXE A;  2NZ8 B;  5D3V A;  2DHK A;  2UZS A;  1FAO A;  1SHC A;  2N0Y A;  2R0D A;  2EJ8 A;  2YRY A;  3PVL A;  5JHH A;  5C79 A;  1WJ1 A;  3FM8 C;  4ZRI A;  2GCJ A;  3V5W A;  5KCV A;  3PSC A;  1ZVR A;  4GN1 A;  2COD A;  4F7U P;  4F7G A;  2D4Q A;  4KHO A;  1X11 A;  1E5W A;  3IVF A;  4A6K A;  1X05 A;  1M7R A;  1MK9 B;  3WA0 A;  1ZC4 B;  1KZG A;  1V61 A;  1XX0 A;  1U5D A;  1N3H A;  2DKQ A;  2J59 M;  2VSZ A;  5DHF B;  3LJU X;  1MK7 B;  4GXB A;  3SV1 A;  2RGN B;  1XD4 A;  1KI1 B;  4KHA A;  2AL6 A;  2DN6 A;  2D9W A;  3D8F A;  2PZ1 A;  1GC7 A;  2D9Y A;  2D9Z A;  1ZC3 B;  1U5G A;  3BJI A;  2DTC A;  2LOX A;  1J0W A;  1X1G A;  2EMS A;  5HE3 A;  1GG3 A;  1V5U A;  3KRX A;  3ML4 A;  2VKI A;  2CRF A;  4L6E A;  3P7Z A;  3PP2 A;  4Y94 A;  2EMT A;  1DDM A;  1V89 A;  3AU4 A;  3TW1 A;  4PNK A;  1X1F A;  2Y8G A;  1DDV A;  4HDQ A;  2RSG A;  1W1H A;  2CAY A;  2P0H A;  5DH9 B;  3TVV A;  4HB0 B;  2LKO A;  4F7H A;  4HAX B;  4A6H A;  3TCA A;  5CLL B;  4HB2 B;  1PLS A;  4DBB A;  5C5B B;  4CHM A;  4XWX A;  2K2J A;  4HB3 B;  3RCP A;  2I1K A;  4A6F B;  1FHO A;  3NSU A;  2JP2 A;  1V88 A;  4GZU A;  5HE1 A;  2GJY A;  4EMO A;  2KCJ A;  2FJL A;  2H7D A;  1DDW A;  1QQG A;  4K17 A;  4DX9 0;  4A5K A;  1ZSQ A;  3MDB C;  2KGX B;  5JLJ B;  3TFM A;  5L81 A;  2Y7B A;  4K81 A;  5KQ4 A;  5C16 A;  3CIK A;  1NU2 A;  3SO6 A;  3AU5 A;  5LON B;  2HTH B;  1W1G A;  1I7A A;  1SGH A;  2YT0 A;  4GPT B;  1WGQ A;  5D3W A;  4K2O A;  4WJ7 A;  3QIJ A;  1BTN A;  3DXD A;  3VIA A;  4GMV A;  1DBH A;  4HAV B;  1EF1 A;  2RUK B;  3KRW A;  2DYN A;  1U27 A;  1OQN A;  1H10 A;  4P7I A;  4ZRK A;  2COC A;  1B55 A;  1MIX A;  2X18 A;  2YS3 A;  2N23 A;  2ELA A;  3VOQ A;  1P5T A;  3BIN A;  1NTV A;  1Z87 A;  1U2B A;  5C6R A;  2UZR A;  4HAU B;  1H4R A;  2CY4 A;  2D9X A;  1OY2 A;  1AWE A;  4GMX B;  1I2H A;  3TO1 A;  3ODO A;  3HK0 A;  1XR0 B;  4C0A A;  2G35 A;  1Y19 B;  2YF0 A;  1PFJ A;  2Z0P A;  4EKU A;  1J19 A;  2COA A;  2DYQ A;  2W2X C;  3HQC A;  1XCG A;  2MKR A;  1U5F A;  1MAI A;  1M7E A;  1FGZ A;  3PVU A;  3AJ4 A;  1XOD A;  3KSY A;  2DFK A;  2VRW B;  3O96 A;  2QKL A;  2Z0O A;  2MWN B;  4NY0 A;  3N7C A;  4TYZ A;  2YS5 A;  4YON A;  4B6H A;  2COF A;  2YSZ A;  3F0W A;  1NI2 A;  3U8Z A;  3SUZ A;  3WYF B;  2AEH A;  5D27 A;  2DX1 A;  5D3Y A;  4IOY X;  1U5E A;  4MT7 A;  3SYX A;  3ZVR A;  1UPQ A;  2I5C A;  1U29 A;  5C5B A;  3UZT A;  2ADZ A;  1TXD A;  2ROZ B;  3M1I B;  1V5P A;  2MDX A;  1LB1 A;  2DA0 A;  4Z2M B;  4YL8 A;  1TJ6 A;  1FOE A;  2I1J A;  2J0K A;  2DHI A;  2E2X A;  1TQZ A;  2P8V A;  1WGU A;  5D3X A;  4KHB B;  2DKP A;  4KVG B;  3PG7 A;  4EJN A;  2W2X D;  2P0F A;  3D8D A;  1GC6 A;  1Q67 A;  2MFQ A;  2LOZ A;  2DHJ A;  3G9W A;  1IRS A;  2Z0Q A;  1FHX A;  2P0D A;  2ZPY A;  1LW3 A;  2OQB A;  5J3T A;  4CYE A;  1K5D B;  2DX5 A;  2HE7 A;  3CXB B;  4MK0 A;  2Q13 A;  3PEG A;  2IFS A;  3ULB A;  2RVB B;  4WVF B;  2V76 A;  2ROV A;  3A98 B;  4DXA B;  1EGX A;  2Y8F A;  1BAK A;  2QKM A;  3FSS A;  2I5F A;  5LOP B;  4HAT B;  4TKN A;  3SNH A;  5KQ1 A;  2UVM A;  4HAW B;  4DX8 A;  4HAY B;  1UNQ A;  3X23 A;  1Y5O A;  2RLO A;  4BBK A;  2YT1 A;  2EC1 A;  3P6A A;  2D2Q A;  1WI1 A;  2NMB A;  2H7E A;  4ZRJ A;  1UPR A;  4NSW A;  5HE0 A;  1UEF A;  1RRP B;  3PZD A;  3MPX A;  1P3R A;  1X86 A;  1BTK A;  2GS0 A;  2LYD A;  1BWN A;  5JHG A;  5EFX A;  3U7D A;  1WVH A;  3F5R A;  2W2W A;  2LG1 A;  2L2I A;  4WSF A;  4CHJ A;  1EVH A;  1PMS A;  2DLW A;  1KZ7 A;  1FHW A;  1K5G B;  1AQC A;  3HW2 B;  1OMW A;  2GCL A;  2BCJ A;  1FGY A;  4IFS A;  5CLQ B;  2YS1 A;  1DYN A;  3PVW A;  3GYP A;  2ELB A;  4KAX B;  2J0M A;  1P6S A;  2R09 A;  1MIZ B;  3KZ1 A;  3ULC A;  3QBV B;  1XKE A;  2IYB A;  2M38 A;  2KUP A;  5GOW B;  1RJ2 A;  3QWM A;  2M14 A;  1UNP A;  3ODX A;  3OAN A;  4HHV A;  1NTY A;  1DRO A;  2D9V A;  5FI0 A;  2RNR B;  2YVC A;  5DI9 B;  5J3Y A;  5DIF B;  1WG7 A;  4A6F A;  5J3Q A;  5HE2 A;  1ISN A;  1ZM0 A;  5JP4 A;  1MKE A;  2K00 A;  2J0J A;  3A8Q A;  4HB4 B;  1QC6 A;  4PQ0 A;  3A8P A;  5FI1 A;  4D0N B;  1MPH A;  2L1C A;  4HAZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...