2D9ZA

Solution structure of the ph domain of protein kinase c, nu type from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
129
structure length
129
Chain Sequence
GSSGSSGMVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQGSNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of Protein kinase C, nu type from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Protein kinase C, nu type
total genus 13
structure length 129
sequence length 129
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9zA01
2ZPYA 1Q67A 4GPTB 1P6SA 2I5FA 4HATB 5KQ1A 4ZRIA 2N0YA 4K17A 1J19A 5KQ4A 2ADZA 2D9VA 3ULCA 5C6RA 4EKUA 4HDOA 1AWEA 2LULA 2MWNB 2IFSA 5HE1A 2MKRA 1DROA 1TJ6A 3HQCA 1U5EA 3F5RA 2OQBA 2EJ8A 2YS3A 1Y5OA 3PVUA 2HTHB 1ZVRA 1H4RA 2I1JA 2DHIA 5JHHA 1BTNA 1WJMA 5HE0A 3A8QA 1PFJA 1ZC3B 3P6AA 4CHMA 2DHJA 3IVFA 3KRWA 3VOQA 2RVBB 2UZRA 4L6EA 2D9XA 5CLQB 1XR0B 2DX1A 2COFA 2EC1A 4HAYB 1M7EA 3WYFB 5LONB 2M38A 3KRXA 1MK7B 2L2IA 4Z2MB 4WSFA 2R0DA 4Z2NA 3MDBC 4YL8A 2Y8FA 1DDWA 1W1GA 5GOWB 4GMXB 4HB3B 1ZSQA 1GG3A 2CODA 3KSYA 4EMOA 1X86A 4KHAA 1W1HA 4DBBA 2X18A 4KHBB 1EAZA 3HW2B 2GJYA 2IYBA 2YVCA 2MDXA 3T06A 3FM8C 4F7HA 1MK9B 4KVGB 4P7IA 4DX90 3RCPA 4PQ0A 1OY2A 2ROVA 1FHOA 3PVLA 1FHWA 3A8PA 5DI9B 2NZ8B 4A6FB 2Y8GA 2VRWB 4HB4B 1B55A 1E5WA 4IFSA 1UEFA 3ML4A 2G35A 1NTVA 3M1IB 5C79A 5C5BA 2J0MA 3PZDA 2YSZA 5KCVA 5D3XA 2J0JA 3UZTA 2ROZB 1FHXA 4NSWA 2I5CA 3GYOA 1KI1B 4BBKA 2VKIA 2DLWA 1V5MA 1MKEA 1U5DA 1TXDA 3AU5A 4WVFB 1FGYA 4KHOA 2XQNM 1XKEA 1MIZB 3BINA 1UNQA 1BWNA 3GYPA 2W2WA 1FB8A 1N3HA 1UPQA 2P0DA 2P8VA 3SNHA 1OMWA 3TO1A 2RGNB 1NTYA 1K5GB 1NU2A 1P3RA 3ODOA 2LOZA 4EJNA 3QBVB 4ZRJA 2FJLA 2K2UA 5DIFB 1PLSA 2EMSA 3TW1A 4H8SA 3NSUA 2D9ZA 1GC6A 1XODA 2KUPA 4A6HA 1KZ7A 3U8ZA 2N23A 2CRFA 2YS5A 4HB0B 2AL6A 3MPXA 2ELBA 5JHGA 3DXCA 4GN1A 2DA0A 1Y19B 3TFMA 3ULBA 2OTXA 2H7EA 1EVHA 2RLOA 1WJ1A 5HE2A 2UVMA 2M14A 1V5UA 2ELAA 3VIAA 3DXEA 2GCJA 2MFQA 2RNRB 1V61A 3TCAA 1H10A 1GC7A 4HB2B 2YF0A 2CY4A 2DFKA 3PG7A 2D10A 2COAA 4IOYX 4HAUB 2E2XA 1KZGA 1BAKA 2R09A 3DXDA 1X1GA 2CY5A 4DX8A 4IAPA 2Q13A 1M7RA 5CLLB 2J0KA 3FSSA 1DDMA 2P0HA 1U5FA 4A5KA 3A98B 3QIJA 4WJ7A 5J3YA 4TYZA 5D27A 2LG1A 3ODXA 1DYNA 5C5BB 5FI1A 2P0FA 3ZVRA 2D4QA 1MAIA 5J3QA 3CXBB 3V5WA 1BTKA 2Y7BA 2D11A 1ISNA 4MK0A 2DYQA 4DXAB 4K2PA 3D8FA 2YRYA 1QC6A 1U29A 1X1FA 4PNKA 3HK0A 2JP2A 3AU4A 1X11A 2RSGA 2DN6A 1K5DB 2KCJA 2QKMA 4F7UP 2KGXB 1UNPA 3D8EA 2DYNA 1WVHA 1WGUA 3O96A 2UZSA 1I7AA 1OQNA 1QQGA 3AJ4A 1WGQA 2EMTA 4HAWB 1U2BA 3F0WA 4A6FA 1RJ2A 4YONA 3QWMA 4GZUA 2COCA 5DHAB 1P5TA 5EFXA 3SYXA 4ZRKA 2D2QA 4GMVA 1W1DA 4HAZB 4D0NB 2GCLA 3PEGA 3SO6A 1V5PA 1FOEA 5DHFB 1LW3A 2W2XC 4HAVB 2RUKB 1DBHA 3KY9A 3OANA 4CHJA 4Y94A 3PSCA 1MPHA 4F7GA 2QKLA 2HE7A 1FAOA 5D3VA 2DKPA 1V88A 3P7ZA 2LYDA 2D9YA 1U5GA 2D9WA 1ZC4B 1SHCA 5JP4A 4HAXB 2VSZA 4MY6A 4CYEA 3SV1A 5J3TA 5JLJB 2PZ1A 4B6HA 5D3WA 3D8DA 3X23A 3WA0A 5C16A 1PMSA 2AEHA 1V89A 2DHKA 2Z0OA 1EGXA 3PVWA 3SUZA 1XD4A 3N7CA 1SGHA 1NI2A 2I1KA 3PP2A 1MIXA 1J0WA 1WI1A 2YS1A 1TQZA 2V76A 3KZ1A 1IRSA 4XWXA 2LKOA 2YT0A 4K2OA 1EF1A 2CAYA 1ZM0A 3LJUX 1XX0A 2DTCA 2J59M 3CIKA 1FGZA 2LOXA 1XCGA 1Z87A 3ZDTA 2W2XD 1AQCA 2K00A 2GS0A 5LOPB 2BCJA 2L1CA 5HE3A 5L81A 3U7DA 1LB1A 4GXBA 3BJIA 4K81A 4A6KA 1I2HA 3ODWA 5FI0A 2Z0QA 2DX5A 3G9WA 2NMBA 4C0AA 1RRPB 3FEHA 4NY0A 1DDVA 3TVVA 1U27A 2YT1A 4HHVA 4KAXB 2Z0PA 2K2JA 5D3YA 4HDQA 4TKNA 5DH9B 2DKQA 1UPRA 1X05A 1WG7A 1UNRA 2H7DA 4MT7A
chains in the Genus database with same CATH superfamily
2ZPYA 1Q67A 4GPTB 1P6SA 2I5FA 4HATB 2R2YA 5KQ1A 4ZRIA 2N0YA 4K17A 1J19A 5KQ4A 2ADZA 2D9VA 2KR0A 3ULCA 5C6RA 4EKUA 4HDOA 1MI1A 1AWEA 2LULA 2MWNB 2IFSA 5HE1A 2MKRA 1DROA 1TJ6A 3HQCA 1U5EA 3F5RA 2OQBA 2EJ8A 2YS3A 3PVUA 3NW8A 1Y5OA 2HTHB 1ZVRA 1H4RA 2I1JA 2DHIA 3U12A 5JHHA 1BTNA 1WJMA 5HE0A 3A8QA 1PFJA 1ZC3B 4QJ4B 2KIEA 3P6AA 4CHMA 2DHJA 4OT1A 3IVFA 3KRWA 3VOQA 2RVBB 2UZRA 4L6EA 2D9XA 5CLQB 1XR0B 2DX1A 2COFA 2EC1A 4HAYB 1M7EA 2KUQA 3WYFB 5LONB 2M38A 3KRXA 1MK7B 2L2IA 4Z2MB 4WSFA 2R0DA 4Z2NA 4QJ5B 3MDBC 4YL8A 2Y8FA 1DDWA 1W1GA 5GOWB 4GMXB 4HB3B 1ZSQA 1GG3A 2CODA 3KSYA 4EMOA 1X86A 4KHAA 1W1HA 4DBBA 2X18A 4KHBB 1EAZA 3HW2B 2GJYA 2IYBA 5M4YB 2YVCA 2MDXA 3T06A 3FM8C 4F7HA 1MK9B 4KVGB 4GOUA 4P7IA 2K49A 4DX90 3RCPA 3HIEA 4KHBA 1OY2A 4PQ0A 3A58A 2ROVA 2Z59A 1FHOA 3PVLA 1FHWA 3A8PA 5DI9B 2NZ8B 4A6FB 2Y8GA 2VRWB 4HB4B 1B55A 1E5WA 4IFSA 1UEFA 3ML4A 2G35A 1NTVA 3M1IB 5C79A 5C5BA 2J0MA 3PZDA 2YSZA 5KCVA 5D3XA 2J0JA 3UZTA 2ROZB 1FHXA 4NSWA 2I5CA 3GYOA 1KI1B 4BBKA 2VKIA 2DLWA 1V5MA 1MKEA 1U5DA 1TXDA 3AU5A 4WVFB 2RRFA 1FGYA 4KHOA 2XQNM 1XKEA 1MIZB 3BINA 1UNQA 1BWNA 3GYPA 2W2WA 1FB8A 1N3HA 1UPQA 2P0DA 3OHMB 2K8EA 2P8VA 3SNHA 1OMWA 3TO1A 2RGNB 1NTYA 1K5GB 1NU2A 1P3RA 3ODOA 2KIGA 2LOZA 4EJNA 3QBVB 4ZRJA 2Z14A 2FJLA 2K2UA 5DIFB 1PLSA 2EMSA 3TW1A 4H8SA 3NSUA 4QXAB 2D9ZA 1GC6A 1XODA 2KUPA 4OSNA 4A6HA 1KZ7A 3U8ZA 2N23A 2CRFA 2YS5A 4HB0B 2AL6A 3MPXA 2ELBA 5JHGA 3DXCA 4GN1A 2DA0A 1Y19B 3TFMA 3ULBA 2OTXA 2H7EA 1EVHA 2RLOA 1WJ1A 5HE2A 2UVMA 2M14A 1V5UA 2ELAA 3VIAA 3DXEA 2GCJA 2MFQA 2RNRB 1V61A 3TCAA 1H10A 4GNKB 1GC7A 4D6WA 4HB2B 2YF0A 2CY4A 2DFKA 3PG7A 2D10A 2COAA 4IOYX 4HAUB 2E2XA 1KZGA 1BAKA 2R09A 3DXDA 1X1GA 2CY5A 4DX8A 2NBVA 4IAPA 2Q13A 2Z4DA 1M7RA 5CLLB 2J0KA 3FSSA 1DDMA 2P0HA 1U5FA 4A5KA 3A98B 3QIJA 4WJ7A 5J3YA 4TYZA 5D27A 2LG1A 3ODXA 2ZKMX 1DYNA 5C5BB 3NWFA 5FI1A 2P0FA 3ZVRA 4CSQA 3HSAA 2D4QA 1MAIA 5J3QA 3CXBB 3V5WA 1BTKA 2Y7BA 2D11A 1ISNA 4MK0A 2DYQA 4DXAB 4K2PA 3D8FA 2YRYA 1QC6A 4HSIA 2GUMA 1U29A 5I2SA 1X1FA 4PNKA 3HK0A 2JP2A 3AU4A 1X11A 5IRSA 2RSGA 2DN6A 1K5DB 2KCJA 2QKMA 4F7UP 2KGXB 1UNPA 3D8EA 2DYNA 1WVHA 1WGUA 3O96A 2UZSA 1I7AA 1OQNA 1QQGA 3AJ4A 1WGQA 2EMTA 4HAWB 1U2BA 3F0WA 4A6FA 1RJ2A 4YONA 3QWMA 4GZUA 2COCA 5DHAB 1P5TA 5EFXA 3SYXA 4ZRKA 2D2QA 4GMVA 1W1DA 4HAZB 4D0NB 2GCLA 3B77A 3PEGA 3SO6A 1V5PA 1FOEA 5DHFB 1LW3A 2W2XC 4HAVB 2RUKB 1DBHA 2Z13A 3KY9A 3OANA 4CHJA 4Y94A 3PSCA 1MPHA 3NWDA 2FJUB 4F7GA 2QKLA 5I2MA 2HE7A 1T77A 1FAOA 5D3VA 2DKPA 1V88A 3P7ZA 2LYDA 2D9YA 1U5GA 2D9WA 4DIXA 1ZC4B 1SHCA 5JP4A 4HAXB 2VSZA 4MY6A 4CYEA 3SV1A 5J3TA 5JLJB 2PZ1A 4B6HA 5D3WA 3D8DA 3DCXA 3WA0A 3X23A 5C16A 1PMSA 2AEHA 1V89A 2DHKA 2Z0OA 1EGXA 3NWAA 3PVWA 3SUZA 1XD4A 3N7CA 1SGHA 1NI2A 2I1KA 3PP2A 1MIXA 1J0WA 1WI1A 2YS1A 1TQZA 2V76A 3KZ1A 1IRSA 4XWXA 2LKOA 2YT0A 4K2OA 1EF1A 2CAYA 1ZM0A 1ZYIA 5LG4B 3LJUX 1XX0A 2DTCA 2J59M 3CIKA 4L1RA 1FGZA 2LOXA 1XCGA 1Z87A 3ZDTA 2W2XD 1AQCA 2K00A 2GS0A 5LOPB 2BCJA 2L1CA 5HE3A 5L81A 3U7DA 1LB1A 4GXBA 4QJ3B 3BJIA 3FVCA 4K81A 4A6KA 1I2HA 3ODWA 5FI0A 2Z0QA 2DX5A 3G9WA 2NMBA 4C0AA 1RRPB 3FEHA 4NY0A 1DDVA 3TVVA 1U27A 2YT1A 4HHVA 2Z0PA 4KAXB 2K2JA 5D3YA 4HDQA 4TKNA 5DH9B 2DKQA 1UPRA 1X05A 1WG7A 1UNRA 2YT2A 2H7DA 4MT7A
chains in the Genus database with same CATH topology
2ZPYA 1Q67A 4GPTB 1P6SA 2I5FA 4HATB 5KQ1A 4ZRIA 2N0YA 4K17A 1J19A 5KQ4A 2ADZA 2D9VA 3ULCA 5C6RA 4EKUA 4HDOA 1AWEA 2LULA 2MWNB 2IFSA 5HE1A 2MKRA 1DROA 1TJ6A 3HQCA 1U5EA 3F5RA 2OQBA 2EJ8A 2YS3A 1Y5OA 3PVUA 2HTHB 1ZVRA 1H4RA 2I1JA 2DHIA 5JHHA 1BTNA 1WJMA 5HE0A 3A8QA 1PFJA 1ZC3B 3P6AA 4CHMA 2DHJA 3IVFA 3KRWA 3VOQA 2RVBB 2UZRA 4L6EA 2D9XA 5CLQB 1XR0B 2DX1A 2COFA 2EC1A 4HAYB 1M7EA 3WYFB 5LONB 2M38A 3KRXA 1MK7B 2L2IA 4Z2MB 4WSFA 2R0DA 4Z2NA 3MDBC 4YL8A 2Y8FA 1DDWA 1W1GA 5GOWB 4GMXB 4HB3B 1ZSQA 1GG3A 2CODA 3KSYA 4EMOA 1X86A 4KHAA 1W1HA 4DBBA 2X18A 4KHBB 1EAZA 3HW2B 2GJYA 2IYBA 2YVCA 2MDXA 3T06A 3FM8C 4F7HA 1MK9B 4KVGB 4P7IA 4DX90 3RCPA 4PQ0A 1OY2A 2ROVA 1FHOA 3PVLA 1FHWA 3A8PA 5DI9B 2NZ8B 4A6FB 2Y8GA 2VRWB 4HB4B 1B55A 1E5WA 4IFSA 1UEFA 3ML4A 2G35A 1NTVA 3M1IB 5C79A 5C5BA 2J0MA 3PZDA 2YSZA 5KCVA 5D3XA 2J0JA 3UZTA 2ROZB 1FHXA 4NSWA 2I5CA 3GYOA 1KI1B 4BBKA 2VKIA 2DLWA 1V5MA 1MKEA 1U5DA 1TXDA 3AU5A 4WVFB 1FGYA 4KHOA 2XQNM 1XKEA 1MIZB 3BINA 1UNQA 1BWNA 3GYPA 2W2WA 1FB8A 1N3HA 1UPQA 2P0DA 2P8VA 3SNHA 1OMWA 3TO1A 2RGNB 1NTYA 1K5GB 1NU2A 1P3RA 3ODOA 2LOZA 4EJNA 3QBVB 4ZRJA 2FJLA 2K2UA 5DIFB 1PLSA 2EMSA 3TW1A 4H8SA 3NSUA 2D9ZA 1GC6A 1XODA 2KUPA 4A6HA 1KZ7A 3U8ZA 2N23A 2CRFA 2YS5A 4HB0B 2AL6A 3MPXA 2ELBA 5JHGA 3DXCA 4GN1A 2DA0A 1Y19B 3TFMA 3ULBA 2OTXA 2H7EA 1EVHA 2RLOA 1WJ1A 5HE2A 2UVMA 2M14A 1V5UA 2ELAA 3VIAA 3DXEA 2GCJA 2MFQA 2RNRB 1V61A 3TCAA 1H10A 1GC7A 4HB2B 2YF0A 2CY4A 2DFKA 3PG7A 2D10A 2COAA 4IOYX 4HAUB 2E2XA 1KZGA 1BAKA 2R09A 3DXDA 1X1GA 2CY5A 4DX8A 4IAPA 2Q13A 1M7RA 5CLLB 2J0KA 3FSSA 1DDMA 2P0HA 1U5FA 4A5KA 3A98B 3QIJA 4WJ7A 5J3YA 4TYZA 5D27A 2LG1A 3ODXA 1DYNA 5C5BB 5FI1A 2P0FA 3ZVRA 2D4QA 1MAIA 5J3QA 3CXBB 3V5WA 1BTKA 2Y7BA 2D11A 1ISNA 4MK0A 2DYQA 4DXAB 4K2PA 3D8FA 2YRYA 1QC6A 1U29A 1X1FA 4PNKA 3HK0A 2JP2A 3AU4A 1X11A 2RSGA 2DN6A 1K5DB 2KCJA 2QKMA 4F7UP 2KGXB 1UNPA 3D8EA 2DYNA 1WVHA 1WGUA 3O96A 2UZSA 1I7AA 1OQNA 1QQGA 3AJ4A 1WGQA 2EMTA 4HAWB 1U2BA 3F0WA 4A6FA 1RJ2A 4YONA 3QWMA 4GZUA 2COCA 5DHAB 1P5TA 5EFXA 3SYXA 4ZRKA 2D2QA 4GMVA 1W1DA 4HAZB 4D0NB 2GCLA 3PEGA 3SO6A 1V5PA 1FOEA 5DHFB 1LW3A 2W2XC 4HAVB 2RUKB 1DBHA 3KY9A 3OANA 4CHJA 4Y94A 3PSCA 1MPHA 4F7GA 2QKLA 2HE7A 1FAOA 5D3VA 2DKPA 1V88A 3P7ZA 2LYDA 2D9YA 1U5GA 2D9WA 1ZC4B 1SHCA 5JP4A 4HAXB 2VSZA 4MY6A 4CYEA 3SV1A 5J3TA 5JLJB 2PZ1A 4B6HA 5D3WA 3D8DA 3X23A 3WA0A 5C16A 1PMSA 2AEHA 1V89A 2DHKA 2Z0OA 1EGXA 3PVWA 3SUZA 1XD4A 3N7CA 1SGHA 1NI2A 2I1KA 3PP2A 1MIXA 1J0WA 1WI1A 2YS1A 1TQZA 2V76A 3KZ1A 1IRSA 4XWXA 2LKOA 2YT0A 4K2OA 1EF1A 2CAYA 1ZM0A 3LJUX 1XX0A 2DTCA 2J59M 3CIKA 1FGZA 2LOXA 1XCGA 1Z87A 3ZDTA 2W2XD 1AQCA 2K00A 2GS0A 5LOPB 2BCJA 2L1CA 5HE3A 5L81A 3U7DA 1LB1A 4GXBA 3BJIA 4K81A 4A6KA 1I2HA 3ODWA 5FI0A 2Z0QA 2DX5A 3G9WA 2NMBA 4C0AA 1RRPB 3FEHA 4NY0A 1DDVA 3TVVA 1U27A 2YT1A 4HHVA 4KAXB 2Z0PA 2K2JA 5D3YA 4HDQA 4TKNA 5DH9B 2DKQA 1UPRA 1X05A 1WG7A 1UNRA 2H7DA 4MT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPY A;  1Q67 A;  4GPT B;  1P6S A;  2I5F A;  4HAT B;  5KQ1 A;  4ZRI A;  2N0Y A;  4K17 A;  1J19 A;  5KQ4 A;  2ADZ A;  2D9V A;  3ULC A;  5C6R A;  4EKU A;  4HDO A;  1AWE A;  2LUL A;  2MWN B;  2IFS A;  5HE1 A;  2MKR A;  1DRO A;  1TJ6 A;  3HQC A;  1U5E A;  3F5R A;  2OQB A;  2EJ8 A;  2YS3 A;  1Y5O A;  3PVU A;  2HTH B;  1ZVR A;  1H4R A;  2I1J A;  2DHI A;  5JHH A;  1BTN A;  1WJM A;  5HE0 A;  3A8Q A;  1PFJ A;  1ZC3 B;  3P6A A;  4CHM A;  2DHJ A;  3IVF A;  3KRW A;  3VOQ A;  2RVB B;  2UZR A;  4L6E A;  2D9X A;  5CLQ B;  1XR0 B;  2DX1 A;  2COF A;  2EC1 A;  4HAY B;  1M7E A;  3WYF B;  5LON B;  2M38 A;  3KRX A;  1MK7 B;  2L2I A;  4Z2M B;  4WSF A;  2R0D A;  4Z2N A;  3MDB C;  4YL8 A;  2Y8F A;  1DDW A;  1W1G A;  5GOW B;  4GMX B;  4HB3 B;  1ZSQ A;  1GG3 A;  2COD A;  3KSY A;  4EMO A;  1X86 A;  4KHA A;  1W1H A;  4DBB A;  2X18 A;  4KHB B;  1EAZ A;  3HW2 B;  2GJY A;  2IYB A;  2YVC A;  2MDX A;  3T06 A;  3FM8 C;  4F7H A;  1MK9 B;  4KVG B;  4P7I A;  4DX9 0;  3RCP A;  4PQ0 A;  1OY2 A;  2ROV A;  1FHO A;  3PVL A;  1FHW A;  3A8P A;  5DI9 B;  2NZ8 B;  4A6F B;  2Y8G A;  2VRW B;  4HB4 B;  1B55 A;  1E5W A;  4IFS A;  1UEF A;  3ML4 A;  2G35 A;  1NTV A;  3M1I B;  5C79 A;  5C5B A;  2J0M A;  3PZD A;  2YSZ A;  5KCV A;  5D3X A;  2J0J A;  3UZT A;  2ROZ B;  1FHX A;  4NSW A;  2I5C A;  3GYO A;  1KI1 B;  4BBK A;  2VKI A;  2DLW A;  1V5M A;  1MKE A;  1U5D A;  1TXD A;  3AU5 A;  4WVF B;  1FGY A;  4KHO A;  2XQN M;  1XKE A;  1MIZ B;  3BIN A;  1UNQ A;  1BWN A;  3GYP A;  2W2W A;  1FB8 A;  1N3H A;  1UPQ A;  2P0D A;  2P8V A;  3SNH A;  1OMW A;  3TO1 A;  2RGN B;  1NTY A;  1K5G B;  1NU2 A;  1P3R A;  3ODO A;  2LOZ A;  4EJN A;  3QBV B;  4ZRJ A;  2FJL A;  2K2U A;  5DIF B;  1PLS A;  2EMS A;  3TW1 A;  4H8S A;  3NSU A;  2D9Z A;  1GC6 A;  1XOD A;  2KUP A;  4A6H A;  1KZ7 A;  3U8Z A;  2N23 A;  2CRF A;  2YS5 A;  4HB0 B;  2AL6 A;  3MPX A;  2ELB A;  5JHG A;  3DXC A;  4GN1 A;  2DA0 A;  1Y19 B;  3TFM A;  3ULB A;  2OTX A;  2H7E A;  1EVH A;  2RLO A;  1WJ1 A;  5HE2 A;  2UVM A;  2M14 A;  1V5U A;  2ELA A;  3VIA A;  3DXE A;  2GCJ A;  2MFQ A;  2RNR B;  1V61 A;  3TCA A;  1H10 A;  1GC7 A;  4HB2 B;  2YF0 A;  2CY4 A;  2DFK A;  3PG7 A;  2D10 A;  2COA A;  4IOY X;  4HAU B;  2E2X A;  1KZG A;  1BAK A;  2R09 A;  3DXD A;  1X1G A;  2CY5 A;  4DX8 A;  4IAP A;  2Q13 A;  1M7R A;  5CLL B;  2J0K A;  3FSS A;  1DDM A;  2P0H A;  1U5F A;  4A5K A;  3A98 B;  3QIJ A;  4WJ7 A;  5J3Y A;  4TYZ A;  5D27 A;  2LG1 A;  3ODX A;  1DYN A;  5C5B B;  5FI1 A;  2P0F A;  3ZVR A;  2D4Q A;  1MAI A;  5J3Q A;  3CXB B;  3V5W A;  1BTK A;  2Y7B A;  2D11 A;  1ISN A;  4MK0 A;  2DYQ A;  4DXA B;  4K2P A;  3D8F A;  2YRY A;  1QC6 A;  1U29 A;  1X1F A;  4PNK A;  3HK0 A;  2JP2 A;  3AU4 A;  1X11 A;  2RSG A;  2DN6 A;  1K5D B;  2KCJ A;  2QKM A;  4F7U P;  2KGX B;  1UNP A;  3D8E A;  2DYN A;  1WVH A;  1WGU A;  3O96 A;  2UZS A;  1I7A A;  1OQN A;  1QQG A;  3AJ4 A;  1WGQ A;  2EMT A;  4HAW B;  1U2B A;  3F0W A;  4A6F A;  1RJ2 A;  4YON A;  3QWM A;  4GZU A;  2COC A;  5DHA B;  1P5T A;  5EFX A;  3SYX A;  4ZRK A;  2D2Q A;  4GMV A;  1W1D A;  4HAZ B;  4D0N B;  2GCL A;  3PEG A;  3SO6 A;  1V5P A;  1FOE A;  5DHF B;  1LW3 A;  2W2X C;  4HAV B;  2RUK B;  1DBH A;  3KY9 A;  3OAN A;  4CHJ A;  4Y94 A;  3PSC A;  1MPH A;  4F7G A;  2QKL A;  2HE7 A;  1FAO A;  5D3V A;  2DKP A;  1V88 A;  3P7Z A;  2LYD A;  2D9Y A;  1U5G A;  2D9W A;  1ZC4 B;  1SHC A;  5JP4 A;  4HAX B;  2VSZ A;  4MY6 A;  4CYE A;  3SV1 A;  5J3T A;  5JLJ B;  2PZ1 A;  4B6H A;  5D3W A;  3D8D A;  3X23 A;  3WA0 A;  5C16 A;  1PMS A;  2AEH A;  1V89 A;  2DHK A;  2Z0O A;  1EGX A;  3PVW A;  3SUZ A;  1XD4 A;  3N7C A;  1SGH A;  1NI2 A;  2I1K A;  3PP2 A;  1MIX A;  1J0W A;  1WI1 A;  2YS1 A;  1TQZ A;  2V76 A;  3KZ1 A;  1IRS A;  4XWX A;  2LKO A;  2YT0 A;  4K2O A;  1EF1 A;  2CAY A;  1ZM0 A;  3LJU X;  1XX0 A;  2DTC A;  2J59 M;  3CIK A;  1FGZ A;  2LOX A;  1XCG A;  1Z87 A;  3ZDT A;  2W2X D;  1AQC A;  2K00 A;  2GS0 A;  5LOP B;  2BCJ A;  2L1C A;  5HE3 A;  5L81 A;  3U7D A;  1LB1 A;  4GXB A;  3BJI A;  4K81 A;  4A6K A;  1I2H A;  3ODW A;  5FI0 A;  2Z0Q A;  2DX5 A;  3G9W A;  2NMB A;  4C0A A;  1RRP B;  3FEH A;  4NY0 A;  1DDV A;  3TVV A;  1U27 A;  2YT1 A;  4HHV A;  4KAX B;  2Z0P A;  2K2J A;  5D3Y A;  4HDQ A;  4TKN A;  5DH9 B;  2DKQ A;  1UPR A;  1X05 A;  1WG7 A;  1UNR A;  2H7D A;  4MT7 A; 
#chains in the Genus database with same CATH topology
 2ZPY A;  1Q67 A;  4GPT B;  1P6S A;  2I5F A;  4HAT B;  2R2Y A;  5KQ1 A;  4ZRI A;  2N0Y A;  4K17 A;  1J19 A;  5KQ4 A;  2ADZ A;  2D9V A;  2KR0 A;  3ULC A;  5C6R A;  4EKU A;  4HDO A;  1MI1 A;  1AWE A;  2LUL A;  2MWN B;  2IFS A;  5HE1 A;  2MKR A;  1DRO A;  1TJ6 A;  3HQC A;  1U5E A;  3F5R A;  2OQB A;  2EJ8 A;  2YS3 A;  3PVU A;  3NW8 A;  1Y5O A;  2HTH B;  1ZVR A;  1H4R A;  2I1J A;  2DHI A;  3U12 A;  5JHH A;  1BTN A;  1WJM A;  5HE0 A;  3A8Q A;  1PFJ A;  1ZC3 B;  4QJ4 B;  2KIE A;  3P6A A;  4CHM A;  2DHJ A;  4OT1 A;  3IVF A;  3KRW A;  3VOQ A;  2RVB B;  2UZR A;  4L6E A;  2D9X A;  5CLQ B;  1XR0 B;  2DX1 A;  2COF A;  2EC1 A;  4HAY B;  1M7E A;  2KUQ A;  3WYF B;  5LON B;  2M38 A;  3KRX A;  1MK7 B;  2L2I A;  4Z2M B;  4WSF A;  2R0D A;  4Z2N A;  4QJ5 B;  3MDB C;  4YL8 A;  2Y8F A;  1DDW A;  1W1G A;  5GOW B;  4GMX B;  4HB3 B;  1ZSQ A;  1GG3 A;  2COD A;  3KSY A;  4EMO A;  1X86 A;  4KHA A;  1W1H A;  4DBB A;  2X18 A;  4KHB B;  1EAZ A;  3HW2 B;  2GJY A;  2IYB A;  5M4Y B;  2YVC A;  2MDX A;  3T06 A;  3FM8 C;  4F7H A;  1MK9 B;  4KVG B;  4GOU A;  4P7I A;  2K49 A;  4DX9 0;  3RCP A;  3HIE A;  4KHB A;  1OY2 A;  4PQ0 A;  3A58 A;  2ROV A;  2Z59 A;  1FHO A;  3PVL A;  1FHW A;  3A8P A;  5DI9 B;  2NZ8 B;  4A6F B;  2Y8G A;  2VRW B;  4HB4 B;  1B55 A;  1E5W A;  4IFS A;  1UEF A;  3ML4 A;  2G35 A;  1NTV A;  3M1I B;  5C79 A;  5C5B A;  2J0M A;  3PZD A;  2YSZ A;  5KCV A;  5D3X A;  2J0J A;  3UZT A;  2ROZ B;  1FHX A;  4NSW A;  2I5C A;  3GYO A;  1KI1 B;  4BBK A;  2VKI A;  2DLW A;  1V5M A;  1MKE A;  1U5D A;  1TXD A;  3AU5 A;  4WVF B;  2RRF A;  1FGY A;  4KHO A;  2XQN M;  1XKE A;  1MIZ B;  3BIN A;  1UNQ A;  1BWN A;  3GYP A;  2W2W A;  1FB8 A;  1N3H A;  1UPQ A;  2P0D A;  3OHM B;  2K8E A;  2P8V A;  3SNH A;  1OMW A;  3TO1 A;  2RGN B;  1NTY A;  1K5G B;  1NU2 A;  1P3R A;  3ODO A;  2KIG A;  2LOZ A;  4EJN A;  3QBV B;  4ZRJ A;  2Z14 A;  2FJL A;  2K2U A;  5DIF B;  1PLS A;  2EMS A;  3TW1 A;  4H8S A;  3NSU A;  4QXA B;  2D9Z A;  1GC6 A;  1XOD A;  2KUP A;  4OSN A;  4A6H A;  1KZ7 A;  3U8Z A;  2N23 A;  2CRF A;  2YS5 A;  4HB0 B;  2AL6 A;  3MPX A;  2ELB A;  5JHG A;  3DXC A;  4GN1 A;  2DA0 A;  1Y19 B;  3TFM A;  3ULB A;  2OTX A;  2H7E A;  1EVH A;  2RLO A;  1WJ1 A;  5HE2 A;  2UVM A;  2M14 A;  1V5U A;  2ELA A;  3VIA A;  3DXE A;  2GCJ A;  2MFQ A;  2RNR B;  1V61 A;  3TCA A;  1H10 A;  4GNK B;  1GC7 A;  4D6W A;  4HB2 B;  2YF0 A;  2CY4 A;  2DFK A;  3PG7 A;  2D10 A;  2COA A;  4IOY X;  4HAU B;  2E2X A;  1KZG A;  1BAK A;  2R09 A;  3DXD A;  1X1G A;  2CY5 A;  4DX8 A;  2NBV A;  4IAP A;  2Q13 A;  2Z4D A;  1M7R A;  5CLL B;  2J0K A;  3FSS A;  1DDM A;  2P0H A;  1U5F A;  4A5K A;  3A98 B;  3QIJ A;  4WJ7 A;  5J3Y A;  4TYZ A;  5D27 A;  2LG1 A;  3ODX A;  2ZKM X;  1DYN A;  5C5B B;  3NWF A;  5FI1 A;  2P0F A;  3ZVR A;  4CSQ A;  3HSA A;  2D4Q A;  1MAI A;  5J3Q A;  3CXB B;  3V5W A;  1BTK A;  2Y7B A;  2D11 A;  1ISN A;  4MK0 A;  2DYQ A;  4DXA B;  4K2P A;  3D8F A;  2YRY A;  1QC6 A;  4HSI A;  2GUM A;  1U29 A;  5I2S A;  1X1F A;  4PNK A;  3HK0 A;  2JP2 A;  3AU4 A;  1X11 A;  5IRS A;  2RSG A;  2DN6 A;  1K5D B;  2KCJ A;  2QKM A;  4F7U P;  2KGX B;  1UNP A;  3D8E A;  2DYN A;  1WVH A;  1WGU A;  3O96 A;  2UZS A;  1I7A A;  1OQN A;  1QQG A;  3AJ4 A;  1WGQ A;  2EMT A;  4HAW B;  1U2B A;  3F0W A;  4A6F A;  1RJ2 A;  4YON A;  3QWM A;  4GZU A;  2COC A;  5DHA B;  1P5T A;  5EFX A;  3SYX A;  4ZRK A;  2D2Q A;  4GMV A;  1W1D A;  4HAZ B;  4D0N B;  2GCL A;  3B77 A;  3PEG A;  3SO6 A;  1V5P A;  1FOE A;  5DHF B;  1LW3 A;  2W2X C;  4HAV B;  2RUK B;  1DBH A;  2Z13 A;  3KY9 A;  3OAN A;  4CHJ A;  4Y94 A;  3PSC A;  1MPH A;  3NWD A;  2FJU B;  4F7G A;  2QKL A;  5I2M A;  2HE7 A;  1T77 A;  1FAO A;  5D3V A;  2DKP A;  1V88 A;  3P7Z A;  2LYD A;  2D9Y A;  1U5G A;  2D9W A;  4DIX A;  1ZC4 B;  1SHC A;  5JP4 A;  4HAX B;  2VSZ A;  4MY6 A;  4CYE A;  3SV1 A;  5J3T A;  5JLJ B;  2PZ1 A;  4B6H A;  5D3W A;  3D8D A;  3DCX A;  3WA0 A;  3X23 A;  5C16 A;  1PMS A;  2AEH A;  1V89 A;  2DHK A;  2Z0O A;  1EGX A;  3NWA A;  3PVW A;  3SUZ A;  1XD4 A;  3N7C A;  1SGH A;  1NI2 A;  2I1K A;  3PP2 A;  1MIX A;  1J0W A;  1WI1 A;  2YS1 A;  1TQZ A;  2V76 A;  3KZ1 A;  1IRS A;  4XWX A;  2LKO A;  2YT0 A;  4K2O A;  1EF1 A;  2CAY A;  1ZM0 A;  1ZYI A;  5LG4 B;  3LJU X;  1XX0 A;  2DTC A;  2J59 M;  3CIK A;  4L1R A;  1FGZ A;  2LOX A;  1XCG A;  1Z87 A;  3ZDT A;  2W2X D;  1AQC A;  2K00 A;  2GS0 A;  5LOP B;  2BCJ A;  2L1C A;  5HE3 A;  5L81 A;  3U7D A;  1LB1 A;  4GXB A;  4QJ3 B;  3BJI A;  3FVC A;  4K81 A;  4A6K A;  1I2H A;  3ODW A;  5FI0 A;  2Z0Q A;  2DX5 A;  3G9W A;  2NMB A;  4C0A A;  1RRP B;  3FEH A;  4NY0 A;  1DDV A;  3TVV A;  1U27 A;  2YT1 A;  4HHV A;  2Z0P A;  4KAX B;  2K2J A;  5D3Y A;  4HDQ A;  4TKN A;  5DH9 B;  2DKQ A;  1UPR A;  1X05 A;  1WG7 A;  1UNR A;  2YT2 A;  2H7D A;  4MT7 A; 
#chains in the Genus database with same CATH homology
 2ZPY A;  1Q67 A;  4GPT B;  1P6S A;  2I5F A;  4HAT B;  5KQ1 A;  4ZRI A;  2N0Y A;  4K17 A;  1J19 A;  5KQ4 A;  2ADZ A;  2D9V A;  3ULC A;  5C6R A;  4EKU A;  4HDO A;  1AWE A;  2LUL A;  2MWN B;  2IFS A;  5HE1 A;  2MKR A;  1DRO A;  1TJ6 A;  3HQC A;  1U5E A;  3F5R A;  2OQB A;  2EJ8 A;  2YS3 A;  1Y5O A;  3PVU A;  2HTH B;  1ZVR A;  1H4R A;  2I1J A;  2DHI A;  5JHH A;  1BTN A;  1WJM A;  5HE0 A;  3A8Q A;  1PFJ A;  1ZC3 B;  3P6A A;  4CHM A;  2DHJ A;  3IVF A;  3KRW A;  3VOQ A;  2RVB B;  2UZR A;  4L6E A;  2D9X A;  5CLQ B;  1XR0 B;  2DX1 A;  2COF A;  2EC1 A;  4HAY B;  1M7E A;  3WYF B;  5LON B;  2M38 A;  3KRX A;  1MK7 B;  2L2I A;  4Z2M B;  4WSF A;  2R0D A;  4Z2N A;  3MDB C;  4YL8 A;  2Y8F A;  1DDW A;  1W1G A;  5GOW B;  4GMX B;  4HB3 B;  1ZSQ A;  1GG3 A;  2COD A;  3KSY A;  4EMO A;  1X86 A;  4KHA A;  1W1H A;  4DBB A;  2X18 A;  4KHB B;  1EAZ A;  3HW2 B;  2GJY A;  2IYB A;  2YVC A;  2MDX A;  3T06 A;  3FM8 C;  4F7H A;  1MK9 B;  4KVG B;  4P7I A;  4DX9 0;  3RCP A;  4PQ0 A;  1OY2 A;  2ROV A;  1FHO A;  3PVL A;  1FHW A;  3A8P A;  5DI9 B;  2NZ8 B;  4A6F B;  2Y8G A;  2VRW B;  4HB4 B;  1B55 A;  1E5W A;  4IFS A;  1UEF A;  3ML4 A;  2G35 A;  1NTV A;  3M1I B;  5C79 A;  5C5B A;  2J0M A;  3PZD A;  2YSZ A;  5KCV A;  5D3X A;  2J0J A;  3UZT A;  2ROZ B;  1FHX A;  4NSW A;  2I5C A;  3GYO A;  1KI1 B;  4BBK A;  2VKI A;  2DLW A;  1V5M A;  1MKE A;  1U5D A;  1TXD A;  3AU5 A;  4WVF B;  1FGY A;  4KHO A;  2XQN M;  1XKE A;  1MIZ B;  3BIN A;  1UNQ A;  1BWN A;  3GYP A;  2W2W A;  1FB8 A;  1N3H A;  1UPQ A;  2P0D A;  2P8V A;  3SNH A;  1OMW A;  3TO1 A;  2RGN B;  1NTY A;  1K5G B;  1NU2 A;  1P3R A;  3ODO A;  2LOZ A;  4EJN A;  3QBV B;  4ZRJ A;  2FJL A;  2K2U A;  5DIF B;  1PLS A;  2EMS A;  3TW1 A;  4H8S A;  3NSU A;  2D9Z A;  1GC6 A;  1XOD A;  2KUP A;  4A6H A;  1KZ7 A;  3U8Z A;  2N23 A;  2CRF A;  2YS5 A;  4HB0 B;  2AL6 A;  3MPX A;  2ELB A;  5JHG A;  3DXC A;  4GN1 A;  2DA0 A;  1Y19 B;  3TFM A;  3ULB A;  2OTX A;  2H7E A;  1EVH A;  2RLO A;  1WJ1 A;  5HE2 A;  2UVM A;  2M14 A;  1V5U A;  2ELA A;  3VIA A;  3DXE A;  2GCJ A;  2MFQ A;  2RNR B;  1V61 A;  3TCA A;  1H10 A;  1GC7 A;  4HB2 B;  2YF0 A;  2CY4 A;  2DFK A;  3PG7 A;  2D10 A;  2COA A;  4IOY X;  4HAU B;  2E2X A;  1KZG A;  1BAK A;  2R09 A;  3DXD A;  1X1G A;  2CY5 A;  4DX8 A;  4IAP A;  2Q13 A;  1M7R A;  5CLL B;  2J0K A;  3FSS A;  1DDM A;  2P0H A;  1U5F A;  4A5K A;  3A98 B;  3QIJ A;  4WJ7 A;  5J3Y A;  4TYZ A;  5D27 A;  2LG1 A;  3ODX A;  1DYN A;  5C5B B;  5FI1 A;  2P0F A;  3ZVR A;  2D4Q A;  1MAI A;  5J3Q A;  3CXB B;  3V5W A;  1BTK A;  2Y7B A;  2D11 A;  1ISN A;  4MK0 A;  2DYQ A;  4DXA B;  4K2P A;  3D8F A;  2YRY A;  1QC6 A;  1U29 A;  1X1F A;  4PNK A;  3HK0 A;  2JP2 A;  3AU4 A;  1X11 A;  2RSG A;  2DN6 A;  1K5D B;  2KCJ A;  2QKM A;  4F7U P;  2KGX B;  1UNP A;  3D8E A;  2DYN A;  1WVH A;  1WGU A;  3O96 A;  2UZS A;  1I7A A;  1OQN A;  1QQG A;  3AJ4 A;  1WGQ A;  2EMT A;  4HAW B;  1U2B A;  3F0W A;  4A6F A;  1RJ2 A;  4YON A;  3QWM A;  4GZU A;  2COC A;  5DHA B;  1P5T A;  5EFX A;  3SYX A;  4ZRK A;  2D2Q A;  4GMV A;  1W1D A;  4HAZ B;  4D0N B;  2GCL A;  3PEG A;  3SO6 A;  1V5P A;  1FOE A;  5DHF B;  1LW3 A;  2W2X C;  4HAV B;  2RUK B;  1DBH A;  3KY9 A;  3OAN A;  4CHJ A;  4Y94 A;  3PSC A;  1MPH A;  4F7G A;  2QKL A;  2HE7 A;  1FAO A;  5D3V A;  2DKP A;  1V88 A;  3P7Z A;  2LYD A;  2D9Y A;  1U5G A;  2D9W A;  1ZC4 B;  1SHC A;  5JP4 A;  4HAX B;  2VSZ A;  4MY6 A;  4CYE A;  3SV1 A;  5J3T A;  5JLJ B;  2PZ1 A;  4B6H A;  5D3W A;  3D8D A;  3X23 A;  3WA0 A;  5C16 A;  1PMS A;  2AEH A;  1V89 A;  2DHK A;  2Z0O A;  1EGX A;  3PVW A;  3SUZ A;  1XD4 A;  3N7C A;  1SGH A;  1NI2 A;  2I1K A;  3PP2 A;  1MIX A;  1J0W A;  1WI1 A;  2YS1 A;  1TQZ A;  2V76 A;  3KZ1 A;  1IRS A;  4XWX A;  2LKO A;  2YT0 A;  4K2O A;  1EF1 A;  2CAY A;  1ZM0 A;  3LJU X;  1XX0 A;  2DTC A;  2J59 M;  3CIK A;  1FGZ A;  2LOX A;  1XCG A;  1Z87 A;  3ZDT A;  2W2X D;  1AQC A;  2K00 A;  2GS0 A;  5LOP B;  2BCJ A;  2L1C A;  5HE3 A;  5L81 A;  3U7D A;  1LB1 A;  4GXB A;  3BJI A;  4K81 A;  4A6K A;  1I2H A;  3ODW A;  5FI0 A;  2Z0Q A;  2DX5 A;  3G9W A;  2NMB A;  4C0A A;  1RRP B;  3FEH A;  4NY0 A;  1DDV A;  3TVV A;  1U27 A;  2YT1 A;  4HHV A;  4KAX B;  2Z0P A;  2K2J A;  5D3Y A;  4HDQ A;  4TKN A;  5DH9 B;  2DKQ A;  1UPR A;  1X05 A;  1WG7 A;  1UNR A;  2H7D A;  4MT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...