2DA0A

Solution structure of the ph domain of pip2-dependent arf1 gtpase-activating protein from human
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSSGSSGYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALTMAFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1
publication title Solution structure of the PH domain of PIP2-dependent ARF1 GTPase-activating protein from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2da0A00
4DBBA 4HAXB 1KI1B 5HE1A 2D9YA 5DIFB 2IFSA 2YS5A 2L1CA 3WYFB 1NTVA 4F7UP 4HB2B 4GN1A 1AQCA 1WJ1A 1XODA 2VKIA 3SV1A 1DYNA 2D10A 4H8SA 1MIZB 1N3HA 4MK0A 3GYPA 4K17A 1I2HA 1X11A 5KCVA 3D8EA 4PQ0A 3HK0A 3PZDA 5HE2A 2DYNA 1BTKA 3CIKA 3T06A 4WJ7A 4Y94A 2YVCA 2EMTA 2K2UA 2K2JA 1U2BA 1P5TA 1M7RA 2M14A 4WSFA 5KQ1A 2COAA 1GC7A 2IYBA 3FEHA 2ZPYA 4HB0B 5JLJB 5LONB 2H7DA 2W2WA 1W1HA 2KUPA 3ODWA 1MKEA 1TQZA 2NMBA 1Y19B 3QWMA 1OQNA 2N23A 4KHOA 3ZDTA 1H10A 3F5RA 1UPQA 5JHGA 4HDQA 3KRWA 2DA0A 1DROA 3N7CA 5HE3A 2D9ZA 3M1IB 2P0FA 3UZTA 1FHXA 4YONA 3OANA 4HATB 2GCJA 3VOQA 2YRYA 1ZM0A 2MDXA 1NI2A 3KZ1A 2Q13A 2RNRB 1RJ2A 4XWXA 3KY9A 2AL6A 3SUZA 1E5WA 4MT7A 4A6FA 1ZVRA 4C0AA 4GMVA 3DXEA 2LULA 4CHJA 3ODXA 1V89A 2DX5A 2DHKA 2DN6A 1X05A 4MY6A 1QC6A 1MIXA 3TO1A 3D8FA 2CRFA 3QBVB 4KHAA 1Z87A 4ZRKA 2LOZA 3AU5A 4DX90 3A8QA 5FI0A 4NY0A 4IAPA 2M38A 1SGHA 2DKPA 5HE0A 1K5DB 5DHAB 2W2XD 2FJLA 3DXDA 5DHFB 4KAXB 2QKMA 2W2XC 1FGZA 5D27A 2I1JA 5DH9B 3AU4A 4HB3B 3P6AA 2ELBA 5C5BA 2ROZB 2I5FA 1X1GA 5D3VA 1ZC4B 4GZUA 2D4QA 3U8ZA 2LG1A 2X18A 5JHHA 4PNKA 2VRWB 2DTCA 2P0HA 1IRSA 1MK9B 1U27A 1QQGA 1XX0A 2KCJA 3DXCA 4ZRJA 3PP2A 2KGXB 5C79A 2DLWA 3SO6A 3IVFA 1V5MA 2V76A 3P7ZA 4HHVA 3A8PA 3FSSA 1FHOA 1K5GB 2UVMA 3A98B 2OQBA 1SHCA 1KZGA 3FM8C 2GCLA 3D8DA 3PVWA 4HAUB 2D11A 2R09A 2DX1A 4HAWB 3ULCA 1LW3A 2JP2A 1V5UA 4L6EA 2MFQA 2NZ8B 5J3TA 4HDOA 4A6HA 1TJ6A 4A6KA 3PVLA 1M7EA 4A6FB 2EJ8A 5CLQB 1J19A 1FGYA 5J3QA 2DFKA 4GXBA 1WVHA 4F7HA 4WVFB 1MAIA 2ADZA 2RGNB 5GOWB 5CLLB 1XR0B 4DXAB 1X1FA 1P6SA 2DKQA 4TYZA 1ISNA 3MDBC 1XKEA 3SNHA 2EMSA 2CAYA 1EVHA 3U7DA 2CY5A 4CYEA 2HTHB 1FB8A 1NU2A 4B6HA 1ZSQA 2L2IA 1Y5OA 3X23A 2BCJA 1ZC3B 3G9WA 4YL8A 5C5BB 4GPTB 1XD4A 1Q67A 4K2PA 2XQNM 2DHJA 4HAYB 1V61A 2LYDA 1WGUA 2GS0A 3TW1A 2OTXA 1J0WA 1H4RA 1BTNA 5J3YA 3BJIA 4GMXB 3TFMA 1U5EA 1WI1A 2P0DA 1WG7A 2LKOA 3PEGA 1OY2A 4K2OA 2D9XA 3PSCA 5JP4A 4IFSA 3LJUX 1LB1A 2J0KA 4P7IA 1UNQA 3F0WA 4EKUA 1GG3A 1FOEA 1UNPA 4HAZB 2Z0OA 3KRXA 5C6RA 1PMSA 1KZ7A 2HE7A 1EGXA 1OMWA 2N0YA 5LOPB 2Y8FA 4F7GA 5C16A 1W1DA 1DDMA 3BINA 1P3RA 3HQCA 3CXBB 4BBKA 2UZRA 2YS1A 2Y8GA 4ZRIA 1U5DA 3PG7A 4K81A 1DDWA 2RLOA 2E2XA 2D9WA 3TVVA 5KQ4A 4DX8A 5FI1A 2D2QA 2YSZA 3SYXA 3ODOA 3NSUA 2CY4A 2EC1A 4A5KA 5DI9B 2GJYA 1UEFA 2RUKB 3WA0A 2RVBB 5D3YA 3TCAA 1XCGA 1MPHA 1DDVA 5D3WA 1UNRA 1AWEA 4D0NB 2Z0PA 4KVGB 1PLSA 5L81A 2I1KA 2J0MA 2PZ1A 1BWNA 1X86A 1UPRA 2Y7BA 1FAOA 4KHBB 2J0JA 2YT1A 2COFA 1MK7B 2G35A 3VIAA 2ELAA 3ZVRA 2RSGA 2YF0A 4Z2MB 4CHMA 2H7EA 3AJ4A 3RCPA 1B55A 1I7AA 2I5CA 4NSWA 1V5PA 1FHWA 3ML4A 1PFJA 3V5WA 4TKNA 2MKRA 1EF1A 3QIJA 1U5GA 4EMOA 2DHIA 1BAKA 2CODA 1WGQA 2YT0A 3HW2B 3GYOA 1U29A 1V88A 2Z0QA 3KSYA 1WJMA 1TXDA 1DBHA 3ULBA 2UZSA 2D9VA 5D3XA 4Z2NA 4EJNA 4HAVB 2VSZA 4HB4B 1GC6A 3MPXA 3PVUA 3O96A 1U5FA 1NTYA 1W1GA 2YS3A 2QKLA 2LOXA 2P8VA 2R0DA 1RRPB 2DYQA 4IOYX 2MWNB 5EFXA 2COCA 2J59M 2ROVA 2AEHA 1EAZA 2K00A
chains in the Genus database with same CATH superfamily
4DBBA 4HAXB 1KI1B 5HE1A 2D9YA 5DIFB 2IFSA 2YS5A 2L1CA 3WYFB 1NTVA 4F7UP 4HB2B 4GN1A 1AQCA 4OSNA 1ZYIA 1WJ1A 1XODA 2VKIA 3SV1A 1DYNA 2D10A 4QJ3B 4H8SA 1MIZB 1N3HA 4MK0A 3GYPA 4K17A 1I2HA 1X11A 5KCVA 3D8EA 4PQ0A 3HK0A 3PZDA 5HE2A 2DYNA 1BTKA 3CIKA 3T06A 4WJ7A 4Y94A 2YVCA 2EMTA 2K2UA 2K2JA 1U2BA 1P5TA 1M7RA 2M14A 4WSFA 5KQ1A 2COAA 4D6WA 1GC7A 2IYBA 3FEHA 2ZPYA 4HB0B 5JLJB 5LONB 2H7DA 2W2WA 1W1HA 2KUPA 3ODWA 1MKEA 1TQZA 2NMBA 1Y19B 3QWMA 1OQNA 2N23A 4KHOA 3ZDTA 1H10A 3F5RA 1UPQA 5JHGA 4HDQA 3KRWA 2DA0A 1DROA 3FVCA 3N7CA 5HE3A 2D9ZA 3M1IB 2P0FA 3UZTA 1FHXA 4YONA 3OANA 4HATB 2GCJA 3VOQA 2YRYA 1ZM0A 2MDXA 1NI2A 3KZ1A 2Q13A 2RNRB 3NW8A 1RJ2A 4XWXA 3KY9A 2AL6A 3SUZA 1E5WA 4MT7A 4QXAB 4A6FA 1ZVRA 4C0AA 4GMVA 3DXEA 2LULA 4CHJA 3ODXA 1V89A 2DX5A 2DHKA 2DN6A 1X05A 3OHMB 5I2MA 4MY6A 2Z4DA 1QC6A 1MIXA 3TO1A 3D8FA 2CRFA 3QBVB 4KHAA 1Z87A 4ZRKA 2LOZA 3AU5A 4DX90 3A8QA 5FI0A 4CSQA 4NY0A 4IAPA 2M38A 1SGHA 2DKPA 3DCXA 5HE0A 1K5DB 5DHAB 2W2XD 2FJLA 3DXDA 4HSIA 5DHFB 4KAXB 2QKMA 2W2XC 1FGZA 5D27A 2I1JA 5DH9B 3AU4A 4HB3B 3P6AA 2ELBA 5C5BA 2ROZB 2I5FA 1X1GA 5D3VA 1ZC4B 5LG4B 3B77A 4GZUA 4QJ5B 2D4QA 3U8ZA 2LG1A 2X18A 5JHHA 2KUQA 4GNKB 4PNKA 2VRWB 3HIEA 2DTCA 2FJUB 2P0HA 5M4YB 1IRSA 1MK9B 1U27A 2ZKMX 1QQGA 1XX0A 2KCJA 3DXCA 4ZRJA 3PP2A 2KGXB 5C79A 2DLWA 3SO6A 3IVFA 1V5MA 2V76A 3P7ZA 4HHVA 3A8PA 3FSSA 1FHOA 1K5GB 2UVMA 3A98B 2OQBA 1SHCA 1KZGA 3FM8C 2GCLA 3D8DA 3PVWA 4HAUB 2D11A 2R09A 2DX1A 4HAWB 2R2YA 3ULCA 1LW3A 2JP2A 1V5UA 4L6EA 2MFQA 2NZ8B 5J3TA 4HDOA 4A6HA 1TJ6A 4GOUA 4A6KA 3PVLA 5IRSA 1M7EA 4A6FB 2EJ8A 5CLQB 1J19A 1FGYA 4DIXA 5J3QA 2DFKA 4GXBA 1WVHA 4F7HA 4WVFB 1MAIA 2KIEA 2ADZA 2RGNB 5GOWB 5CLLB 3NWAA 1XR0B 4DXAB 1X1FA 1P6SA 2DKQA 4TYZA 2RRFA 1ISNA 3MDBC 1XKEA 3SNHA 2EMSA 2CAYA 1EVHA 3U7DA 2CY5A 2NBVA 4CYEA 2HTHB 1FB8A 1NU2A 4B6HA 4KHBA 1ZSQA 2Z13A 2L2IA 1Y5OA 1T77A 3X23A 2BCJA 1ZC3B 3G9WA 4YL8A 5C5BB 4GPTB 1XD4A 1Q67A 4K2PA 2XQNM 2DHJA 4HAYB 1V61A 2LYDA 1WGUA 2GS0A 3TW1A 2OTXA 1J0WA 1H4RA 1BTNA 5J3YA 3BJIA 2KR0A 4GMXB 2YT2A 3TFMA 1U5EA 1WI1A 2P0DA 1WG7A 2LKOA 3PEGA 1OY2A 4K2OA 2D9XA 3PSCA 5JP4A 4IFSA 3LJUX 1LB1A 2J0KA 4P7IA 1UNQA 3F0WA 4EKUA 1GG3A 1FOEA 1UNPA 4HAZB 2Z0OA 2K8EA 3KRXA 5C6RA 1PMSA 1KZ7A 2HE7A 1EGXA 1OMWA 2N0YA 5LOPB 2Y8FA 4F7GA 5C16A 3NWDA 1W1DA 1DDMA 3BINA 1P3RA 3HQCA 3CXBB 4BBKA 2UZRA 2YS1A 2Y8GA 4ZRIA 2Z59A 1U5DA 3PG7A 4K81A 1DDWA 2RLOA 2E2XA 2D9WA 3TVVA 5KQ4A 4DX8A 5FI1A 2D2QA 2YSZA 3SYXA 3HSAA 3ODOA 3NSUA 2CY4A 2EC1A 4A5KA 5DI9B 2GJYA 1UEFA 2RUKB 3WA0A 2RVBB 5D3YA 3TCAA 1XCGA 1MPHA 1DDVA 5D3WA 1UNRA 1AWEA 2Z14A 4D0NB 2Z0PA 4KVGB 1PLSA 5L81A 2I1KA 2J0MA 2PZ1A 1BWNA 1X86A 4L1RA 2GUMA 1UPRA 1MI1A 2Y7BA 1FAOA 4KHBB 2J0JA 2YT1A 4QJ4B 2COFA 1MK7B 2G35A 3VIAA 2ELAA 3ZVRA 3U12A 2RSGA 2YF0A 4Z2MB 4CHMA 2H7EA 3AJ4A 3RCPA 1B55A 1I7AA 2I5CA 4NSWA 1V5PA 2KIGA 1FHWA 3ML4A 1PFJA 3V5WA 4TKNA 2MKRA 1EF1A 3QIJA 1U5GA 4EMOA 2DHIA 1BAKA 2CODA 1WGQA 2YT0A 3NWFA 3HW2B 3GYOA 4OT1A 1U29A 1V88A 2Z0QA 3KSYA 1WJMA 1TXDA 1DBHA 3ULBA 2UZSA 2D9VA 5D3XA 4Z2NA 4EJNA 4HAVB 2VSZA 4HB4B 1GC6A 3MPXA 3PVUA 3O96A 1U5FA 1NTYA 1W1GA 2YS3A 3A58A 2QKLA 2K49A 2LOXA 2P8VA 2R0DA 1RRPB 2DYQA 4IOYX 2MWNB 5EFXA 2COCA 2J59M 2ROVA 2AEHA 1EAZA 2K00A 5I2SA
chains in the Genus database with same CATH topology
4DBBA 4HAXB 1KI1B 5HE1A 2D9YA 5DIFB 2IFSA 2YS5A 2L1CA 3WYFB 1NTVA 4F7UP 4HB2B 4GN1A 1AQCA 1WJ1A 1XODA 2VKIA 3SV1A 1DYNA 2D10A 4H8SA 1MIZB 1N3HA 4MK0A 3GYPA 4K17A 1I2HA 1X11A 5KCVA 3D8EA 4PQ0A 3HK0A 3PZDA 5HE2A 2DYNA 1BTKA 3CIKA 3T06A 4WJ7A 4Y94A 2YVCA 2EMTA 2K2UA 2K2JA 1U2BA 1P5TA 1M7RA 2M14A 4WSFA 5KQ1A 2COAA 1GC7A 2IYBA 3FEHA 2ZPYA 4HB0B 5JLJB 5LONB 2H7DA 2W2WA 1W1HA 2KUPA 3ODWA 1MKEA 1TQZA 2NMBA 1Y19B 3QWMA 1OQNA 2N23A 4KHOA 3ZDTA 1H10A 3F5RA 1UPQA 5JHGA 4HDQA 3KRWA 2DA0A 1DROA 3N7CA 5HE3A 2D9ZA 3M1IB 2P0FA 3UZTA 1FHXA 4YONA 3OANA 4HATB 2GCJA 3VOQA 2YRYA 1ZM0A 2MDXA 1NI2A 3KZ1A 2Q13A 2RNRB 1RJ2A 4XWXA 3KY9A 2AL6A 3SUZA 1E5WA 4MT7A 4A6FA 1ZVRA 4C0AA 4GMVA 3DXEA 2LULA 4CHJA 3ODXA 1V89A 2DX5A 2DHKA 2DN6A 1X05A 4MY6A 1QC6A 1MIXA 3TO1A 3D8FA 2CRFA 3QBVB 4KHAA 1Z87A 4ZRKA 2LOZA 3AU5A 4DX90 3A8QA 5FI0A 4NY0A 4IAPA 2M38A 1SGHA 2DKPA 5HE0A 1K5DB 5DHAB 2W2XD 2FJLA 3DXDA 5DHFB 4KAXB 2QKMA 2W2XC 1FGZA 5D27A 2I1JA 5DH9B 3AU4A 4HB3B 3P6AA 2ELBA 5C5BA 2ROZB 2I5FA 1X1GA 5D3VA 1ZC4B 4GZUA 2D4QA 3U8ZA 2LG1A 2X18A 5JHHA 4PNKA 2VRWB 2DTCA 2P0HA 1IRSA 1MK9B 1U27A 1QQGA 1XX0A 2KCJA 3DXCA 4ZRJA 3PP2A 2KGXB 5C79A 2DLWA 3SO6A 3IVFA 1V5MA 2V76A 3P7ZA 4HHVA 3A8PA 3FSSA 1FHOA 1K5GB 2UVMA 3A98B 2OQBA 1SHCA 1KZGA 3FM8C 2GCLA 3D8DA 3PVWA 4HAUB 2D11A 2R09A 2DX1A 4HAWB 3ULCA 1LW3A 2JP2A 1V5UA 4L6EA 2MFQA 2NZ8B 5J3TA 4HDOA 4A6HA 1TJ6A 4A6KA 3PVLA 1M7EA 4A6FB 2EJ8A 5CLQB 1J19A 1FGYA 5J3QA 2DFKA 4GXBA 1WVHA 4F7HA 4WVFB 1MAIA 2ADZA 2RGNB 5GOWB 5CLLB 1XR0B 4DXAB 1X1FA 1P6SA 2DKQA 4TYZA 1ISNA 3MDBC 1XKEA 3SNHA 2EMSA 2CAYA 1EVHA 3U7DA 2CY5A 4CYEA 2HTHB 1FB8A 1NU2A 4B6HA 1ZSQA 2L2IA 1Y5OA 3X23A 2BCJA 1ZC3B 3G9WA 4YL8A 5C5BB 4GPTB 1XD4A 1Q67A 4K2PA 2XQNM 2DHJA 4HAYB 1V61A 2LYDA 1WGUA 2GS0A 3TW1A 2OTXA 1J0WA 1H4RA 1BTNA 5J3YA 3BJIA 4GMXB 3TFMA 1U5EA 1WI1A 2P0DA 1WG7A 2LKOA 3PEGA 1OY2A 4K2OA 2D9XA 3PSCA 5JP4A 4IFSA 3LJUX 1LB1A 2J0KA 4P7IA 1UNQA 3F0WA 4EKUA 1GG3A 1FOEA 1UNPA 4HAZB 2Z0OA 3KRXA 5C6RA 1PMSA 1KZ7A 2HE7A 1EGXA 1OMWA 2N0YA 5LOPB 2Y8FA 4F7GA 5C16A 1W1DA 1DDMA 3BINA 1P3RA 3HQCA 3CXBB 4BBKA 2UZRA 2YS1A 2Y8GA 4ZRIA 1U5DA 3PG7A 4K81A 1DDWA 2RLOA 2E2XA 2D9WA 3TVVA 5KQ4A 4DX8A 5FI1A 2D2QA 2YSZA 3SYXA 3ODOA 3NSUA 2CY4A 2EC1A 4A5KA 5DI9B 2GJYA 1UEFA 2RUKB 3WA0A 2RVBB 5D3YA 3TCAA 1XCGA 1MPHA 1DDVA 5D3WA 1UNRA 1AWEA 4D0NB 2Z0PA 4KVGB 1PLSA 5L81A 2I1KA 2J0MA 2PZ1A 1BWNA 1X86A 1UPRA 2Y7BA 1FAOA 4KHBB 2J0JA 2YT1A 2COFA 1MK7B 2G35A 3VIAA 2ELAA 3ZVRA 2RSGA 2YF0A 4Z2MB 4CHMA 2H7EA 3AJ4A 3RCPA 1B55A 1I7AA 2I5CA 4NSWA 1V5PA 1FHWA 3ML4A 1PFJA 3V5WA 4TKNA 2MKRA 1EF1A 3QIJA 1U5GA 4EMOA 2DHIA 1BAKA 2CODA 1WGQA 2YT0A 3HW2B 3GYOA 1U29A 1V88A 2Z0QA 3KSYA 1WJMA 1TXDA 1DBHA 3ULBA 2UZSA 2D9VA 5D3XA 4Z2NA 4EJNA 4HAVB 2VSZA 4HB4B 1GC6A 3MPXA 3PVUA 3O96A 1U5FA 1NTYA 1W1GA 2YS3A 2QKLA 2LOXA 2P8VA 2R0DA 1RRPB 2DYQA 4IOYX 2MWNB 5EFXA 2COCA 2J59M 2ROVA 2AEHA 1EAZA 2K00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DBB A;  4HAX B;  1KI1 B;  5HE1 A;  2D9Y A;  5DIF B;  2IFS A;  2YS5 A;  2L1C A;  3WYF B;  1NTV A;  4F7U P;  4HB2 B;  4GN1 A;  1AQC A;  1WJ1 A;  1XOD A;  2VKI A;  3SV1 A;  1DYN A;  2D10 A;  4H8S A;  1MIZ B;  1N3H A;  4MK0 A;  3GYP A;  4K17 A;  1I2H A;  1X11 A;  5KCV A;  3D8E A;  4PQ0 A;  3HK0 A;  3PZD A;  5HE2 A;  2DYN A;  1BTK A;  3CIK A;  3T06 A;  4WJ7 A;  4Y94 A;  2YVC A;  2EMT A;  2K2U A;  2K2J A;  1U2B A;  1P5T A;  1M7R A;  2M14 A;  4WSF A;  5KQ1 A;  2COA A;  1GC7 A;  2IYB A;  3FEH A;  2ZPY A;  4HB0 B;  5JLJ B;  5LON B;  2H7D A;  2W2W A;  1W1H A;  2KUP A;  3ODW A;  1MKE A;  1TQZ A;  2NMB A;  1Y19 B;  3QWM A;  1OQN A;  2N23 A;  4KHO A;  3ZDT A;  1H10 A;  3F5R A;  1UPQ A;  5JHG A;  4HDQ A;  3KRW A;  2DA0 A;  1DRO A;  3N7C A;  5HE3 A;  2D9Z A;  3M1I B;  2P0F A;  3UZT A;  1FHX A;  4YON A;  3OAN A;  4HAT B;  2GCJ A;  3VOQ A;  2YRY A;  1ZM0 A;  2MDX A;  1NI2 A;  3KZ1 A;  2Q13 A;  2RNR B;  1RJ2 A;  4XWX A;  3KY9 A;  2AL6 A;  3SUZ A;  1E5W A;  4MT7 A;  4A6F A;  1ZVR A;  4C0A A;  4GMV A;  3DXE A;  2LUL A;  4CHJ A;  3ODX A;  1V89 A;  2DX5 A;  2DHK A;  2DN6 A;  1X05 A;  4MY6 A;  1QC6 A;  1MIX A;  3TO1 A;  3D8F A;  2CRF A;  3QBV B;  4KHA A;  1Z87 A;  4ZRK A;  2LOZ A;  3AU5 A;  4DX9 0;  3A8Q A;  5FI0 A;  4NY0 A;  4IAP A;  2M38 A;  1SGH A;  2DKP A;  5HE0 A;  1K5D B;  5DHA B;  2W2X D;  2FJL A;  3DXD A;  5DHF B;  4KAX B;  2QKM A;  2W2X C;  1FGZ A;  5D27 A;  2I1J A;  5DH9 B;  3AU4 A;  4HB3 B;  3P6A A;  2ELB A;  5C5B A;  2ROZ B;  2I5F A;  1X1G A;  5D3V A;  1ZC4 B;  4GZU A;  2D4Q A;  3U8Z A;  2LG1 A;  2X18 A;  5JHH A;  4PNK A;  2VRW B;  2DTC A;  2P0H A;  1IRS A;  1MK9 B;  1U27 A;  1QQG A;  1XX0 A;  2KCJ A;  3DXC A;  4ZRJ A;  3PP2 A;  2KGX B;  5C79 A;  2DLW A;  3SO6 A;  3IVF A;  1V5M A;  2V76 A;  3P7Z A;  4HHV A;  3A8P A;  3FSS A;  1FHO A;  1K5G B;  2UVM A;  3A98 B;  2OQB A;  1SHC A;  1KZG A;  3FM8 C;  2GCL A;  3D8D A;  3PVW A;  4HAU B;  2D11 A;  2R09 A;  2DX1 A;  4HAW B;  3ULC A;  1LW3 A;  2JP2 A;  1V5U A;  4L6E A;  2MFQ A;  2NZ8 B;  5J3T A;  4HDO A;  4A6H A;  1TJ6 A;  4A6K A;  3PVL A;  1M7E A;  4A6F B;  2EJ8 A;  5CLQ B;  1J19 A;  1FGY A;  5J3Q A;  2DFK A;  4GXB A;  1WVH A;  4F7H A;  4WVF B;  1MAI A;  2ADZ A;  2RGN B;  5GOW B;  5CLL B;  1XR0 B;  4DXA B;  1X1F A;  1P6S A;  2DKQ A;  4TYZ A;  1ISN A;  3MDB C;  1XKE A;  3SNH A;  2EMS A;  2CAY A;  1EVH A;  3U7D A;  2CY5 A;  4CYE A;  2HTH B;  1FB8 A;  1NU2 A;  4B6H A;  1ZSQ A;  2L2I A;  1Y5O A;  3X23 A;  2BCJ A;  1ZC3 B;  3G9W A;  4YL8 A;  5C5B B;  4GPT B;  1XD4 A;  1Q67 A;  4K2P A;  2XQN M;  2DHJ A;  4HAY B;  1V61 A;  2LYD A;  1WGU A;  2GS0 A;  3TW1 A;  2OTX A;  1J0W A;  1H4R A;  1BTN A;  5J3Y A;  3BJI A;  4GMX B;  3TFM A;  1U5E A;  1WI1 A;  2P0D A;  1WG7 A;  2LKO A;  3PEG A;  1OY2 A;  4K2O A;  2D9X A;  3PSC A;  5JP4 A;  4IFS A;  3LJU X;  1LB1 A;  2J0K A;  4P7I A;  1UNQ A;  3F0W A;  4EKU A;  1GG3 A;  1FOE A;  1UNP A;  4HAZ B;  2Z0O A;  3KRX A;  5C6R A;  1PMS A;  1KZ7 A;  2HE7 A;  1EGX A;  1OMW A;  2N0Y A;  5LOP B;  2Y8F A;  4F7G A;  5C16 A;  1W1D A;  1DDM A;  3BIN A;  1P3R A;  3HQC A;  3CXB B;  4BBK A;  2UZR A;  2YS1 A;  2Y8G A;  4ZRI A;  1U5D A;  3PG7 A;  4K81 A;  1DDW A;  2RLO A;  2E2X A;  2D9W A;  3TVV A;  5KQ4 A;  4DX8 A;  5FI1 A;  2D2Q A;  2YSZ A;  3SYX A;  3ODO A;  3NSU A;  2CY4 A;  2EC1 A;  4A5K A;  5DI9 B;  2GJY A;  1UEF A;  2RUK B;  3WA0 A;  2RVB B;  5D3Y A;  3TCA A;  1XCG A;  1MPH A;  1DDV A;  5D3W A;  1UNR A;  1AWE A;  4D0N B;  2Z0P A;  4KVG B;  1PLS A;  5L81 A;  2I1K A;  2J0M A;  2PZ1 A;  1BWN A;  1X86 A;  1UPR A;  2Y7B A;  1FAO A;  4KHB B;  2J0J A;  2YT1 A;  2COF A;  1MK7 B;  2G35 A;  3VIA A;  2ELA A;  3ZVR A;  2RSG A;  2YF0 A;  4Z2M B;  4CHM A;  2H7E A;  3AJ4 A;  3RCP A;  1B55 A;  1I7A A;  2I5C A;  4NSW A;  1V5P A;  1FHW A;  3ML4 A;  1PFJ A;  3V5W A;  4TKN A;  2MKR A;  1EF1 A;  3QIJ A;  1U5G A;  4EMO A;  2DHI A;  1BAK A;  2COD A;  1WGQ A;  2YT0 A;  3HW2 B;  3GYO A;  1U29 A;  1V88 A;  2Z0Q A;  3KSY A;  1WJM A;  1TXD A;  1DBH A;  3ULB A;  2UZS A;  2D9V A;  5D3X A;  4Z2N A;  4EJN A;  4HAV B;  2VSZ A;  4HB4 B;  1GC6 A;  3MPX A;  3PVU A;  3O96 A;  1U5F A;  1NTY A;  1W1G A;  2YS3 A;  2QKL A;  2LOX A;  2P8V A;  2R0D A;  1RRP B;  2DYQ A;  4IOY X;  2MWN B;  5EFX A;  2COC A;  2J59 M;  2ROV A;  2AEH A;  1EAZ A;  2K00 A; 
#chains in the Genus database with same CATH topology
 4DBB A;  4HAX B;  1KI1 B;  5HE1 A;  2D9Y A;  5DIF B;  2IFS A;  2YS5 A;  2L1C A;  3WYF B;  1NTV A;  4F7U P;  4HB2 B;  4GN1 A;  1AQC A;  4OSN A;  1ZYI A;  1WJ1 A;  1XOD A;  2VKI A;  3SV1 A;  1DYN A;  2D10 A;  4QJ3 B;  4H8S A;  1MIZ B;  1N3H A;  4MK0 A;  3GYP A;  4K17 A;  1I2H A;  1X11 A;  5KCV A;  3D8E A;  4PQ0 A;  3HK0 A;  3PZD A;  5HE2 A;  2DYN A;  1BTK A;  3CIK A;  3T06 A;  4WJ7 A;  4Y94 A;  2YVC A;  2EMT A;  2K2U A;  2K2J A;  1U2B A;  1P5T A;  1M7R A;  2M14 A;  4WSF A;  5KQ1 A;  2COA A;  4D6W A;  1GC7 A;  2IYB A;  3FEH A;  2ZPY A;  4HB0 B;  5JLJ B;  5LON B;  2H7D A;  2W2W A;  1W1H A;  2KUP A;  3ODW A;  1MKE A;  1TQZ A;  2NMB A;  1Y19 B;  3QWM A;  1OQN A;  2N23 A;  4KHO A;  3ZDT A;  1H10 A;  3F5R A;  1UPQ A;  5JHG A;  4HDQ A;  3KRW A;  2DA0 A;  1DRO A;  3FVC A;  3N7C A;  5HE3 A;  2D9Z A;  3M1I B;  2P0F A;  3UZT A;  1FHX A;  4YON A;  3OAN A;  4HAT B;  2GCJ A;  3VOQ A;  2YRY A;  1ZM0 A;  2MDX A;  1NI2 A;  3KZ1 A;  2Q13 A;  2RNR B;  3NW8 A;  1RJ2 A;  4XWX A;  3KY9 A;  2AL6 A;  3SUZ A;  1E5W A;  4MT7 A;  4QXA B;  4A6F A;  1ZVR A;  4C0A A;  4GMV A;  3DXE A;  2LUL A;  4CHJ A;  3ODX A;  1V89 A;  2DX5 A;  2DHK A;  2DN6 A;  1X05 A;  3OHM B;  5I2M A;  4MY6 A;  2Z4D A;  1QC6 A;  1MIX A;  3TO1 A;  3D8F A;  2CRF A;  3QBV B;  4KHA A;  1Z87 A;  4ZRK A;  2LOZ A;  3AU5 A;  4DX9 0;  3A8Q A;  5FI0 A;  4CSQ A;  4NY0 A;  4IAP A;  2M38 A;  1SGH A;  2DKP A;  3DCX A;  5HE0 A;  1K5D B;  5DHA B;  2W2X D;  2FJL A;  3DXD A;  4HSI A;  5DHF B;  4KAX B;  2QKM A;  2W2X C;  1FGZ A;  5D27 A;  2I1J A;  5DH9 B;  3AU4 A;  4HB3 B;  3P6A A;  2ELB A;  5C5B A;  2ROZ B;  2I5F A;  1X1G A;  5D3V A;  1ZC4 B;  5LG4 B;  3B77 A;  4GZU A;  4QJ5 B;  2D4Q A;  3U8Z A;  2LG1 A;  2X18 A;  5JHH A;  2KUQ A;  4GNK B;  4PNK A;  2VRW B;  3HIE A;  2DTC A;  2FJU B;  2P0H A;  5M4Y B;  1IRS A;  1MK9 B;  1U27 A;  2ZKM X;  1QQG A;  1XX0 A;  2KCJ A;  3DXC A;  4ZRJ A;  3PP2 A;  2KGX B;  5C79 A;  2DLW A;  3SO6 A;  3IVF A;  1V5M A;  2V76 A;  3P7Z A;  4HHV A;  3A8P A;  3FSS A;  1FHO A;  1K5G B;  2UVM A;  3A98 B;  2OQB A;  1SHC A;  1KZG A;  3FM8 C;  2GCL A;  3D8D A;  3PVW A;  4HAU B;  2D11 A;  2R09 A;  2DX1 A;  4HAW B;  2R2Y A;  3ULC A;  1LW3 A;  2JP2 A;  1V5U A;  4L6E A;  2MFQ A;  2NZ8 B;  5J3T A;  4HDO A;  4A6H A;  1TJ6 A;  4GOU A;  4A6K A;  3PVL A;  5IRS A;  1M7E A;  4A6F B;  2EJ8 A;  5CLQ B;  1J19 A;  1FGY A;  4DIX A;  5J3Q A;  2DFK A;  4GXB A;  1WVH A;  4F7H A;  4WVF B;  1MAI A;  2KIE A;  2ADZ A;  2RGN B;  5GOW B;  5CLL B;  3NWA A;  1XR0 B;  4DXA B;  1X1F A;  1P6S A;  2DKQ A;  4TYZ A;  2RRF A;  1ISN A;  3MDB C;  1XKE A;  3SNH A;  2EMS A;  2CAY A;  1EVH A;  3U7D A;  2CY5 A;  2NBV A;  4CYE A;  2HTH B;  1FB8 A;  1NU2 A;  4B6H A;  4KHB A;  1ZSQ A;  2Z13 A;  2L2I A;  1Y5O A;  1T77 A;  3X23 A;  2BCJ A;  1ZC3 B;  3G9W A;  4YL8 A;  5C5B B;  4GPT B;  1XD4 A;  1Q67 A;  4K2P A;  2XQN M;  2DHJ A;  4HAY B;  1V61 A;  2LYD A;  1WGU A;  2GS0 A;  3TW1 A;  2OTX A;  1J0W A;  1H4R A;  1BTN A;  5J3Y A;  3BJI A;  2KR0 A;  4GMX B;  2YT2 A;  3TFM A;  1U5E A;  1WI1 A;  2P0D A;  1WG7 A;  2LKO A;  3PEG A;  1OY2 A;  4K2O A;  2D9X A;  3PSC A;  5JP4 A;  4IFS A;  3LJU X;  1LB1 A;  2J0K A;  4P7I A;  1UNQ A;  3F0W A;  4EKU A;  1GG3 A;  1FOE A;  1UNP A;  4HAZ B;  2Z0O A;  2K8E A;  3KRX A;  5C6R A;  1PMS A;  1KZ7 A;  2HE7 A;  1EGX A;  1OMW A;  2N0Y A;  5LOP B;  2Y8F A;  4F7G A;  5C16 A;  3NWD A;  1W1D A;  1DDM A;  3BIN A;  1P3R A;  3HQC A;  3CXB B;  4BBK A;  2UZR A;  2YS1 A;  2Y8G A;  4ZRI A;  2Z59 A;  1U5D A;  3PG7 A;  4K81 A;  1DDW A;  2RLO A;  2E2X A;  2D9W A;  3TVV A;  5KQ4 A;  4DX8 A;  5FI1 A;  2D2Q A;  2YSZ A;  3SYX A;  3HSA A;  3ODO A;  3NSU A;  2CY4 A;  2EC1 A;  4A5K A;  5DI9 B;  2GJY A;  1UEF A;  2RUK B;  3WA0 A;  2RVB B;  5D3Y A;  3TCA A;  1XCG A;  1MPH A;  1DDV A;  5D3W A;  1UNR A;  1AWE A;  2Z14 A;  4D0N B;  2Z0P A;  4KVG B;  1PLS A;  5L81 A;  2I1K A;  2J0M A;  2PZ1 A;  1BWN A;  1X86 A;  4L1R A;  2GUM A;  1UPR A;  1MI1 A;  2Y7B A;  1FAO A;  4KHB B;  2J0J A;  2YT1 A;  4QJ4 B;  2COF A;  1MK7 B;  2G35 A;  3VIA A;  2ELA A;  3ZVR A;  3U12 A;  2RSG A;  2YF0 A;  4Z2M B;  4CHM A;  2H7E A;  3AJ4 A;  3RCP A;  1B55 A;  1I7A A;  2I5C A;  4NSW A;  1V5P A;  2KIG A;  1FHW A;  3ML4 A;  1PFJ A;  3V5W A;  4TKN A;  2MKR A;  1EF1 A;  3QIJ A;  1U5G A;  4EMO A;  2DHI A;  1BAK A;  2COD A;  1WGQ A;  2YT0 A;  3NWF A;  3HW2 B;  3GYO A;  4OT1 A;  1U29 A;  1V88 A;  2Z0Q A;  3KSY A;  1WJM A;  1TXD A;  1DBH A;  3ULB A;  2UZS A;  2D9V A;  5D3X A;  4Z2N A;  4EJN A;  4HAV B;  2VSZ A;  4HB4 B;  1GC6 A;  3MPX A;  3PVU A;  3O96 A;  1U5F A;  1NTY A;  1W1G A;  2YS3 A;  3A58 A;  2QKL A;  2K49 A;  2LOX A;  2P8V A;  2R0D A;  1RRP B;  2DYQ A;  4IOY X;  2MWN B;  5EFX A;  2COC A;  2J59 M;  2ROV A;  2AEH A;  1EAZ A;  2K00 A;  5I2S A; 
#chains in the Genus database with same CATH homology
 4DBB A;  4HAX B;  1KI1 B;  5HE1 A;  2D9Y A;  5DIF B;  2IFS A;  2YS5 A;  2L1C A;  3WYF B;  1NTV A;  4F7U P;  4HB2 B;  4GN1 A;  1AQC A;  1WJ1 A;  1XOD A;  2VKI A;  3SV1 A;  1DYN A;  2D10 A;  4H8S A;  1MIZ B;  1N3H A;  4MK0 A;  3GYP A;  4K17 A;  1I2H A;  1X11 A;  5KCV A;  3D8E A;  4PQ0 A;  3HK0 A;  3PZD A;  5HE2 A;  2DYN A;  1BTK A;  3CIK A;  3T06 A;  4WJ7 A;  4Y94 A;  2YVC A;  2EMT A;  2K2U A;  2K2J A;  1U2B A;  1P5T A;  1M7R A;  2M14 A;  4WSF A;  5KQ1 A;  2COA A;  1GC7 A;  2IYB A;  3FEH A;  2ZPY A;  4HB0 B;  5JLJ B;  5LON B;  2H7D A;  2W2W A;  1W1H A;  2KUP A;  3ODW A;  1MKE A;  1TQZ A;  2NMB A;  1Y19 B;  3QWM A;  1OQN A;  2N23 A;  4KHO A;  3ZDT A;  1H10 A;  3F5R A;  1UPQ A;  5JHG A;  4HDQ A;  3KRW A;  2DA0 A;  1DRO A;  3N7C A;  5HE3 A;  2D9Z A;  3M1I B;  2P0F A;  3UZT A;  1FHX A;  4YON A;  3OAN A;  4HAT B;  2GCJ A;  3VOQ A;  2YRY A;  1ZM0 A;  2MDX A;  1NI2 A;  3KZ1 A;  2Q13 A;  2RNR B;  1RJ2 A;  4XWX A;  3KY9 A;  2AL6 A;  3SUZ A;  1E5W A;  4MT7 A;  4A6F A;  1ZVR A;  4C0A A;  4GMV A;  3DXE A;  2LUL A;  4CHJ A;  3ODX A;  1V89 A;  2DX5 A;  2DHK A;  2DN6 A;  1X05 A;  4MY6 A;  1QC6 A;  1MIX A;  3TO1 A;  3D8F A;  2CRF A;  3QBV B;  4KHA A;  1Z87 A;  4ZRK A;  2LOZ A;  3AU5 A;  4DX9 0;  3A8Q A;  5FI0 A;  4NY0 A;  4IAP A;  2M38 A;  1SGH A;  2DKP A;  5HE0 A;  1K5D B;  5DHA B;  2W2X D;  2FJL A;  3DXD A;  5DHF B;  4KAX B;  2QKM A;  2W2X C;  1FGZ A;  5D27 A;  2I1J A;  5DH9 B;  3AU4 A;  4HB3 B;  3P6A A;  2ELB A;  5C5B A;  2ROZ B;  2I5F A;  1X1G A;  5D3V A;  1ZC4 B;  4GZU A;  2D4Q A;  3U8Z A;  2LG1 A;  2X18 A;  5JHH A;  4PNK A;  2VRW B;  2DTC A;  2P0H A;  1IRS A;  1MK9 B;  1U27 A;  1QQG A;  1XX0 A;  2KCJ A;  3DXC A;  4ZRJ A;  3PP2 A;  2KGX B;  5C79 A;  2DLW A;  3SO6 A;  3IVF A;  1V5M A;  2V76 A;  3P7Z A;  4HHV A;  3A8P A;  3FSS A;  1FHO A;  1K5G B;  2UVM A;  3A98 B;  2OQB A;  1SHC A;  1KZG A;  3FM8 C;  2GCL A;  3D8D A;  3PVW A;  4HAU B;  2D11 A;  2R09 A;  2DX1 A;  4HAW B;  3ULC A;  1LW3 A;  2JP2 A;  1V5U A;  4L6E A;  2MFQ A;  2NZ8 B;  5J3T A;  4HDO A;  4A6H A;  1TJ6 A;  4A6K A;  3PVL A;  1M7E A;  4A6F B;  2EJ8 A;  5CLQ B;  1J19 A;  1FGY A;  5J3Q A;  2DFK A;  4GXB A;  1WVH A;  4F7H A;  4WVF B;  1MAI A;  2ADZ A;  2RGN B;  5GOW B;  5CLL B;  1XR0 B;  4DXA B;  1X1F A;  1P6S A;  2DKQ A;  4TYZ A;  1ISN A;  3MDB C;  1XKE A;  3SNH A;  2EMS A;  2CAY A;  1EVH A;  3U7D A;  2CY5 A;  4CYE A;  2HTH B;  1FB8 A;  1NU2 A;  4B6H A;  1ZSQ A;  2L2I A;  1Y5O A;  3X23 A;  2BCJ A;  1ZC3 B;  3G9W A;  4YL8 A;  5C5B B;  4GPT B;  1XD4 A;  1Q67 A;  4K2P A;  2XQN M;  2DHJ A;  4HAY B;  1V61 A;  2LYD A;  1WGU A;  2GS0 A;  3TW1 A;  2OTX A;  1J0W A;  1H4R A;  1BTN A;  5J3Y A;  3BJI A;  4GMX B;  3TFM A;  1U5E A;  1WI1 A;  2P0D A;  1WG7 A;  2LKO A;  3PEG A;  1OY2 A;  4K2O A;  2D9X A;  3PSC A;  5JP4 A;  4IFS A;  3LJU X;  1LB1 A;  2J0K A;  4P7I A;  1UNQ A;  3F0W A;  4EKU A;  1GG3 A;  1FOE A;  1UNP A;  4HAZ B;  2Z0O A;  3KRX A;  5C6R A;  1PMS A;  1KZ7 A;  2HE7 A;  1EGX A;  1OMW A;  2N0Y A;  5LOP B;  2Y8F A;  4F7G A;  5C16 A;  1W1D A;  1DDM A;  3BIN A;  1P3R A;  3HQC A;  3CXB B;  4BBK A;  2UZR A;  2YS1 A;  2Y8G A;  4ZRI A;  1U5D A;  3PG7 A;  4K81 A;  1DDW A;  2RLO A;  2E2X A;  2D9W A;  3TVV A;  5KQ4 A;  4DX8 A;  5FI1 A;  2D2Q A;  2YSZ A;  3SYX A;  3ODO A;  3NSU A;  2CY4 A;  2EC1 A;  4A5K A;  5DI9 B;  2GJY A;  1UEF A;  2RUK B;  3WA0 A;  2RVB B;  5D3Y A;  3TCA A;  1XCG A;  1MPH A;  1DDV A;  5D3W A;  1UNR A;  1AWE A;  4D0N B;  2Z0P A;  4KVG B;  1PLS A;  5L81 A;  2I1K A;  2J0M A;  2PZ1 A;  1BWN A;  1X86 A;  1UPR A;  2Y7B A;  1FAO A;  4KHB B;  2J0J A;  2YT1 A;  2COF A;  1MK7 B;  2G35 A;  3VIA A;  2ELA A;  3ZVR A;  2RSG A;  2YF0 A;  4Z2M B;  4CHM A;  2H7E A;  3AJ4 A;  3RCP A;  1B55 A;  1I7A A;  2I5C A;  4NSW A;  1V5P A;  1FHW A;  3ML4 A;  1PFJ A;  3V5W A;  4TKN A;  2MKR A;  1EF1 A;  3QIJ A;  1U5G A;  4EMO A;  2DHI A;  1BAK A;  2COD A;  1WGQ A;  2YT0 A;  3HW2 B;  3GYO A;  1U29 A;  1V88 A;  2Z0Q A;  3KSY A;  1WJM A;  1TXD A;  1DBH A;  3ULB A;  2UZS A;  2D9V A;  5D3X A;  4Z2N A;  4EJN A;  4HAV B;  2VSZ A;  4HB4 B;  1GC6 A;  3MPX A;  3PVU A;  3O96 A;  1U5F A;  1NTY A;  1W1G A;  2YS3 A;  2QKL A;  2LOX A;  2P8V A;  2R0D A;  1RRP B;  2DYQ A;  4IOY X;  2MWN B;  5EFX A;  2COC A;  2J59 M;  2ROV A;  2AEH A;  1EAZ A;  2K00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...