2DA0A

Solution structure of the ph domain of pip2-dependent arf1 gtpase-activating protein from human
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSSGSSGYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALTMAFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of PIP2-dependent ARF1 GTPase-activating protein from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2da0A00
4HDQA 4MT7A 3U8ZA 4A6FB 4MY6A 4KVGB 1BAKA 1K5GB 3N7CA 4BBKA 3ZDTA 3D8FA 4K2OA 1PMSA 1X1FA 2M14A 3KRWA 1LW3A 4KHOA 4WSFA 2ZPYA 2W2XC 4Y94A 1U29A 4HAVB 1ISNA 1KI1B 5C79A 2MWNB 3KY9A 4DXAB 4F7HA 2P0HA 2IYBA 2ELAA 1RRPB 4HAXB 1NTVA 5DIFB 4WJ7A 2YT0A 1XKEA 1UEFA 4GXBA 2Z0OA 5CLQB 1WG7A 1BTNA 4D0NB 1M7EA 5JP4A 4A5KA 2N23A 2YS1A 3MPXA 4KHAA 3FSSA 2PZ1A 2LG1A 3D8DA 2CY5A 4A6KA 1V5PA 1FHOA 1W1HA 1XD4A 3F5RA 2N0YA 2L2IA 5KQ4A 4Z2MB 1MIZB 4IFSA 2Z0PA 2RUKB 4HB3B 1DYNA 4KAXB 3WA0A 3T06A 3GYPA 5LONB 3PP2A 5DHAB 4K2PA 2D9ZA 4XWXA 5J3QA 1KZ7A 2ROZB 1EAZA 4A6HA 1NI2A 2BCJA 3KZ1A 3QIJA 5L81A 3GYOA 2YS3A 4HAWB 4IAPA 4CYEA 4MK0A 2E2XA 3FM8C 3PVWA 2DFKA 3QWMA 2X18A 2D4QA 1MK9B 2QKLA 2DKQA 1V5MA 2LULA 2K2JA 2LKOA 2D9XA 2KGXB 3PG7A 3WYFB 4K17A 3QBVB 3TFMA 1QQGA 1GG3A 2H7DA 2K2UA 2COFA 2I1KA 2XQNM 5C5BA 3PSCA 4DX8A 4HB4B 3DXDA 2H7EA 4P7IA 5D3WA 2DA0A 1AQCA 1XX0A 1EGXA 1Y5OA 4DX90 1PFJA 2P0DA 5C5BB 1K5DB 4GMVA 1FB8A 1E5WA 1H10A 5HE3A 2ELBA 2YRYA 4HB2B 4GZUA 3ZVRA 2V76A 1V5UA 1OMWA 2YVCA 3SO6A 5LOPB 1DDWA 2I5CA 3ML4A 4HAYB 1NTYA 2J59M 3G9WA 1V89A 2UZRA 3P7ZA 1FOEA 2GCJA 2EC1A 1WJMA 2KUPA 2OTXA 1SHCA 2Q13A 1ZM0A 2GJYA 1J0WA 2ROVA 1MK7B 1MPHA 4TYZA 4YONA 3HW2B 3SNHA 2R09A 2D11A 1EVHA 5GOWB 3HQCA 5JHGA 1DBHA 3X23A 4WVFB 3O96A 1U5FA 1M7RA 4GMXB 2YSZA 2J0KA 1P6SA 4HHVA 2EMSA 2HE7A 5DH9B 2Y7BA 4EJNA 5D3VA 4K81A 2J0JA 2I1JA 3PVUA 2D9YA 1GC6A 3NSUA 1U2BA 2CY4A 3SV1A 4PNKA 5HE0A 1XCGA 3RCPA 1QC6A 3BJIA 3D8EA 4TKNA 5JLJB 5HE2A 4ZRKA 2DN6A 1I7AA 2VSZA 3FEHA 1IRSA 4F7GA 2RVBB 4B6HA 3ULBA 2L1CA 5D3XA 1UPRA 2DLWA 1MAIA 1UPQA 2K00A 1WI1A 2VKIA 2GCLA 1ZC4B 5D27A 5D3YA 1TXDA 3VIAA 1UNPA 1FGZA 5EFXA 2DHJA 1BTKA 1GC7A 2UZSA 2CODA 1W1GA 1H4RA 4GPTB 5DI9B 3P6AA 1Y19B 4NY0A 5C6RA 1PLSA 5FI1A 2DX5A 4KHBB 3CXBB 3PZDA 1OQNA 3U7DA 3AU5A 2Y8FA 3VOQA 2OQBA 1MIXA 4Z2NA 3LJUX 1P3RA 2J0MA 1KZGA 2AL6A 3A8PA 1RJ2A 1DDVA 2COCA 5KQ1A 1X05A 2RNRB 3A98B 1UNRA 2FJLA 2ADZA 4YL8A 3AJ4A 2DHIA 2MDXA 5C16A 2DKPA 1DROA 2DYNA 5HE1A 4EKUA 2D9VA 2RSGA 1DDMA 3TCAA 1N3HA 1B55A 2HTHB 1U5GA 4ZRJA 2W2WA 2YF0A 2MFQA 3TVVA 2QKMA 1X1GA 1FHWA 3DXEA 1TQZA 2AEHA 2RLOA 3ODWA 1V61A 4ZRIA 1WJ1A 2LOXA 2M38A 1ZSQA 1P5TA 1MKEA 4L6EA 1OY2A 1Z87A 1ZVRA 1EF1A 1I2HA 3V5WA 2GS0A 1AWEA 2NMBA 2NZ8B 1TJ6A 2MKRA 2EMTA 2UVMA 2IFSA 5J3YA 5J3TA 1W1DA 1WGQA 1V88A 3A8QA 3AU4A 2Y8GA 4PQ0A 2VRWB 5DHFB 1U5EA 2YT1A 4HAZB 2KCJA 4F7UP 1FGYA 1U27A 1SGHA 2Z0QA 3TO1A 3KRXA 3ODXA 2DHKA 4GN1A 3SYXA 4NSWA 1BWNA 2COAA 4IOYX 4EMOA 2D2QA 2CRFA 1ZC3B 3MDBC 1NU2A 1J19A 1LB1A 3F0WA 2W2XD 4DBBA 2G35A 2EJ8A 1UNQA 3HK0A 3ULCA 3OANA 4A6FA 4C0AA 5KCVA 2JP2A 5FI0A 2CAYA 2YS5A 2P8VA 4HATB 1FAOA 2D10A 2LYDA 3ODOA 1WVHA 3M1IB 1Q67A 1U5DA 3SUZA 4CHJA 3CIKA 3KSYA 1XODA 3IVFA 2R0DA 5JHHA 2P0FA 4HB0B 5CLLB 3DXCA 2LOZA 3PVLA 1XR0B 4CHMA 3TW1A 4H8SA 4HDOA 2DX1A 2DTCA 2I5FA 3UZTA 3BINA 2DYQA 2D9WA 1WGUA 2RGNB 4HAUB 3PEGA 1X86A 1FHXA 1X11A
chains in the Genus database with same CATH superfamily
4HDQA 4MT7A 3U8ZA 4A6FB 4MY6A 4KVGB 1BAKA 1K5GB 3N7CA 4BBKA 3ZDTA 5IRSA 3D8FA 4K2OA 1PMSA 1X1FA 2M14A 3KRWA 1LW3A 4KHOA 4WSFA 2ZPYA 2W2XC 4Y94A 1U29A 4HAVB 1ISNA 1KI1B 5C79A 2MWNB 3KY9A 4DXAB 4F7HA 2P0HA 2Z4DA 2IYBA 2ELAA 1RRPB 4HAXB 1NTVA 5DIFB 4WJ7A 2YT0A 1XKEA 1UEFA 4GXBA 2Z0OA 5CLQB 4QJ3B 1WG7A 1BTNA 4D0NB 1M7EA 5JP4A 4A5KA 2N23A 2YS1A 3MPXA 4KHAA 5I2SA 2R2YA 3FSSA 2PZ1A 3A58A 2LG1A 3D8DA 2CY5A 4A6KA 1V5PA 4QJ4B 1FHOA 1W1HA 1XD4A 3F5RA 2N0YA 2L2IA 5KQ4A 4Z2MB 1MIZB 4IFSA 4QXAB 2Z0PA 2RUKB 4HB3B 1DYNA 4KAXB 1MI1A 3WA0A 3T06A 3GYPA 4GNKB 5LONB 3PP2A 5DHAB 4K2PA 2D9ZA 4XWXA 5J3QA 1KZ7A 2ROZB 1EAZA 4A6HA 1NI2A 2BCJA 3KZ1A 3QIJA 5L81A 3GYOA 2YS3A 2FJUB 4HAWB 2K49A 4IAPA 2Z14A 3NWFA 4CYEA 3HIEA 4MK0A 2E2XA 3FM8C 3PVWA 2DFKA 3QWMA 2X18A 2D4QA 1MK9B 2QKLA 2DKQA 1V5MA 2NBVA 2LULA 2K2JA 2LKOA 2D9XA 2KGXB 3PG7A 3WYFB 4K17A 4OT1A 3QBVB 3TFMA 1QQGA 1GG3A 2H7DA 2K2UA 2COFA 2I1KA 2XQNM 5C5BA 3PSCA 4DX8A 4HB4B 3DXDA 2H7EA 4P7IA 5D3WA 5I2MA 2DA0A 1AQCA 1XX0A 1EGXA 1T77A 1Y5OA 4DX90 1PFJA 2P0DA 5C5BB 1K5DB 4GMVA 1FB8A 1E5WA 1H10A 5HE3A 2ELBA 2YRYA 4HB2B 4GZUA 3ZVRA 2V76A 1V5UA 1OMWA 2KIEA 2YVCA 3SO6A 5LOPB 5LG4B 1DDWA 2I5CA 3ML4A 2GUMA 4HAYB 1NTYA 2J59M 3G9WA 1V89A 2UZRA 3P7ZA 1FOEA 3B77A 2GCJA 2EC1A 1WJMA 2KUPA 2OTXA 1SHCA 2Q13A 1ZM0A 2GJYA 1J0WA 2ROVA 3NWAA 1MK7B 1MPHA 2KR0A 4TYZA 4YONA 3HW2B 3SNHA 4GOUA 2R09A 2D11A 1EVHA 5GOWB 3HQCA 5JHGA 1DBHA 3X23A 4WVFB 3O96A 1U5FA 3HSAA 1M7RA 4GMXB 2YSZA 2J0KA 1P6SA 4HHVA 2EMSA 2HE7A 5DH9B 4CSQA 2Y7BA 4EJNA 4D6WA 5D3VA 2J0JA 4K81A 2I1JA 3PVUA 2D9YA 1GC6A 3NSUA 1U2BA 2CY4A 3SV1A 4PNKA 5HE0A 1XCGA 3RCPA 1QC6A 3BJIA 3OHMB 3D8EA 4TKNA 5JLJB 5HE2A 4ZRKA 2DN6A 1I7AA 2VSZA 3FEHA 1IRSA 4F7GA 2RVBB 4B6HA 3ULBA 2L1CA 5D3XA 1UPRA 2DLWA 1MAIA 1UPQA 2K00A 1WI1A 2VKIA 2GCLA 1ZC4B 5D27A 5D3YA 1TXDA 3VIAA 1UNPA 1FGZA 5EFXA 2DHJA 1BTKA 2K8EA 1GC7A 2UZSA 2ZKMX 2CODA 3DCXA 4DIXA 1W1GA 1H4RA 4GPTB 5DI9B 3P6AA 1Y19B 4NY0A 5C6RA 1PLSA 5FI1A 2DX5A 4KHBB 3CXBB 3PZDA 1OQNA 3U7DA 3AU5A 2Y8FA 3VOQA 2OQBA 1MIXA 4Z2NA 3LJUX 1P3RA 2J0MA 1KZGA 2AL6A 3A8PA 4OSNA 1RJ2A 1DDVA 2COCA 5KQ1A 1X05A 2RNRB 3A98B 4QJ5B 1UNRA 2FJLA 2ADZA 4YL8A 3AJ4A 2DHIA 2MDXA 3NWDA 5C16A 2DKPA 2Z59A 1DROA 2DYNA 5HE1A 4EKUA 2D9VA 2RSGA 1DDMA 3TCAA 1N3HA 1B55A 2HTHB 1U5GA 4KHBA 4ZRJA 2W2WA 2YF0A 2MFQA 2KIGA 3TVVA 2QKMA 1X1GA 1FHWA 3DXEA 1TQZA 2AEHA 2RLOA 3ODWA 1V61A 4ZRIA 1WJ1A 2LOXA 2M38A 1ZSQA 4HSIA 2YT2A 1P5TA 1MKEA 4L6EA 1OY2A 1Z87A 1ZVRA 1EF1A 1I2HA 3V5WA 2GS0A 1AWEA 2NMBA 2NZ8B 1TJ6A 2MKRA 2EMTA 2UVMA 1ZYIA 2IFSA 5J3YA 5J3TA 1W1DA 1WGQA 2Z13A 1V88A 5M4YB 3A8QA 2RRFA 3AU4A 2Y8GA 4PQ0A 2VRWB 5DHFB 1U5EA 2YT1A 4HAZB 2KCJA 4F7UP 1FGYA 1U27A 1SGHA 2Z0QA 3TO1A 3KRXA 3ODXA 2DHKA 4GN1A 3SYXA 4NSWA 2KUQA 1BWNA 2COAA 4IOYX 4EMOA 2D2QA 2CRFA 4L1RA 1ZC3B 3MDBC 1NU2A 1J19A 1LB1A 3F0WA 2W2XD 4DBBA 2G35A 2EJ8A 1UNQA 3HK0A 3ULCA 3OANA 3U12A 3FVCA 4A6FA 4C0AA 5KCVA 2JP2A 5FI0A 2CAYA 2YS5A 2P8VA 4HATB 1FAOA 2D10A 2LYDA 3ODOA 1WVHA 3M1IB 1Q67A 1U5DA 3SUZA 4CHJA 3CIKA 3KSYA 1XODA 3IVFA 2R0DA 5JHHA 2P0FA 4HB0B 5CLLB 3DXCA 2LOZA 3PVLA 1XR0B 4CHMA 3TW1A 4H8SA 4HDOA 2DX1A 3NW8A 2DTCA 2I5FA 3UZTA 3BINA 2DYQA 2D9WA 1WGUA 2RGNB 4HAUB 3PEGA 1X86A 1FHXA 1X11A
chains in the Genus database with same CATH topology
4HDQA 4MT7A 3U8ZA 4A6FB 4MY6A 4KVGB 1BAKA 1K5GB 3N7CA 4BBKA 3ZDTA 3D8FA 4K2OA 1PMSA 1X1FA 2M14A 3KRWA 1LW3A 4KHOA 4WSFA 2ZPYA 2W2XC 4Y94A 1U29A 4HAVB 1ISNA 1KI1B 5C79A 2MWNB 3KY9A 4DXAB 4F7HA 2P0HA 2IYBA 2ELAA 1RRPB 4HAXB 1NTVA 5DIFB 4WJ7A 2YT0A 1XKEA 1UEFA 4GXBA 2Z0OA 5CLQB 1WG7A 1BTNA 4D0NB 1M7EA 5JP4A 4A5KA 2N23A 2YS1A 3MPXA 4KHAA 3FSSA 2PZ1A 2LG1A 3D8DA 2CY5A 4A6KA 1V5PA 1FHOA 1W1HA 1XD4A 3F5RA 2N0YA 2L2IA 5KQ4A 4Z2MB 1MIZB 4IFSA 2Z0PA 2RUKB 4HB3B 1DYNA 4KAXB 3WA0A 3T06A 3GYPA 5LONB 3PP2A 5DHAB 4K2PA 2D9ZA 4XWXA 5J3QA 1KZ7A 2ROZB 1EAZA 4A6HA 1NI2A 2BCJA 3KZ1A 3QIJA 5L81A 3GYOA 2YS3A 4HAWB 4IAPA 4CYEA 4MK0A 2E2XA 3FM8C 3PVWA 2DFKA 3QWMA 2X18A 2D4QA 1MK9B 2QKLA 2DKQA 1V5MA 2LULA 2K2JA 2LKOA 2D9XA 2KGXB 3PG7A 3WYFB 4K17A 3QBVB 3TFMA 1QQGA 1GG3A 2H7DA 2K2UA 2COFA 2I1KA 2XQNM 5C5BA 3PSCA 4DX8A 4HB4B 3DXDA 2H7EA 4P7IA 5D3WA 2DA0A 1AQCA 1XX0A 1EGXA 1Y5OA 4DX90 1PFJA 2P0DA 5C5BB 1K5DB 4GMVA 1FB8A 1E5WA 1H10A 5HE3A 2ELBA 2YRYA 4HB2B 4GZUA 3ZVRA 2V76A 1V5UA 1OMWA 2YVCA 3SO6A 5LOPB 1DDWA 2I5CA 3ML4A 4HAYB 1NTYA 2J59M 3G9WA 1V89A 2UZRA 3P7ZA 1FOEA 2GCJA 2EC1A 1WJMA 2KUPA 2OTXA 1SHCA 2Q13A 1ZM0A 2GJYA 1J0WA 2ROVA 1MK7B 1MPHA 4TYZA 4YONA 3HW2B 3SNHA 2R09A 2D11A 1EVHA 5GOWB 3HQCA 5JHGA 1DBHA 3X23A 4WVFB 3O96A 1U5FA 1M7RA 4GMXB 2YSZA 2J0KA 1P6SA 4HHVA 2EMSA 2HE7A 5DH9B 2Y7BA 4EJNA 5D3VA 4K81A 2J0JA 2I1JA 3PVUA 2D9YA 1GC6A 3NSUA 1U2BA 2CY4A 3SV1A 4PNKA 5HE0A 1XCGA 3RCPA 1QC6A 3BJIA 3D8EA 4TKNA 5JLJB 5HE2A 4ZRKA 2DN6A 1I7AA 2VSZA 3FEHA 1IRSA 4F7GA 2RVBB 4B6HA 3ULBA 2L1CA 5D3XA 1UPRA 2DLWA 1MAIA 1UPQA 2K00A 1WI1A 2VKIA 2GCLA 1ZC4B 5D27A 5D3YA 1TXDA 3VIAA 1UNPA 1FGZA 5EFXA 2DHJA 1BTKA 1GC7A 2UZSA 2CODA 1W1GA 1H4RA 4GPTB 5DI9B 3P6AA 1Y19B 4NY0A 5C6RA 1PLSA 5FI1A 2DX5A 4KHBB 3CXBB 3PZDA 1OQNA 3U7DA 3AU5A 2Y8FA 3VOQA 2OQBA 1MIXA 4Z2NA 3LJUX 1P3RA 2J0MA 1KZGA 2AL6A 3A8PA 1RJ2A 1DDVA 2COCA 5KQ1A 1X05A 2RNRB 3A98B 1UNRA 2FJLA 2ADZA 4YL8A 3AJ4A 2DHIA 2MDXA 5C16A 2DKPA 1DROA 2DYNA 5HE1A 4EKUA 2D9VA 2RSGA 1DDMA 3TCAA 1N3HA 1B55A 2HTHB 1U5GA 4ZRJA 2W2WA 2YF0A 2MFQA 3TVVA 2QKMA 1X1GA 1FHWA 3DXEA 1TQZA 2AEHA 2RLOA 3ODWA 1V61A 4ZRIA 1WJ1A 2LOXA 2M38A 1ZSQA 1P5TA 1MKEA 4L6EA 1OY2A 1Z87A 1ZVRA 1EF1A 1I2HA 3V5WA 2GS0A 1AWEA 2NMBA 2NZ8B 1TJ6A 2MKRA 2EMTA 2UVMA 2IFSA 5J3YA 5J3TA 1W1DA 1WGQA 1V88A 3A8QA 3AU4A 2Y8GA 4PQ0A 2VRWB 5DHFB 1U5EA 2YT1A 4HAZB 2KCJA 4F7UP 1FGYA 1U27A 1SGHA 2Z0QA 3TO1A 3KRXA 3ODXA 2DHKA 4GN1A 3SYXA 4NSWA 1BWNA 2COAA 4IOYX 4EMOA 2D2QA 2CRFA 1ZC3B 3MDBC 1NU2A 1J19A 1LB1A 3F0WA 2W2XD 4DBBA 2G35A 2EJ8A 1UNQA 3HK0A 3ULCA 3OANA 4A6FA 4C0AA 5KCVA 2JP2A 5FI0A 2CAYA 2YS5A 2P8VA 4HATB 1FAOA 2D10A 2LYDA 3ODOA 1WVHA 3M1IB 1Q67A 1U5DA 3SUZA 4CHJA 3CIKA 3KSYA 1XODA 3IVFA 2R0DA 5JHHA 2P0FA 4HB0B 5CLLB 3DXCA 2LOZA 3PVLA 1XR0B 4CHMA 3TW1A 4H8SA 4HDOA 2DX1A 2DTCA 2I5FA 3UZTA 3BINA 2DYQA 2D9WA 1WGUA 2RGNB 4HAUB 3PEGA 1X86A 1FHXA 1X11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDQ A;  4MT7 A;  3U8Z A;  4A6F B;  4MY6 A;  4KVG B;  1BAK A;  1K5G B;  3N7C A;  4BBK A;  3ZDT A;  3D8F A;  4K2O A;  1PMS A;  1X1F A;  2M14 A;  3KRW A;  1LW3 A;  4KHO A;  4WSF A;  2ZPY A;  2W2X C;  4Y94 A;  1U29 A;  4HAV B;  1ISN A;  1KI1 B;  5C79 A;  2MWN B;  3KY9 A;  4DXA B;  4F7H A;  2P0H A;  2IYB A;  2ELA A;  1RRP B;  4HAX B;  1NTV A;  5DIF B;  4WJ7 A;  2YT0 A;  1XKE A;  1UEF A;  4GXB A;  2Z0O A;  5CLQ B;  1WG7 A;  1BTN A;  4D0N B;  1M7E A;  5JP4 A;  4A5K A;  2N23 A;  2YS1 A;  3MPX A;  4KHA A;  3FSS A;  2PZ1 A;  2LG1 A;  3D8D A;  2CY5 A;  4A6K A;  1V5P A;  1FHO A;  1W1H A;  1XD4 A;  3F5R A;  2N0Y A;  2L2I A;  5KQ4 A;  4Z2M B;  1MIZ B;  4IFS A;  2Z0P A;  2RUK B;  4HB3 B;  1DYN A;  4KAX B;  3WA0 A;  3T06 A;  3GYP A;  5LON B;  3PP2 A;  5DHA B;  4K2P A;  2D9Z A;  4XWX A;  5J3Q A;  1KZ7 A;  2ROZ B;  1EAZ A;  4A6H A;  1NI2 A;  2BCJ A;  3KZ1 A;  3QIJ A;  5L81 A;  3GYO A;  2YS3 A;  4HAW B;  4IAP A;  4CYE A;  4MK0 A;  2E2X A;  3FM8 C;  3PVW A;  2DFK A;  3QWM A;  2X18 A;  2D4Q A;  1MK9 B;  2QKL A;  2DKQ A;  1V5M A;  2LUL A;  2K2J A;  2LKO A;  2D9X A;  2KGX B;  3PG7 A;  3WYF B;  4K17 A;  3QBV B;  3TFM A;  1QQG A;  1GG3 A;  2H7D A;  2K2U A;  2COF A;  2I1K A;  2XQN M;  5C5B A;  3PSC A;  4DX8 A;  4HB4 B;  3DXD A;  2H7E A;  4P7I A;  5D3W A;  2DA0 A;  1AQC A;  1XX0 A;  1EGX A;  1Y5O A;  4DX9 0;  1PFJ A;  2P0D A;  5C5B B;  1K5D B;  4GMV A;  1FB8 A;  1E5W A;  1H10 A;  5HE3 A;  2ELB A;  2YRY A;  4HB2 B;  4GZU A;  3ZVR A;  2V76 A;  1V5U A;  1OMW A;  2YVC A;  3SO6 A;  5LOP B;  1DDW A;  2I5C A;  3ML4 A;  4HAY B;  1NTY A;  2J59 M;  3G9W A;  1V89 A;  2UZR A;  3P7Z A;  1FOE A;  2GCJ A;  2EC1 A;  1WJM A;  2KUP A;  2OTX A;  1SHC A;  2Q13 A;  1ZM0 A;  2GJY A;  1J0W A;  2ROV A;  1MK7 B;  1MPH A;  4TYZ A;  4YON A;  3HW2 B;  3SNH A;  2R09 A;  2D11 A;  1EVH A;  5GOW B;  3HQC A;  5JHG A;  1DBH A;  3X23 A;  4WVF B;  3O96 A;  1U5F A;  1M7R A;  4GMX B;  2YSZ A;  2J0K A;  1P6S A;  4HHV A;  2EMS A;  2HE7 A;  5DH9 B;  2Y7B A;  4EJN A;  5D3V A;  4K81 A;  2J0J A;  2I1J A;  3PVU A;  2D9Y A;  1GC6 A;  3NSU A;  1U2B A;  2CY4 A;  3SV1 A;  4PNK A;  5HE0 A;  1XCG A;  3RCP A;  1QC6 A;  3BJI A;  3D8E A;  4TKN A;  5JLJ B;  5HE2 A;  4ZRK A;  2DN6 A;  1I7A A;  2VSZ A;  3FEH A;  1IRS A;  4F7G A;  2RVB B;  4B6H A;  3ULB A;  2L1C A;  5D3X A;  1UPR A;  2DLW A;  1MAI A;  1UPQ A;  2K00 A;  1WI1 A;  2VKI A;  2GCL A;  1ZC4 B;  5D27 A;  5D3Y A;  1TXD A;  3VIA A;  1UNP A;  1FGZ A;  5EFX A;  2DHJ A;  1BTK A;  1GC7 A;  2UZS A;  2COD A;  1W1G A;  1H4R A;  4GPT B;  5DI9 B;  3P6A A;  1Y19 B;  4NY0 A;  5C6R A;  1PLS A;  5FI1 A;  2DX5 A;  4KHB B;  3CXB B;  3PZD A;  1OQN A;  3U7D A;  3AU5 A;  2Y8F A;  3VOQ A;  2OQB A;  1MIX A;  4Z2N A;  3LJU X;  1P3R A;  2J0M A;  1KZG A;  2AL6 A;  3A8P A;  1RJ2 A;  1DDV A;  2COC A;  5KQ1 A;  1X05 A;  2RNR B;  3A98 B;  1UNR A;  2FJL A;  2ADZ A;  4YL8 A;  3AJ4 A;  2DHI A;  2MDX A;  5C16 A;  2DKP A;  1DRO A;  2DYN A;  5HE1 A;  4EKU A;  2D9V A;  2RSG A;  1DDM A;  3TCA A;  1N3H A;  1B55 A;  2HTH B;  1U5G A;  4ZRJ A;  2W2W A;  2YF0 A;  2MFQ A;  3TVV A;  2QKM A;  1X1G A;  1FHW A;  3DXE A;  1TQZ A;  2AEH A;  2RLO A;  3ODW A;  1V61 A;  4ZRI A;  1WJ1 A;  2LOX A;  2M38 A;  1ZSQ A;  1P5T A;  1MKE A;  4L6E A;  1OY2 A;  1Z87 A;  1ZVR A;  1EF1 A;  1I2H A;  3V5W A;  2GS0 A;  1AWE A;  2NMB A;  2NZ8 B;  1TJ6 A;  2MKR A;  2EMT A;  2UVM A;  2IFS A;  5J3Y A;  5J3T A;  1W1D A;  1WGQ A;  1V88 A;  3A8Q A;  3AU4 A;  2Y8G A;  4PQ0 A;  2VRW B;  5DHF B;  1U5E A;  2YT1 A;  4HAZ B;  2KCJ A;  4F7U P;  1FGY A;  1U27 A;  1SGH A;  2Z0Q A;  3TO1 A;  3KRX A;  3ODX A;  2DHK A;  4GN1 A;  3SYX A;  4NSW A;  1BWN A;  2COA A;  4IOY X;  4EMO A;  2D2Q A;  2CRF A;  1ZC3 B;  3MDB C;  1NU2 A;  1J19 A;  1LB1 A;  3F0W A;  2W2X D;  4DBB A;  2G35 A;  2EJ8 A;  1UNQ A;  3HK0 A;  3ULC A;  3OAN A;  4A6F A;  4C0A A;  5KCV A;  2JP2 A;  5FI0 A;  2CAY A;  2YS5 A;  2P8V A;  4HAT B;  1FAO A;  2D10 A;  2LYD A;  3ODO A;  1WVH A;  3M1I B;  1Q67 A;  1U5D A;  3SUZ A;  4CHJ A;  3CIK A;  3KSY A;  1XOD A;  3IVF A;  2R0D A;  5JHH A;  2P0F A;  4HB0 B;  5CLL B;  3DXC A;  2LOZ A;  3PVL A;  1XR0 B;  4CHM A;  3TW1 A;  4H8S A;  4HDO A;  2DX1 A;  2DTC A;  2I5F A;  3UZT A;  3BIN A;  2DYQ A;  2D9W A;  1WGU A;  2RGN B;  4HAU B;  3PEG A;  1X86 A;  1FHX A;  1X11 A; 
#chains in the Genus database with same CATH topology
 4HDQ A;  4MT7 A;  3U8Z A;  4A6F B;  4MY6 A;  4KVG B;  1BAK A;  1K5G B;  3N7C A;  4BBK A;  3ZDT A;  5IRS A;  3D8F A;  4K2O A;  1PMS A;  1X1F A;  2M14 A;  3KRW A;  1LW3 A;  4KHO A;  4WSF A;  2ZPY A;  2W2X C;  4Y94 A;  1U29 A;  4HAV B;  1ISN A;  1KI1 B;  5C79 A;  2MWN B;  3KY9 A;  4DXA B;  4F7H A;  2P0H A;  2Z4D A;  2IYB A;  2ELA A;  1RRP B;  4HAX B;  1NTV A;  5DIF B;  4WJ7 A;  2YT0 A;  1XKE A;  1UEF A;  4GXB A;  2Z0O A;  5CLQ B;  4QJ3 B;  1WG7 A;  1BTN A;  4D0N B;  1M7E A;  5JP4 A;  4A5K A;  2N23 A;  2YS1 A;  3MPX A;  4KHA A;  5I2S A;  2R2Y A;  3FSS A;  2PZ1 A;  3A58 A;  2LG1 A;  3D8D A;  2CY5 A;  4A6K A;  1V5P A;  4QJ4 B;  1FHO A;  1W1H A;  1XD4 A;  3F5R A;  2N0Y A;  2L2I A;  5KQ4 A;  4Z2M B;  1MIZ B;  4IFS A;  4QXA B;  2Z0P A;  2RUK B;  4HB3 B;  1DYN A;  4KAX B;  1MI1 A;  3WA0 A;  3T06 A;  3GYP A;  4GNK B;  5LON B;  3PP2 A;  5DHA B;  4K2P A;  2D9Z A;  4XWX A;  5J3Q A;  1KZ7 A;  2ROZ B;  1EAZ A;  4A6H A;  1NI2 A;  2BCJ A;  3KZ1 A;  3QIJ A;  5L81 A;  3GYO A;  2YS3 A;  2FJU B;  4HAW B;  2K49 A;  4IAP A;  2Z14 A;  3NWF A;  4CYE A;  3HIE A;  4MK0 A;  2E2X A;  3FM8 C;  3PVW A;  2DFK A;  3QWM A;  2X18 A;  2D4Q A;  1MK9 B;  2QKL A;  2DKQ A;  1V5M A;  2NBV A;  2LUL A;  2K2J A;  2LKO A;  2D9X A;  2KGX B;  3PG7 A;  3WYF B;  4K17 A;  4OT1 A;  3QBV B;  3TFM A;  1QQG A;  1GG3 A;  2H7D A;  2K2U A;  2COF A;  2I1K A;  2XQN M;  5C5B A;  3PSC A;  4DX8 A;  4HB4 B;  3DXD A;  2H7E A;  4P7I A;  5D3W A;  5I2M A;  2DA0 A;  1AQC A;  1XX0 A;  1EGX A;  1T77 A;  1Y5O A;  4DX9 0;  1PFJ A;  2P0D A;  5C5B B;  1K5D B;  4GMV A;  1FB8 A;  1E5W A;  1H10 A;  5HE3 A;  2ELB A;  2YRY A;  4HB2 B;  4GZU A;  3ZVR A;  2V76 A;  1V5U A;  1OMW A;  2KIE A;  2YVC A;  3SO6 A;  5LOP B;  5LG4 B;  1DDW A;  2I5C A;  3ML4 A;  2GUM A;  4HAY B;  1NTY A;  2J59 M;  3G9W A;  1V89 A;  2UZR A;  3P7Z A;  1FOE A;  3B77 A;  2GCJ A;  2EC1 A;  1WJM A;  2KUP A;  2OTX A;  1SHC A;  2Q13 A;  1ZM0 A;  2GJY A;  1J0W A;  2ROV A;  3NWA A;  1MK7 B;  1MPH A;  2KR0 A;  4TYZ A;  4YON A;  3HW2 B;  3SNH A;  4GOU A;  2R09 A;  2D11 A;  1EVH A;  5GOW B;  3HQC A;  5JHG A;  1DBH A;  3X23 A;  4WVF B;  3O96 A;  1U5F A;  3HSA A;  1M7R A;  4GMX B;  2YSZ A;  2J0K A;  1P6S A;  4HHV A;  2EMS A;  2HE7 A;  5DH9 B;  4CSQ A;  2Y7B A;  4EJN A;  4D6W A;  5D3V A;  2J0J A;  4K81 A;  2I1J A;  3PVU A;  2D9Y A;  1GC6 A;  3NSU A;  1U2B A;  2CY4 A;  3SV1 A;  4PNK A;  5HE0 A;  1XCG A;  3RCP A;  1QC6 A;  3BJI A;  3OHM B;  3D8E A;  4TKN A;  5JLJ B;  5HE2 A;  4ZRK A;  2DN6 A;  1I7A A;  2VSZ A;  3FEH A;  1IRS A;  4F7G A;  2RVB B;  4B6H A;  3ULB A;  2L1C A;  5D3X A;  1UPR A;  2DLW A;  1MAI A;  1UPQ A;  2K00 A;  1WI1 A;  2VKI A;  2GCL A;  1ZC4 B;  5D27 A;  5D3Y A;  1TXD A;  3VIA A;  1UNP A;  1FGZ A;  5EFX A;  2DHJ A;  1BTK A;  2K8E A;  1GC7 A;  2UZS A;  2ZKM X;  2COD A;  3DCX A;  4DIX A;  1W1G A;  1H4R A;  4GPT B;  5DI9 B;  3P6A A;  1Y19 B;  4NY0 A;  5C6R A;  1PLS A;  5FI1 A;  2DX5 A;  4KHB B;  3CXB B;  3PZD A;  1OQN A;  3U7D A;  3AU5 A;  2Y8F A;  3VOQ A;  2OQB A;  1MIX A;  4Z2N A;  3LJU X;  1P3R A;  2J0M A;  1KZG A;  2AL6 A;  3A8P A;  4OSN A;  1RJ2 A;  1DDV A;  2COC A;  5KQ1 A;  1X05 A;  2RNR B;  3A98 B;  4QJ5 B;  1UNR A;  2FJL A;  2ADZ A;  4YL8 A;  3AJ4 A;  2DHI A;  2MDX A;  3NWD A;  5C16 A;  2DKP A;  2Z59 A;  1DRO A;  2DYN A;  5HE1 A;  4EKU A;  2D9V A;  2RSG A;  1DDM A;  3TCA A;  1N3H A;  1B55 A;  2HTH B;  1U5G A;  4KHB A;  4ZRJ A;  2W2W A;  2YF0 A;  2MFQ A;  2KIG A;  3TVV A;  2QKM A;  1X1G A;  1FHW A;  3DXE A;  1TQZ A;  2AEH A;  2RLO A;  3ODW A;  1V61 A;  4ZRI A;  1WJ1 A;  2LOX A;  2M38 A;  1ZSQ A;  4HSI A;  2YT2 A;  1P5T A;  1MKE A;  4L6E A;  1OY2 A;  1Z87 A;  1ZVR A;  1EF1 A;  1I2H A;  3V5W A;  2GS0 A;  1AWE A;  2NMB A;  2NZ8 B;  1TJ6 A;  2MKR A;  2EMT A;  2UVM A;  1ZYI A;  2IFS A;  5J3Y A;  5J3T A;  1W1D A;  1WGQ A;  2Z13 A;  1V88 A;  5M4Y B;  3A8Q A;  2RRF A;  3AU4 A;  2Y8G A;  4PQ0 A;  2VRW B;  5DHF B;  1U5E A;  2YT1 A;  4HAZ B;  2KCJ A;  4F7U P;  1FGY A;  1U27 A;  1SGH A;  2Z0Q A;  3TO1 A;  3KRX A;  3ODX A;  2DHK A;  4GN1 A;  3SYX A;  4NSW A;  2KUQ A;  1BWN A;  2COA A;  4IOY X;  4EMO A;  2D2Q A;  2CRF A;  4L1R A;  1ZC3 B;  3MDB C;  1NU2 A;  1J19 A;  1LB1 A;  3F0W A;  2W2X D;  4DBB A;  2G35 A;  2EJ8 A;  1UNQ A;  3HK0 A;  3ULC A;  3OAN A;  3U12 A;  3FVC A;  4A6F A;  4C0A A;  5KCV A;  2JP2 A;  5FI0 A;  2CAY A;  2YS5 A;  2P8V A;  4HAT B;  1FAO A;  2D10 A;  2LYD A;  3ODO A;  1WVH A;  3M1I B;  1Q67 A;  1U5D A;  3SUZ A;  4CHJ A;  3CIK A;  3KSY A;  1XOD A;  3IVF A;  2R0D A;  5JHH A;  2P0F A;  4HB0 B;  5CLL B;  3DXC A;  2LOZ A;  3PVL A;  1XR0 B;  4CHM A;  3TW1 A;  4H8S A;  4HDO A;  2DX1 A;  3NW8 A;  2DTC A;  2I5F A;  3UZT A;  3BIN A;  2DYQ A;  2D9W A;  1WGU A;  2RGN B;  4HAU B;  3PEG A;  1X86 A;  1FHX A;  1X11 A; 
#chains in the Genus database with same CATH homology
 4HDQ A;  4MT7 A;  3U8Z A;  4A6F B;  4MY6 A;  4KVG B;  1BAK A;  1K5G B;  3N7C A;  4BBK A;  3ZDT A;  3D8F A;  4K2O A;  1PMS A;  1X1F A;  2M14 A;  3KRW A;  1LW3 A;  4KHO A;  4WSF A;  2ZPY A;  2W2X C;  4Y94 A;  1U29 A;  4HAV B;  1ISN A;  1KI1 B;  5C79 A;  2MWN B;  3KY9 A;  4DXA B;  4F7H A;  2P0H A;  2IYB A;  2ELA A;  1RRP B;  4HAX B;  1NTV A;  5DIF B;  4WJ7 A;  2YT0 A;  1XKE A;  1UEF A;  4GXB A;  2Z0O A;  5CLQ B;  1WG7 A;  1BTN A;  4D0N B;  1M7E A;  5JP4 A;  4A5K A;  2N23 A;  2YS1 A;  3MPX A;  4KHA A;  3FSS A;  2PZ1 A;  2LG1 A;  3D8D A;  2CY5 A;  4A6K A;  1V5P A;  1FHO A;  1W1H A;  1XD4 A;  3F5R A;  2N0Y A;  2L2I A;  5KQ4 A;  4Z2M B;  1MIZ B;  4IFS A;  2Z0P A;  2RUK B;  4HB3 B;  1DYN A;  4KAX B;  3WA0 A;  3T06 A;  3GYP A;  5LON B;  3PP2 A;  5DHA B;  4K2P A;  2D9Z A;  4XWX A;  5J3Q A;  1KZ7 A;  2ROZ B;  1EAZ A;  4A6H A;  1NI2 A;  2BCJ A;  3KZ1 A;  3QIJ A;  5L81 A;  3GYO A;  2YS3 A;  4HAW B;  4IAP A;  4CYE A;  4MK0 A;  2E2X A;  3FM8 C;  3PVW A;  2DFK A;  3QWM A;  2X18 A;  2D4Q A;  1MK9 B;  2QKL A;  2DKQ A;  1V5M A;  2LUL A;  2K2J A;  2LKO A;  2D9X A;  2KGX B;  3PG7 A;  3WYF B;  4K17 A;  3QBV B;  3TFM A;  1QQG A;  1GG3 A;  2H7D A;  2K2U A;  2COF A;  2I1K A;  2XQN M;  5C5B A;  3PSC A;  4DX8 A;  4HB4 B;  3DXD A;  2H7E A;  4P7I A;  5D3W A;  2DA0 A;  1AQC A;  1XX0 A;  1EGX A;  1Y5O A;  4DX9 0;  1PFJ A;  2P0D A;  5C5B B;  1K5D B;  4GMV A;  1FB8 A;  1E5W A;  1H10 A;  5HE3 A;  2ELB A;  2YRY A;  4HB2 B;  4GZU A;  3ZVR A;  2V76 A;  1V5U A;  1OMW A;  2YVC A;  3SO6 A;  5LOP B;  1DDW A;  2I5C A;  3ML4 A;  4HAY B;  1NTY A;  2J59 M;  3G9W A;  1V89 A;  2UZR A;  3P7Z A;  1FOE A;  2GCJ A;  2EC1 A;  1WJM A;  2KUP A;  2OTX A;  1SHC A;  2Q13 A;  1ZM0 A;  2GJY A;  1J0W A;  2ROV A;  1MK7 B;  1MPH A;  4TYZ A;  4YON A;  3HW2 B;  3SNH A;  2R09 A;  2D11 A;  1EVH A;  5GOW B;  3HQC A;  5JHG A;  1DBH A;  3X23 A;  4WVF B;  3O96 A;  1U5F A;  1M7R A;  4GMX B;  2YSZ A;  2J0K A;  1P6S A;  4HHV A;  2EMS A;  2HE7 A;  5DH9 B;  2Y7B A;  4EJN A;  5D3V A;  4K81 A;  2J0J A;  2I1J A;  3PVU A;  2D9Y A;  1GC6 A;  3NSU A;  1U2B A;  2CY4 A;  3SV1 A;  4PNK A;  5HE0 A;  1XCG A;  3RCP A;  1QC6 A;  3BJI A;  3D8E A;  4TKN A;  5JLJ B;  5HE2 A;  4ZRK A;  2DN6 A;  1I7A A;  2VSZ A;  3FEH A;  1IRS A;  4F7G A;  2RVB B;  4B6H A;  3ULB A;  2L1C A;  5D3X A;  1UPR A;  2DLW A;  1MAI A;  1UPQ A;  2K00 A;  1WI1 A;  2VKI A;  2GCL A;  1ZC4 B;  5D27 A;  5D3Y A;  1TXD A;  3VIA A;  1UNP A;  1FGZ A;  5EFX A;  2DHJ A;  1BTK A;  1GC7 A;  2UZS A;  2COD A;  1W1G A;  1H4R A;  4GPT B;  5DI9 B;  3P6A A;  1Y19 B;  4NY0 A;  5C6R A;  1PLS A;  5FI1 A;  2DX5 A;  4KHB B;  3CXB B;  3PZD A;  1OQN A;  3U7D A;  3AU5 A;  2Y8F A;  3VOQ A;  2OQB A;  1MIX A;  4Z2N A;  3LJU X;  1P3R A;  2J0M A;  1KZG A;  2AL6 A;  3A8P A;  1RJ2 A;  1DDV A;  2COC A;  5KQ1 A;  1X05 A;  2RNR B;  3A98 B;  1UNR A;  2FJL A;  2ADZ A;  4YL8 A;  3AJ4 A;  2DHI A;  2MDX A;  5C16 A;  2DKP A;  1DRO A;  2DYN A;  5HE1 A;  4EKU A;  2D9V A;  2RSG A;  1DDM A;  3TCA A;  1N3H A;  1B55 A;  2HTH B;  1U5G A;  4ZRJ A;  2W2W A;  2YF0 A;  2MFQ A;  3TVV A;  2QKM A;  1X1G A;  1FHW A;  3DXE A;  1TQZ A;  2AEH A;  2RLO A;  3ODW A;  1V61 A;  4ZRI A;  1WJ1 A;  2LOX A;  2M38 A;  1ZSQ A;  1P5T A;  1MKE A;  4L6E A;  1OY2 A;  1Z87 A;  1ZVR A;  1EF1 A;  1I2H A;  3V5W A;  2GS0 A;  1AWE A;  2NMB A;  2NZ8 B;  1TJ6 A;  2MKR A;  2EMT A;  2UVM A;  2IFS A;  5J3Y A;  5J3T A;  1W1D A;  1WGQ A;  1V88 A;  3A8Q A;  3AU4 A;  2Y8G A;  4PQ0 A;  2VRW B;  5DHF B;  1U5E A;  2YT1 A;  4HAZ B;  2KCJ A;  4F7U P;  1FGY A;  1U27 A;  1SGH A;  2Z0Q A;  3TO1 A;  3KRX A;  3ODX A;  2DHK A;  4GN1 A;  3SYX A;  4NSW A;  1BWN A;  2COA A;  4IOY X;  4EMO A;  2D2Q A;  2CRF A;  1ZC3 B;  3MDB C;  1NU2 A;  1J19 A;  1LB1 A;  3F0W A;  2W2X D;  4DBB A;  2G35 A;  2EJ8 A;  1UNQ A;  3HK0 A;  3ULC A;  3OAN A;  4A6F A;  4C0A A;  5KCV A;  2JP2 A;  5FI0 A;  2CAY A;  2YS5 A;  2P8V A;  4HAT B;  1FAO A;  2D10 A;  2LYD A;  3ODO A;  1WVH A;  3M1I B;  1Q67 A;  1U5D A;  3SUZ A;  4CHJ A;  3CIK A;  3KSY A;  1XOD A;  3IVF A;  2R0D A;  5JHH A;  2P0F A;  4HB0 B;  5CLL B;  3DXC A;  2LOZ A;  3PVL A;  1XR0 B;  4CHM A;  3TW1 A;  4H8S A;  4HDO A;  2DX1 A;  2DTC A;  2I5F A;  3UZT A;  3BIN A;  2DYQ A;  2D9W A;  1WGU A;  2RGN B;  4HAU B;  3PEG A;  1X86 A;  1FHX A;  1X11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...