2DA0A

Solution structure of the ph domain of pip2-dependent arf1 gtpase-activating protein from human
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
b'GSSGSSGYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALTMAFSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1
publication title Solution structure of the PH domain of PIP2-dependent ARF1 GTPase-activating protein from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2da0A00
2LYDA 3KY9A 1AWEA 3RCPA 1UPQA 2COFA 4EJNA 2GCJA 2M14A 4D0NB 2IYBA 2DN6A 4HAVB 4BBKA 4Y94A 2NZ8B 4PQ0A 1P5TA 4F7UP 5J3QA 1UPRA 2IFSA 4IOYX 2H7EA 1BTKA 3SNHA 2MFQA 2EJ8A 1EGXA 2DLWA 3ODXA 1OQNA 2Y8GA 3IVFA 1FHOA 2DKQA 3UZTA 2YVCA 3AU5A 5L81A 4IFSA 2RVBB 2OTXA 2J0MA 1SHCA 4HB2B 2AEHA 3PEGA 5CLQB 2GCLA 2YS5A 1TJ6A 2ELBA 1X11A 4TYZA 4DBBA 2Y8FA 1U29A 4NY0A 5C5BA 1V5MA 3V5WA 1WJ1A 1ZC4B 2X18A 4YONA 1GC6A 4A5KA 4Z2MB 3TW1A 1FB8A 5EFXA 2MDXA 2DHIA 1FHXA 1MKEA 4F7HA 1MK9B 3FM8C 4KHBB 1DYNA 5FI0A 2D9YA 4WVFB 4ZRKA 3ZVRA 2VKIA 2R09A 4CHJA 1P3RA 1U5DA 1U2BA 4A6HA 2Z0QA 2COCA 4WJ7A 2YRYA 4TKNA 1K5GB 1J19A 2ROZB 2YS1A 5CLLB 1QC6A 1WG7A 1MPHA 1UNPA 2G35A 4MT7A 4K17A 2DYNA 3TCAA 3GYOA 4GZUA 4C0AA 4GMVA 3X23A 2DX5A 3VIAA 3LJUX 3SUZA 1FGYA 2Q13A 1FGZA 4HB3B 5D3VA 3QWMA 1W1DA 1WI1A 1Z87A 1NI2A 3A98B 1U5FA 4HDOA 3T06A 3NSUA 4MK0A 2D11A 2EMTA 2UZSA 4KAXB 1DROA 1LB1A 4HAUB 4HHVA 5J3TA 1UNQA 3HK0A 2N0YA 4EKUA 2KGXB 5JHGA 3PP2A 2P0FA 1Y5OA 3OANA 4PNKA 1W1HA 2AL6A 4HDQA 2J0JA 1FAOA 3TVVA 1E5WA 2Z0OA 1GG3A 1U5EA 4ZRIA 1KZ7A 2NMBA 1V61A 1IRSA 3ULBA 2KUPA 5JHHA 1XX0A 2RNRB 2UZRA 4NSWA 3SYXA 3U7DA 2K2UA 3AU4A 5D3WA 4MY6A 2I5FA 3DXCA 4HAWB 2KCJA 2XQNM 3A8PA 4K81A 3BJIA 5LOPB 1K5DB 4H8SA 2CODA 3HQCA 5D27A 3D8DA 1EF1A 5C6RA 4HB0B 2ADZA 2J59M 4L6EA 1V5UA 2I1JA 1Q67A 1P6SA 2D10A 1XODA 3DXEA 1ISNA 2QKMA 1ZC3B 3ULCA 1BAKA 2D9ZA 3SV1A 1ZVRA 1NTYA 2LG1A 1J0WA 4ZRJA 5C16A 4KHOA 1DDWA 3G9WA 5D3XA 4Z2NA 4KHAA 4B6HA 1RJ2A 1WJMA 4GXBA 2EC1A 5JP4A 5HE1A 5KQ1A 1PMSA 2I1KA 4IAPA 2R0DA 1LW3A 1QQGA 2P8VA 2L1CA 4CYEA 2DFKA 4A6FA 1B55A 2D4QA 1U5GA 5DI9B 3FEHA 4K2OA 1AQCA 1I7AA 1KI1B 5DHFB 3KRXA 2RSGA 2Z0PA 5C5BB 3PZDA 3ODOA 4XWXA 4EMOA 1V88A 2CRFA 3PVWA 5LONB 2W2XC 3MPXA 1XCGA 2N23A 2J0KA 1V5PA 2W2XD 1XD4A 1ZSQA 2L2IA 2OQBA 2DKPA 4KVGB 5J3YA 1EVHA 1WGUA 3D8EA 2DTCA 2H7DA 1RRPB 3QBVB 4WSFA 2Y7BA 2ELAA 2GS0A 1UEFA 1OY2A 2D9VA 2UVMA 2CY4A 3O96A 3PVUA 3ZDTA 4A6KA 1H10A 2DX1A 3AJ4A 3TO1A 4HAYB 2W2WA 3BINA 3TFMA 4DX90 3GYPA 3DXDA 1PFJA 1WVHA 4HAZB 2E2XA 2I5CA 2FJLA 1ZM0A 2YT0A 3WYFB 2LKOA 5DIFB 4K2PA 1DDMA 2LULA 3ODWA 3P6AA 2MKRA 5HE2A 1NU2A 2P0DA 4GPTB 4YL8A 1U27A 2ZPYA 5HE0A 1TXDA 5DH9B 4P7IA 1M7RA 2DYQA 2QKLA 2YF0A 5C79A 1MAIA 2HE7A 1X86A 2JP2A 3F5RA 3KRWA 5KQ4A 2CY5A 2DHKA 5DHAB 2D2QA 5JLJB 1W1GA 3N7CA 2VRWB 2MWNB 3KSYA 2V76A 2K00A 2DHJA 4HAXB 1FHWA 2RLOA 2COAA 1XKEA 1EAZA 1TQZA 2EMSA 2YSZA 5KCVA 1FOEA 1UNRA 3PG7A 2D9WA 5D3YA 2RUKB 3VOQA 2GJYA 1XR0B 3SO6A 2YT1A 1DDVA 1WGQA 2LOZA 1MIZB 1PLSA 3CXBB 3QIJA 1BTNA 3CIKA 3WA0A 5GOWB 1M7EA 1V89A 5FI1A 2ROVA 2VSZA 1X1FA 2BCJA 1SGHA 3MDBC 4HATB 1I2HA 4F7GA 4DX8A 2RGNB 1MK7B 2D9XA 3A8QA 3F0WA 2PZ1A 1NTVA 3FSSA 1DBHA 3ML4A 1GC7A 4GMXB 3PVLA 1MIXA 2DA0A 1H4RA 1X1GA 3D8FA 3KZ1A 2HTHB 3P7ZA 2K2JA 3PSCA 3M1IB 5HE3A 4A6FB 2LOXA 4CHMA 2CAYA 1BWNA 4HB4B 1KZGA 3HW2B 2M38A 1N3HA 2YS3A 1Y19B 4GN1A 2P0HA 3U8ZA 1X05A 4DXAB 1OMWA
chains in the Genus database with same CATH superfamily
2LYDA 3HSAA 3KY9A 3NW8A 1AWEA 3RCPA 1UPQA 2COFA 4EJNA 2GCJA 1MI1A 2M14A 4D0NB 2IYBA 2DN6A 4HAVB 4BBKA 4Y94A 2NZ8B 4PQ0A 1P5TA 4F7UP 5J3QA 1UPRA 2IFSA 4IOYX 2H7EA 1BTKA 3SNHA 2MFQA 2EJ8A 4GOUA 1EGXA 2DLWA 3ODXA 1OQNA 2Y8GA 3IVFA 4D6WA 1FHOA 2DKQA 3UZTA 4HSIA 2YVCA 3AU5A 5L81A 4IFSA 2RVBB 2OTXA 2J0MA 1SHCA 4HB2B 2AEHA 3PEGA 5CLQB 2GCLA 2YS5A 1TJ6A 2ELBA 1X11A 4TYZA 4DBBA 2Y8FA 1U29A 4NY0A 5C5BA 1V5MA 3V5WA 2RRFA 1WJ1A 1ZC4B 2X18A 4YONA 1GC6A 4A5KA 4Z2MB 3TW1A 1FB8A 5EFXA 2MDXA 2DHIA 1FHXA 1MKEA 4F7HA 1MK9B 3FM8C 4KHBB 1DYNA 5FI0A 2D9YA 4CSQA 4WVFB 4ZRKA 3ZVRA 2VKIA 2R09A 4CHJA 1P3RA 1U5DA 1U2BA 4A6HA 2GUMA 4OT1A 3A58A 2Z0QA 2COCA 4WJ7A 2YRYA 4TKNA 1K5GB 1J19A 2ROZB 2YS1A 4DIXA 5CLLB 1QC6A 1WG7A 1MPHA 1UNPA 2G35A 4MT7A 4K17A 2DYNA 3TCAA 3GYOA 4GZUA 4C0AA 4GMVA 3X23A 2DX5A 3VIAA 3LJUX 3SUZA 1FGYA 2Q13A 1FGZA 4HB3B 5D3VA 3QWMA 1W1DA 1WI1A 4QJ4B 1Z87A 4GNKB 1NI2A 3A98B 1U5FA 4HDOA 3T06A 3NSUA 4MK0A 2D11A 2EMTA 2UZSA 4KAXB 1DROA 1LB1A 4HAUB 4HHVA 5J3TA 1UNQA 3HK0A 2N0YA 4EKUA 3NWDA 2KGXB 5JHGA 3PP2A 2P0FA 1Y5OA 3OANA 4PNKA 1W1HA 2AL6A 4HDQA 4QJ3B 2J0JA 1FAOA 3TVVA 1E5WA 2Z0OA 1GG3A 1U5EA 4ZRIA 3OHMB 1KZ7A 4OSNA 2NMBA 1V61A 1IRSA 3ULBA 2KUPA 5JHHA 1XX0A 2RNRB 2UZRA 4NSWA 3SYXA 3U7DA 2K2UA 3AU4A 5D3WA 4MY6A 2I5FA 3DXCA 1T77A 4HAWB 2KCJA 2XQNM 3A8PA 4K81A 3BJIA 5LOPB 1K5DB 4H8SA 2CODA 3HQCA 5D27A 3D8DA 1EF1A 5C6RA 4HB0B 2ADZA 2J59M 4L6EA 1V5UA 2I1JA 1Q67A 1P6SA 2D10A 1XODA 3DXEA 1ISNA 2QKMA 2KR0A 1ZC3B 1ZYIA 3ULCA 1BAKA 2D9ZA 3SV1A 1ZVRA 1NTYA 2Z13A 2LG1A 1J0WA 4ZRJA 5C16A 4KHOA 1DDWA 3G9WA 2KIEA 5D3XA 4Z2NA 4KHAA 4B6HA 1RJ2A 1WJMA 4GXBA 2EC1A 5JP4A 5HE1A 5KQ1A 1PMSA 2I1KA 4IAPA 2R0DA 1LW3A 1QQGA 2P8VA 2L1CA 4CYEA 2DFKA 4A6FA 1B55A 2D4QA 1U5GA 5DI9B 3FEHA 3HIEA 4K2OA 1AQCA 1I7AA 1KI1B 5DHFB 3KRXA 2RSGA 2Z0PA 5C5BB 3PZDA 3ODOA 4XWXA 4EMOA 1V88A 2CRFA 3PVWA 5LONB 2W2XC 3MPXA 1XCGA 2N23A 2J0KA 1V5PA 2W2XD 5I2SA 1XD4A 1ZSQA 2L2IA 2OQBA 2DKPA 4KVGB 5J3YA 1EVHA 1WGUA 3D8EA 2DTCA 2H7DA 1RRPB 3QBVB 4WSFA 2Y7BA 4QXAB 2ELAA 5I2MA 2GS0A 1UEFA 1OY2A 2D9VA 2UVMA 2CY4A 3O96A 3PVUA 3ZDTA 4A6KA 1H10A 2DX1A 2NBVA 3AJ4A 3TO1A 4HAYB 2W2WA 3BINA 3TFMA 5IRSA 5LG4B 4DX90 3GYPA 3DXDA 5M4YB 1PFJA 4L1RA 1WVHA 4HAZB 2E2XA 2I5CA 2FJLA 1ZM0A 2YT0A 3WYFB 2LKOA 5DIFB 4K2PA 1DDMA 2LULA 3ODWA 3P6AA 2MKRA 5HE2A 1NU2A 2P0DA 4GPTB 4YL8A 1U27A 2ZPYA 2Z14A 4KHBA 5HE0A 1TXDA 5DH9B 4P7IA 1M7RA 2DYQA 2QKLA 2YF0A 5C79A 2FJUB 1MAIA 2HE7A 1X86A 2JP2A 3F5RA 2KUQA 3KRWA 5KQ4A 2K8EA 2CY5A 2DHKA 5DHAB 2D2QA 5JLJB 1W1GA 3N7CA 2VRWB 2MWNB 2Z59A 2V76A 3KSYA 2K00A 2DHJA 3FVCA 4HAXB 1FHWA 2RLOA 2COAA 3B77A 1XKEA 1EAZA 1TQZA 2EMSA 2YSZA 2K49A 5KCVA 1FOEA 2ZKMX 1UNRA 3PG7A 2Z4DA 2D9WA 5D3YA 2RUKB 3VOQA 2GJYA 1XR0B 4QJ5B 3SO6A 2YT1A 1DDVA 1WGQA 2LOZA 1MIZB 1PLSA 3CXBB 3QIJA 2KIGA 1BTNA 3CIKA 3WA0A 5GOWB 1M7EA 1V89A 5FI1A 2ROVA 2VSZA 1X1FA 2BCJA 1SGHA 3MDBC 4HATB 1I2HA 2YT2A 4F7GA 4DX8A 2RGNB 1MK7B 2D9XA 3A8QA 3F0WA 2PZ1A 1NTVA 3FSSA 1DBHA 3ML4A 1GC7A 4GMXB 3PVLA 3U12A 1MIXA 2DA0A 1H4RA 1X1GA 3D8FA 3KZ1A 2HTHB 3P7ZA 2K2JA 3PSCA 3NWFA 3M1IB 3NWAA 5HE3A 4A6FB 2LOXA 4CHMA 2CAYA 1BWNA 4HB4B 1KZGA 3HW2B 2M38A 1N3HA 2YS3A 1Y19B 4GN1A 2R2YA 3DCXA 2P0HA 3U8ZA 1X05A 4DXAB 1OMWA
chains in the Genus database with same CATH topology
2LYDA 3KY9A 1AWEA 3RCPA 1UPQA 2COFA 4EJNA 2GCJA 2M14A 4D0NB 2IYBA 2DN6A 4HAVB 4BBKA 4Y94A 2NZ8B 4PQ0A 1P5TA 4F7UP 5J3QA 1UPRA 2IFSA 4IOYX 2H7EA 1BTKA 3SNHA 2MFQA 2EJ8A 1EGXA 2DLWA 3ODXA 1OQNA 2Y8GA 3IVFA 1FHOA 2DKQA 3UZTA 2YVCA 3AU5A 5L81A 4IFSA 2RVBB 2OTXA 2J0MA 1SHCA 4HB2B 2AEHA 3PEGA 5CLQB 2GCLA 2YS5A 1TJ6A 2ELBA 1X11A 4TYZA 4DBBA 2Y8FA 1U29A 4NY0A 5C5BA 1V5MA 3V5WA 1WJ1A 1ZC4B 2X18A 4YONA 1GC6A 4A5KA 4Z2MB 3TW1A 1FB8A 5EFXA 2MDXA 2DHIA 1FHXA 1MKEA 4F7HA 1MK9B 3FM8C 4KHBB 1DYNA 5FI0A 2D9YA 4WVFB 4ZRKA 3ZVRA 2VKIA 2R09A 4CHJA 1P3RA 1U5DA 1U2BA 4A6HA 2Z0QA 2COCA 4WJ7A 2YRYA 4TKNA 1K5GB 1J19A 2ROZB 2YS1A 5CLLB 1QC6A 1WG7A 1MPHA 1UNPA 2G35A 4MT7A 4K17A 2DYNA 3TCAA 3GYOA 4GZUA 4C0AA 4GMVA 3X23A 2DX5A 3VIAA 3LJUX 3SUZA 1FGYA 2Q13A 1FGZA 4HB3B 5D3VA 3QWMA 1W1DA 1WI1A 1Z87A 1NI2A 3A98B 1U5FA 4HDOA 3T06A 3NSUA 4MK0A 2D11A 2EMTA 2UZSA 4KAXB 1DROA 1LB1A 4HAUB 4HHVA 5J3TA 1UNQA 3HK0A 2N0YA 4EKUA 2KGXB 5JHGA 3PP2A 2P0FA 1Y5OA 3OANA 4PNKA 1W1HA 2AL6A 4HDQA 2J0JA 1FAOA 3TVVA 1E5WA 2Z0OA 1GG3A 1U5EA 4ZRIA 1KZ7A 2NMBA 1V61A 1IRSA 3ULBA 2KUPA 5JHHA 1XX0A 2RNRB 2UZRA 4NSWA 3SYXA 3U7DA 2K2UA 3AU4A 5D3WA 4MY6A 2I5FA 3DXCA 4HAWB 2KCJA 2XQNM 3A8PA 4K81A 3BJIA 5LOPB 1K5DB 4H8SA 2CODA 3HQCA 5D27A 3D8DA 1EF1A 5C6RA 4HB0B 2ADZA 2J59M 4L6EA 1V5UA 2I1JA 1Q67A 1P6SA 2D10A 1XODA 3DXEA 1ISNA 2QKMA 1ZC3B 3ULCA 1BAKA 2D9ZA 3SV1A 1ZVRA 1NTYA 2LG1A 1J0WA 4ZRJA 5C16A 4KHOA 1DDWA 3G9WA 5D3XA 4Z2NA 4KHAA 4B6HA 1RJ2A 1WJMA 4GXBA 2EC1A 5JP4A 5HE1A 5KQ1A 1PMSA 2I1KA 4IAPA 2R0DA 1LW3A 1QQGA 2P8VA 2L1CA 4CYEA 2DFKA 4A6FA 1B55A 2D4QA 1U5GA 5DI9B 3FEHA 4K2OA 1AQCA 1I7AA 1KI1B 5DHFB 3KRXA 2RSGA 2Z0PA 5C5BB 3PZDA 3ODOA 4XWXA 4EMOA 1V88A 2CRFA 3PVWA 5LONB 2W2XC 3MPXA 1XCGA 2N23A 2J0KA 1V5PA 2W2XD 1XD4A 1ZSQA 2L2IA 2OQBA 2DKPA 4KVGB 5J3YA 1EVHA 1WGUA 3D8EA 2DTCA 2H7DA 1RRPB 3QBVB 4WSFA 2Y7BA 2ELAA 2GS0A 1UEFA 1OY2A 2D9VA 2UVMA 2CY4A 3O96A 3PVUA 3ZDTA 4A6KA 1H10A 2DX1A 3AJ4A 3TO1A 4HAYB 2W2WA 3BINA 3TFMA 4DX90 3GYPA 3DXDA 1PFJA 1WVHA 4HAZB 2E2XA 2I5CA 2FJLA 1ZM0A 2YT0A 3WYFB 2LKOA 5DIFB 4K2PA 1DDMA 2LULA 3ODWA 3P6AA 2MKRA 5HE2A 1NU2A 2P0DA 4GPTB 4YL8A 1U27A 2ZPYA 5HE0A 1TXDA 5DH9B 4P7IA 1M7RA 2DYQA 2QKLA 2YF0A 5C79A 1MAIA 2HE7A 1X86A 2JP2A 3F5RA 3KRWA 5KQ4A 2CY5A 2DHKA 5DHAB 2D2QA 5JLJB 1W1GA 3N7CA 2VRWB 2MWNB 3KSYA 2V76A 2K00A 2DHJA 4HAXB 1FHWA 2RLOA 2COAA 1XKEA 1EAZA 1TQZA 2EMSA 2YSZA 5KCVA 1FOEA 1UNRA 3PG7A 2D9WA 5D3YA 2RUKB 3VOQA 2GJYA 1XR0B 3SO6A 2YT1A 1DDVA 1WGQA 2LOZA 1MIZB 1PLSA 3CXBB 3QIJA 1BTNA 3CIKA 3WA0A 5GOWB 1M7EA 1V89A 5FI1A 2ROVA 2VSZA 1X1FA 2BCJA 1SGHA 3MDBC 4HATB 1I2HA 4F7GA 4DX8A 2RGNB 1MK7B 2D9XA 3A8QA 3F0WA 2PZ1A 1NTVA 3FSSA 1DBHA 3ML4A 1GC7A 4GMXB 3PVLA 1MIXA 2DA0A 1H4RA 1X1GA 3D8FA 3KZ1A 2HTHB 3P7ZA 2K2JA 3PSCA 3M1IB 5HE3A 4A6FB 2LOXA 4CHMA 2CAYA 1BWNA 4HB4B 1KZGA 3HW2B 2M38A 1N3HA 2YS3A 1Y19B 4GN1A 2P0HA 3U8ZA 1X05A 4DXAB 1OMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYD A;  3KY9 A;  1AWE A;  3RCP A;  1UPQ A;  2COF A;  4EJN A;  2GCJ A;  2M14 A;  4D0N B;  2IYB A;  2DN6 A;  4HAV B;  4BBK A;  4Y94 A;  2NZ8 B;  4PQ0 A;  1P5T A;  4F7U P;  5J3Q A;  1UPR A;  2IFS A;  4IOY X;  2H7E A;  1BTK A;  3SNH A;  2MFQ A;  2EJ8 A;  1EGX A;  2DLW A;  3ODX A;  1OQN A;  2Y8G A;  3IVF A;  1FHO A;  2DKQ A;  3UZT A;  2YVC A;  3AU5 A;  5L81 A;  4IFS A;  2RVB B;  2OTX A;  2J0M A;  1SHC A;  4HB2 B;  2AEH A;  3PEG A;  5CLQ B;  2GCL A;  2YS5 A;  1TJ6 A;  2ELB A;  1X11 A;  4TYZ A;  4DBB A;  2Y8F A;  1U29 A;  4NY0 A;  5C5B A;  1V5M A;  3V5W A;  1WJ1 A;  1ZC4 B;  2X18 A;  4YON A;  1GC6 A;  4A5K A;  4Z2M B;  3TW1 A;  1FB8 A;  5EFX A;  2MDX A;  2DHI A;  1FHX A;  1MKE A;  4F7H A;  1MK9 B;  3FM8 C;  4KHB B;  1DYN A;  5FI0 A;  2D9Y A;  4WVF B;  4ZRK A;  3ZVR A;  2VKI A;  2R09 A;  4CHJ A;  1P3R A;  1U5D A;  1U2B A;  4A6H A;  2Z0Q A;  2COC A;  4WJ7 A;  2YRY A;  4TKN A;  1K5G B;  1J19 A;  2ROZ B;  2YS1 A;  5CLL B;  1QC6 A;  1WG7 A;  1MPH A;  1UNP A;  2G35 A;  4MT7 A;  4K17 A;  2DYN A;  3TCA A;  3GYO A;  4GZU A;  4C0A A;  4GMV A;  3X23 A;  2DX5 A;  3VIA A;  3LJU X;  3SUZ A;  1FGY A;  2Q13 A;  1FGZ A;  4HB3 B;  5D3V A;  3QWM A;  1W1D A;  1WI1 A;  1Z87 A;  1NI2 A;  3A98 B;  1U5F A;  4HDO A;  3T06 A;  3NSU A;  4MK0 A;  2D11 A;  2EMT A;  2UZS A;  4KAX B;  1DRO A;  1LB1 A;  4HAU B;  4HHV A;  5J3T A;  1UNQ A;  3HK0 A;  2N0Y A;  4EKU A;  2KGX B;  5JHG A;  3PP2 A;  2P0F A;  1Y5O A;  3OAN A;  4PNK A;  1W1H A;  2AL6 A;  4HDQ A;  2J0J A;  1FAO A;  3TVV A;  1E5W A;  2Z0O A;  1GG3 A;  1U5E A;  4ZRI A;  1KZ7 A;  2NMB A;  1V61 A;  1IRS A;  3ULB A;  2KUP A;  5JHH A;  1XX0 A;  2RNR B;  2UZR A;  4NSW A;  3SYX A;  3U7D A;  2K2U A;  3AU4 A;  5D3W A;  4MY6 A;  2I5F A;  3DXC A;  4HAW B;  2KCJ A;  2XQN M;  3A8P A;  4K81 A;  3BJI A;  5LOP B;  1K5D B;  4H8S A;  2COD A;  3HQC A;  5D27 A;  3D8D A;  1EF1 A;  5C6R A;  4HB0 B;  2ADZ A;  2J59 M;  4L6E A;  1V5U A;  2I1J A;  1Q67 A;  1P6S A;  2D10 A;  1XOD A;  3DXE A;  1ISN A;  2QKM A;  1ZC3 B;  3ULC A;  1BAK A;  2D9Z A;  3SV1 A;  1ZVR A;  1NTY A;  2LG1 A;  1J0W A;  4ZRJ A;  5C16 A;  4KHO A;  1DDW A;  3G9W A;  5D3X A;  4Z2N A;  4KHA A;  4B6H A;  1RJ2 A;  1WJM A;  4GXB A;  2EC1 A;  5JP4 A;  5HE1 A;  5KQ1 A;  1PMS A;  2I1K A;  4IAP A;  2R0D A;  1LW3 A;  1QQG A;  2P8V A;  2L1C A;  4CYE A;  2DFK A;  4A6F A;  1B55 A;  2D4Q A;  1U5G A;  5DI9 B;  3FEH A;  4K2O A;  1AQC A;  1I7A A;  1KI1 B;  5DHF B;  3KRX A;  2RSG A;  2Z0P A;  5C5B B;  3PZD A;  3ODO A;  4XWX A;  4EMO A;  1V88 A;  2CRF A;  3PVW A;  5LON B;  2W2X C;  3MPX A;  1XCG A;  2N23 A;  2J0K A;  1V5P A;  2W2X D;  1XD4 A;  1ZSQ A;  2L2I A;  2OQB A;  2DKP A;  4KVG B;  5J3Y A;  1EVH A;  1WGU A;  3D8E A;  2DTC A;  2H7D A;  1RRP B;  3QBV B;  4WSF A;  2Y7B A;  2ELA A;  2GS0 A;  1UEF A;  1OY2 A;  2D9V A;  2UVM A;  2CY4 A;  3O96 A;  3PVU A;  3ZDT A;  4A6K A;  1H10 A;  2DX1 A;  3AJ4 A;  3TO1 A;  4HAY B;  2W2W A;  3BIN A;  3TFM A;  4DX9 0;  3GYP A;  3DXD A;  1PFJ A;  1WVH A;  4HAZ B;  2E2X A;  2I5C A;  2FJL A;  1ZM0 A;  2YT0 A;  3WYF B;  2LKO A;  5DIF B;  4K2P A;  1DDM A;  2LUL A;  3ODW A;  3P6A A;  2MKR A;  5HE2 A;  1NU2 A;  2P0D A;  4GPT B;  4YL8 A;  1U27 A;  2ZPY A;  5HE0 A;  1TXD A;  5DH9 B;  4P7I A;  1M7R A;  2DYQ A;  2QKL A;  2YF0 A;  5C79 A;  1MAI A;  2HE7 A;  1X86 A;  2JP2 A;  3F5R A;  3KRW A;  5KQ4 A;  2CY5 A;  2DHK A;  5DHA B;  2D2Q A;  5JLJ B;  1W1G A;  3N7C A;  2VRW B;  2MWN B;  3KSY A;  2V76 A;  2K00 A;  2DHJ A;  4HAX B;  1FHW A;  2RLO A;  2COA A;  1XKE A;  1EAZ A;  1TQZ A;  2EMS A;  2YSZ A;  5KCV A;  1FOE A;  1UNR A;  3PG7 A;  2D9W A;  5D3Y A;  2RUK B;  3VOQ A;  2GJY A;  1XR0 B;  3SO6 A;  2YT1 A;  1DDV A;  1WGQ A;  2LOZ A;  1MIZ B;  1PLS A;  3CXB B;  3QIJ A;  1BTN A;  3CIK A;  3WA0 A;  5GOW B;  1M7E A;  1V89 A;  5FI1 A;  2ROV A;  2VSZ A;  1X1F A;  2BCJ A;  1SGH A;  3MDB C;  4HAT B;  1I2H A;  4F7G A;  4DX8 A;  2RGN B;  1MK7 B;  2D9X A;  3A8Q A;  3F0W A;  2PZ1 A;  1NTV A;  3FSS A;  1DBH A;  3ML4 A;  1GC7 A;  4GMX B;  3PVL A;  1MIX A;  2DA0 A;  1H4R A;  1X1G A;  3D8F A;  3KZ1 A;  2HTH B;  3P7Z A;  2K2J A;  3PSC A;  3M1I B;  5HE3 A;  4A6F B;  2LOX A;  4CHM A;  2CAY A;  1BWN A;  4HB4 B;  1KZG A;  3HW2 B;  2M38 A;  1N3H A;  2YS3 A;  1Y19 B;  4GN1 A;  2P0H A;  3U8Z A;  1X05 A;  4DXA B;  1OMW A; 
#chains in the Genus database with same CATH topology
 2LYD A;  3HSA A;  3KY9 A;  3NW8 A;  1AWE A;  3RCP A;  1UPQ A;  2COF A;  4EJN A;  2GCJ A;  1MI1 A;  2M14 A;  4D0N B;  2IYB A;  2DN6 A;  4HAV B;  4BBK A;  4Y94 A;  2NZ8 B;  4PQ0 A;  1P5T A;  4F7U P;  5J3Q A;  1UPR A;  2IFS A;  4IOY X;  2H7E A;  1BTK A;  3SNH A;  2MFQ A;  2EJ8 A;  4GOU A;  1EGX A;  2DLW A;  3ODX A;  1OQN A;  2Y8G A;  3IVF A;  4D6W A;  1FHO A;  2DKQ A;  3UZT A;  4HSI A;  2YVC A;  3AU5 A;  5L81 A;  4IFS A;  2RVB B;  2OTX A;  2J0M A;  1SHC A;  4HB2 B;  2AEH A;  3PEG A;  5CLQ B;  2GCL A;  2YS5 A;  1TJ6 A;  2ELB A;  1X11 A;  4TYZ A;  4DBB A;  2Y8F A;  1U29 A;  4NY0 A;  5C5B A;  1V5M A;  3V5W A;  2RRF A;  1WJ1 A;  1ZC4 B;  2X18 A;  4YON A;  1GC6 A;  4A5K A;  4Z2M B;  3TW1 A;  1FB8 A;  5EFX A;  2MDX A;  2DHI A;  1FHX A;  1MKE A;  4F7H A;  1MK9 B;  3FM8 C;  4KHB B;  1DYN A;  5FI0 A;  2D9Y A;  4CSQ A;  4WVF B;  4ZRK A;  3ZVR A;  2VKI A;  2R09 A;  4CHJ A;  1P3R A;  1U5D A;  1U2B A;  4A6H A;  2GUM A;  4OT1 A;  3A58 A;  2Z0Q A;  2COC A;  4WJ7 A;  2YRY A;  4TKN A;  1K5G B;  1J19 A;  2ROZ B;  2YS1 A;  4DIX A;  5CLL B;  1QC6 A;  1WG7 A;  1MPH A;  1UNP A;  2G35 A;  4MT7 A;  4K17 A;  2DYN A;  3TCA A;  3GYO A;  4GZU A;  4C0A A;  4GMV A;  3X23 A;  2DX5 A;  3VIA A;  3LJU X;  3SUZ A;  1FGY A;  2Q13 A;  1FGZ A;  4HB3 B;  5D3V A;  3QWM A;  1W1D A;  1WI1 A;  4QJ4 B;  1Z87 A;  4GNK B;  1NI2 A;  3A98 B;  1U5F A;  4HDO A;  3T06 A;  3NSU A;  4MK0 A;  2D11 A;  2EMT A;  2UZS A;  4KAX B;  1DRO A;  1LB1 A;  4HAU B;  4HHV A;  5J3T A;  1UNQ A;  3HK0 A;  2N0Y A;  4EKU A;  3NWD A;  2KGX B;  5JHG A;  3PP2 A;  2P0F A;  1Y5O A;  3OAN A;  4PNK A;  1W1H A;  2AL6 A;  4HDQ A;  4QJ3 B;  2J0J A;  1FAO A;  3TVV A;  1E5W A;  2Z0O A;  1GG3 A;  1U5E A;  4ZRI A;  3OHM B;  1KZ7 A;  4OSN A;  2NMB A;  1V61 A;  1IRS A;  3ULB A;  2KUP A;  5JHH A;  1XX0 A;  2RNR B;  2UZR A;  4NSW A;  3SYX A;  3U7D A;  2K2U A;  3AU4 A;  5D3W A;  4MY6 A;  2I5F A;  3DXC A;  1T77 A;  4HAW B;  2KCJ A;  2XQN M;  3A8P A;  4K81 A;  3BJI A;  5LOP B;  1K5D B;  4H8S A;  2COD A;  3HQC A;  5D27 A;  3D8D A;  1EF1 A;  5C6R A;  4HB0 B;  2ADZ A;  2J59 M;  4L6E A;  1V5U A;  2I1J A;  1Q67 A;  1P6S A;  2D10 A;  1XOD A;  3DXE A;  1ISN A;  2QKM A;  2KR0 A;  1ZC3 B;  1ZYI A;  3ULC A;  1BAK A;  2D9Z A;  3SV1 A;  1ZVR A;  1NTY A;  2Z13 A;  2LG1 A;  1J0W A;  4ZRJ A;  5C16 A;  4KHO A;  1DDW A;  3G9W A;  2KIE A;  5D3X A;  4Z2N A;  4KHA A;  4B6H A;  1RJ2 A;  1WJM A;  4GXB A;  2EC1 A;  5JP4 A;  5HE1 A;  5KQ1 A;  1PMS A;  2I1K A;  4IAP A;  2R0D A;  1LW3 A;  1QQG A;  2P8V A;  2L1C A;  4CYE A;  2DFK A;  4A6F A;  1B55 A;  2D4Q A;  1U5G A;  5DI9 B;  3FEH A;  3HIE A;  4K2O A;  1AQC A;  1I7A A;  1KI1 B;  5DHF B;  3KRX A;  2RSG A;  2Z0P A;  5C5B B;  3PZD A;  3ODO A;  4XWX A;  4EMO A;  1V88 A;  2CRF A;  3PVW A;  5LON B;  2W2X C;  3MPX A;  1XCG A;  2N23 A;  2J0K A;  1V5P A;  2W2X D;  5I2S A;  1XD4 A;  1ZSQ A;  2L2I A;  2OQB A;  2DKP A;  4KVG B;  5J3Y A;  1EVH A;  1WGU A;  3D8E A;  2DTC A;  2H7D A;  1RRP B;  3QBV B;  4WSF A;  2Y7B A;  4QXA B;  2ELA A;  5I2M A;  2GS0 A;  1UEF A;  1OY2 A;  2D9V A;  2UVM A;  2CY4 A;  3O96 A;  3PVU A;  3ZDT A;  4A6K A;  1H10 A;  2DX1 A;  2NBV A;  3AJ4 A;  3TO1 A;  4HAY B;  2W2W A;  3BIN A;  3TFM A;  5IRS A;  5LG4 B;  4DX9 0;  3GYP A;  3DXD A;  5M4Y B;  1PFJ A;  4L1R A;  1WVH A;  4HAZ B;  2E2X A;  2I5C A;  2FJL A;  1ZM0 A;  2YT0 A;  3WYF B;  2LKO A;  5DIF B;  4K2P A;  1DDM A;  2LUL A;  3ODW A;  3P6A A;  2MKR A;  5HE2 A;  1NU2 A;  2P0D A;  4GPT B;  4YL8 A;  1U27 A;  2ZPY A;  2Z14 A;  4KHB A;  5HE0 A;  1TXD A;  5DH9 B;  4P7I A;  1M7R A;  2DYQ A;  2QKL A;  2YF0 A;  5C79 A;  2FJU B;  1MAI A;  2HE7 A;  1X86 A;  2JP2 A;  3F5R A;  2KUQ A;  3KRW A;  5KQ4 A;  2K8E A;  2CY5 A;  2DHK A;  5DHA B;  2D2Q A;  5JLJ B;  1W1G A;  3N7C A;  2VRW B;  2MWN B;  2Z59 A;  2V76 A;  3KSY A;  2K00 A;  2DHJ A;  3FVC A;  4HAX B;  1FHW A;  2RLO A;  2COA A;  3B77 A;  1XKE A;  1EAZ A;  1TQZ A;  2EMS A;  2YSZ A;  2K49 A;  5KCV A;  1FOE A;  2ZKM X;  1UNR A;  3PG7 A;  2Z4D A;  2D9W A;  5D3Y A;  2RUK B;  3VOQ A;  2GJY A;  1XR0 B;  4QJ5 B;  3SO6 A;  2YT1 A;  1DDV A;  1WGQ A;  2LOZ A;  1MIZ B;  1PLS A;  3CXB B;  3QIJ A;  2KIG A;  1BTN A;  3CIK A;  3WA0 A;  5GOW B;  1M7E A;  1V89 A;  5FI1 A;  2ROV A;  2VSZ A;  1X1F A;  2BCJ A;  1SGH A;  3MDB C;  4HAT B;  1I2H A;  2YT2 A;  4F7G A;  4DX8 A;  2RGN B;  1MK7 B;  2D9X A;  3A8Q A;  3F0W A;  2PZ1 A;  1NTV A;  3FSS A;  1DBH A;  3ML4 A;  1GC7 A;  4GMX B;  3PVL A;  3U12 A;  1MIX A;  2DA0 A;  1H4R A;  1X1G A;  3D8F A;  3KZ1 A;  2HTH B;  3P7Z A;  2K2J A;  3PSC A;  3NWF A;  3M1I B;  3NWA A;  5HE3 A;  4A6F B;  2LOX A;  4CHM A;  2CAY A;  1BWN A;  4HB4 B;  1KZG A;  3HW2 B;  2M38 A;  1N3H A;  2YS3 A;  1Y19 B;  4GN1 A;  2R2Y A;  3DCX A;  2P0H A;  3U8Z A;  1X05 A;  4DXA B;  1OMW A; 
#chains in the Genus database with same CATH homology
 2LYD A;  3KY9 A;  1AWE A;  3RCP A;  1UPQ A;  2COF A;  4EJN A;  2GCJ A;  2M14 A;  4D0N B;  2IYB A;  2DN6 A;  4HAV B;  4BBK A;  4Y94 A;  2NZ8 B;  4PQ0 A;  1P5T A;  4F7U P;  5J3Q A;  1UPR A;  2IFS A;  4IOY X;  2H7E A;  1BTK A;  3SNH A;  2MFQ A;  2EJ8 A;  1EGX A;  2DLW A;  3ODX A;  1OQN A;  2Y8G A;  3IVF A;  1FHO A;  2DKQ A;  3UZT A;  2YVC A;  3AU5 A;  5L81 A;  4IFS A;  2RVB B;  2OTX A;  2J0M A;  1SHC A;  4HB2 B;  2AEH A;  3PEG A;  5CLQ B;  2GCL A;  2YS5 A;  1TJ6 A;  2ELB A;  1X11 A;  4TYZ A;  4DBB A;  2Y8F A;  1U29 A;  4NY0 A;  5C5B A;  1V5M A;  3V5W A;  1WJ1 A;  1ZC4 B;  2X18 A;  4YON A;  1GC6 A;  4A5K A;  4Z2M B;  3TW1 A;  1FB8 A;  5EFX A;  2MDX A;  2DHI A;  1FHX A;  1MKE A;  4F7H A;  1MK9 B;  3FM8 C;  4KHB B;  1DYN A;  5FI0 A;  2D9Y A;  4WVF B;  4ZRK A;  3ZVR A;  2VKI A;  2R09 A;  4CHJ A;  1P3R A;  1U5D A;  1U2B A;  4A6H A;  2Z0Q A;  2COC A;  4WJ7 A;  2YRY A;  4TKN A;  1K5G B;  1J19 A;  2ROZ B;  2YS1 A;  5CLL B;  1QC6 A;  1WG7 A;  1MPH A;  1UNP A;  2G35 A;  4MT7 A;  4K17 A;  2DYN A;  3TCA A;  3GYO A;  4GZU A;  4C0A A;  4GMV A;  3X23 A;  2DX5 A;  3VIA A;  3LJU X;  3SUZ A;  1FGY A;  2Q13 A;  1FGZ A;  4HB3 B;  5D3V A;  3QWM A;  1W1D A;  1WI1 A;  1Z87 A;  1NI2 A;  3A98 B;  1U5F A;  4HDO A;  3T06 A;  3NSU A;  4MK0 A;  2D11 A;  2EMT A;  2UZS A;  4KAX B;  1DRO A;  1LB1 A;  4HAU B;  4HHV A;  5J3T A;  1UNQ A;  3HK0 A;  2N0Y A;  4EKU A;  2KGX B;  5JHG A;  3PP2 A;  2P0F A;  1Y5O A;  3OAN A;  4PNK A;  1W1H A;  2AL6 A;  4HDQ A;  2J0J A;  1FAO A;  3TVV A;  1E5W A;  2Z0O A;  1GG3 A;  1U5E A;  4ZRI A;  1KZ7 A;  2NMB A;  1V61 A;  1IRS A;  3ULB A;  2KUP A;  5JHH A;  1XX0 A;  2RNR B;  2UZR A;  4NSW A;  3SYX A;  3U7D A;  2K2U A;  3AU4 A;  5D3W A;  4MY6 A;  2I5F A;  3DXC A;  4HAW B;  2KCJ A;  2XQN M;  3A8P A;  4K81 A;  3BJI A;  5LOP B;  1K5D B;  4H8S A;  2COD A;  3HQC A;  5D27 A;  3D8D A;  1EF1 A;  5C6R A;  4HB0 B;  2ADZ A;  2J59 M;  4L6E A;  1V5U A;  2I1J A;  1Q67 A;  1P6S A;  2D10 A;  1XOD A;  3DXE A;  1ISN A;  2QKM A;  1ZC3 B;  3ULC A;  1BAK A;  2D9Z A;  3SV1 A;  1ZVR A;  1NTY A;  2LG1 A;  1J0W A;  4ZRJ A;  5C16 A;  4KHO A;  1DDW A;  3G9W A;  5D3X A;  4Z2N A;  4KHA A;  4B6H A;  1RJ2 A;  1WJM A;  4GXB A;  2EC1 A;  5JP4 A;  5HE1 A;  5KQ1 A;  1PMS A;  2I1K A;  4IAP A;  2R0D A;  1LW3 A;  1QQG A;  2P8V A;  2L1C A;  4CYE A;  2DFK A;  4A6F A;  1B55 A;  2D4Q A;  1U5G A;  5DI9 B;  3FEH A;  4K2O A;  1AQC A;  1I7A A;  1KI1 B;  5DHF B;  3KRX A;  2RSG A;  2Z0P A;  5C5B B;  3PZD A;  3ODO A;  4XWX A;  4EMO A;  1V88 A;  2CRF A;  3PVW A;  5LON B;  2W2X C;  3MPX A;  1XCG A;  2N23 A;  2J0K A;  1V5P A;  2W2X D;  1XD4 A;  1ZSQ A;  2L2I A;  2OQB A;  2DKP A;  4KVG B;  5J3Y A;  1EVH A;  1WGU A;  3D8E A;  2DTC A;  2H7D A;  1RRP B;  3QBV B;  4WSF A;  2Y7B A;  2ELA A;  2GS0 A;  1UEF A;  1OY2 A;  2D9V A;  2UVM A;  2CY4 A;  3O96 A;  3PVU A;  3ZDT A;  4A6K A;  1H10 A;  2DX1 A;  3AJ4 A;  3TO1 A;  4HAY B;  2W2W A;  3BIN A;  3TFM A;  4DX9 0;  3GYP A;  3DXD A;  1PFJ A;  1WVH A;  4HAZ B;  2E2X A;  2I5C A;  2FJL A;  1ZM0 A;  2YT0 A;  3WYF B;  2LKO A;  5DIF B;  4K2P A;  1DDM A;  2LUL A;  3ODW A;  3P6A A;  2MKR A;  5HE2 A;  1NU2 A;  2P0D A;  4GPT B;  4YL8 A;  1U27 A;  2ZPY A;  5HE0 A;  1TXD A;  5DH9 B;  4P7I A;  1M7R A;  2DYQ A;  2QKL A;  2YF0 A;  5C79 A;  1MAI A;  2HE7 A;  1X86 A;  2JP2 A;  3F5R A;  3KRW A;  5KQ4 A;  2CY5 A;  2DHK A;  5DHA B;  2D2Q A;  5JLJ B;  1W1G A;  3N7C A;  2VRW B;  2MWN B;  3KSY A;  2V76 A;  2K00 A;  2DHJ A;  4HAX B;  1FHW A;  2RLO A;  2COA A;  1XKE A;  1EAZ A;  1TQZ A;  2EMS A;  2YSZ A;  5KCV A;  1FOE A;  1UNR A;  3PG7 A;  2D9W A;  5D3Y A;  2RUK B;  3VOQ A;  2GJY A;  1XR0 B;  3SO6 A;  2YT1 A;  1DDV A;  1WGQ A;  2LOZ A;  1MIZ B;  1PLS A;  3CXB B;  3QIJ A;  1BTN A;  3CIK A;  3WA0 A;  5GOW B;  1M7E A;  1V89 A;  5FI1 A;  2ROV A;  2VSZ A;  1X1F A;  2BCJ A;  1SGH A;  3MDB C;  4HAT B;  1I2H A;  4F7G A;  4DX8 A;  2RGN B;  1MK7 B;  2D9X A;  3A8Q A;  3F0W A;  2PZ1 A;  1NTV A;  3FSS A;  1DBH A;  3ML4 A;  1GC7 A;  4GMX B;  3PVL A;  1MIX A;  2DA0 A;  1H4R A;  1X1G A;  3D8F A;  3KZ1 A;  2HTH B;  3P7Z A;  2K2J A;  3PSC A;  3M1I B;  5HE3 A;  4A6F B;  2LOX A;  4CHM A;  2CAY A;  1BWN A;  4HB4 B;  1KZG A;  3HW2 B;  2M38 A;  1N3H A;  2YS3 A;  1Y19 B;  4GN1 A;  2P0H A;  3U8Z A;  1X05 A;  4DXA B;  1OMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...