2DA0A

Solution structure of the ph domain of pip2-dependent arf1 gtpase-activating protein from human
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSSGSSGYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALTMAFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of PIP2-dependent ARF1 GTPase-activating protein from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2da0A00
5DI9B 1DYNA 1P6SA 1X86A 3PSCA 4NSWA 1SGHA 4WSFA 2QKMA 2EJ8A 2LULA 1X11A 2W2XC 2ROZB 2RGNB 3SUZA 5J3YA 4DBBA 2RLOA 1UPRA 4HDOA 1NI2A 3A8PA 4IOYX 1XKEA 5D3YA 2N0YA 1XD4A 2YVCA 5JHGA 4EJNA 2RVBB 3PVUA 2CAYA 2G35A 3OANA 3TVVA 1XODA 2MDXA 3M1IB 2YS5A 1NU2A 1EVHA 2RUKB 4K2OA 2UVMA 4L6EA 1J19A 2D9VA 3P7ZA 4TKNA 2P8VA 2HE7A 1Q67A 2NZ8B 4YONA 1BTNA 2AL6A 1TJ6A 2K2UA 2DLWA 2MWNB 2DYNA 2VRWB 3TFMA 2K00A 4HAZB 4HATB 1WJMA 3DXDA 5HE3A 2GCLA 2LOXA 2L2IA 3HW2B 5KQ4A 2D11A 1Z87A 4MY6A 1FB8A 3SO6A 1EGXA 2M38A 5DIFB 5D3VA 2Z0PA 2EMTA 1UNQA 3ULBA 4HAXB 1FGYA 2OQBA 1X1FA 5FI1A 2J0MA 4P7IA 4A6KA 2FJLA 1LW3A 3TCAA 5D3XA 4GPTB 1QQGA 3N7CA 2LYDA 5HE1A 4A6HA 5DH9B 2J0KA 1DDWA 5C16A 1WVHA 4PNKA 4HB0B 2ELAA 4B6HA 1KI1B 3DXCA 1Y5OA 1U5EA 2DTCA 1I2HA 2R0DA 3ML4A 1QC6A 4YL8A 3KY9A 2DKPA 4DX8A 4K17A 4H8SA 1V88A 2IYBA 2ADZA 1EAZA 2DA0A 5KQ1A 1WGUA 2GCJA 3KZ1A 2P0DA 1W1HA 5J3QA 2CODA 2MFQA 2Z0QA 4CYEA 1N3HA 1BWNA 1MAIA 3ODOA 2COFA 2GJYA 5L81A 2W2WA 1DDVA 1UEFA 1MPHA 1K5DB 3QIJA 3PZDA 2KUPA 1MKEA 2DX5A 3ODXA 1WGQA 2W2XD 3O96A 3A98B 2D2QA 2IFSA 1PMSA 2GS0A 5JHHA 4XWXA 2I1KA 4GZUA 1KZ7A 4KHAA 3TW1A 4GXBA 1IRSA 4GMXB 1V89A 2D9ZA 5J3TA 1ZM0A 2Z0OA 4WJ7A 2CRFA 2J0JA 1OMWA 5DHAB 1DBHA 2COAA 3GYPA 3SNHA 2P0FA 3U7DA 3KSYA 3QWMA 2LOZA 4CHJA 3LJUX 4MK0A 1V61A 2D10A 3HK0A 1WG7A 3RCPA 1AQCA 1H4RA 4Y94A 3BINA 2MKRA 2D4QA 2Y8FA 4F7HA 4C0AA 3IVFA 5C5BA 1MK9B 4EMOA 5FI0A 2BCJA 4HAWB 1MIXA 2RNRB 3F5RA 1FAOA 3D8EA 1V5PA 1K5GB 2DN6A 2DHIA 4GN1A 2LKOA 5CLLB 4HB2B 3U8ZA 3TO1A 3D8DA 3FEHA 2EC1A 1XX0A 1PLSA 2YRYA 2H7EA 4A6FA 2DYQA 2KGXB 1FHWA 2DHKA 4ZRIA 1FGZA 4DX90 1U2BA 2NMBA 3SYXA 2DHJA 4HAVB 3KRXA 3CXBB 3AU5A 2CY5A 3T06A 3PP2A 4F7UP 1U5GA 3FSSA 5D3WA 3D8FA 2D9XA 1B55A 4EKUA 1RJ2A 3NSUA 1OQNA 4TYZA 4IAPA 4IFSA 4Z2NA 2ZPYA 2KCJA 1PFJA 4KHBB 1UNPA 1U5FA 2I5FA 1P5TA 2I1JA 3AJ4A 4MT7A 2HTHB 1XCGA 2Y8GA 5LONB 1MIZB 3PVWA 2H7DA 3P6AA 2DFKA 4A6FB 1FHOA 4PQ0A 1V5UA 3A8QA 2PZ1A 2YT0A 4BBKA 3G9WA 2R09A 3WA0A 1ZVRA 3ZVRA 1NTYA 1TXDA 5C6RA 2EMSA 1GC7A 2DKQA 1FOEA 2N23A 3ULCA 4ZRKA 2ROVA 1H10A 4HAUB 4KVGB 2UZSA 1BAKA 2OTXA 3PG7A 1MK7B 3VOQA 3X23A 2YS3A 1GC6A 2E2XA 1U29A 2P0HA 2YT1A 1J0WA 1M7EA 4F7GA 4KHOA 2VKIA 1I7AA 3F0WA 2YS1A 2YF0A 5JP4A 2UZRA 2JP2A 2V76A 4K81A 4GMVA 3ZDTA 1X05A 2RSGA 3CIKA 1V5MA 5EFXA 1FHXA 3UZTA 1ISNA 5HE0A 1ZSQA 4WVFB 2J59M 2L1CA 1U27A 5DHFB 1OY2A 4D0NB 4DXAB 1W1GA 2D9WA 3WYFB 4K2PA 4CHMA 2AEHA 4ZRJA 2XQNM 3FM8C 1EF1A 1DDMA 4HAYB 3HQCA 2ELBA 5KCVA 5C5BB 2X18A 2COCA 2Y7BA 1BTKA 1P3RA 3ODWA 1UNRA 1WJ1A 1Y19B 3VIAA 1TQZA 1WI1A 1W1DA 5GOWB 1E5WA 3QBVB 4HB4B 3BJIA 5D27A 4HHVA 4A5KA 1ZC3B 3MPXA 2CY4A 1SHCA 1UPQA 2D9YA 1AWEA 3AU4A 4KAXB 3PEGA 5HE2A 4HDQA 1ZC4B 3MDBC 1RRPB 2VSZA 2I5CA 3PVLA 1X1GA 3GYOA 2Q13A 1GG3A 4Z2MB 5JLJB 3KRWA 1KZGA 5CLQB 1DROA 1LB1A 5C79A 3V5WA 2M14A 2QKLA 4HB3B 4NY0A 1U5DA 1XR0B 2LG1A 1NTVA 2DX1A 2YSZA 2K2JA 3DXEA 3SV1A 5LOPB 1M7RA
chains in the Genus database with same CATH superfamily
5DI9B 1DYNA 1MI1A 4OT1A 1P6SA 1X86A 3PSCA 4NSWA 4OSNA 1SGHA 4WSFA 2QKMA 2EJ8A 2LULA 1X11A 2W2XC 2ROZB 2RGNB 3SUZA 5J3YA 4DBBA 2RLOA 1UPRA 4HDOA 4L1RA 5M4YB 1NI2A 3A8PA 4IOYX 1XKEA 5D3YA 2N0YA 1XD4A 2YVCA 2K49A 5JHGA 4EJNA 2RVBB 3PVUA 2CAYA 2G35A 3OANA 3TVVA 2Z4DA 1XODA 2MDXA 1T77A 3M1IB 2YS5A 1NU2A 1EVHA 2RUKB 4K2OA 3FVCA 2UVMA 4L6EA 1J19A 2D9VA 3P7ZA 4TKNA 2P8VA 2HE7A 1Q67A 2NZ8B 4YONA 1BTNA 4QXAB 2AL6A 1TJ6A 2K2UA 4HSIA 2DLWA 1ZYIA 2MWNB 2DYNA 2VRWB 3TFMA 2K00A 4HAZB 4HATB 1WJMA 3DXDA 5HE3A 2GCLA 2RRFA 2LOXA 2L2IA 3HW2B 5KQ4A 2D11A 1Z87A 4MY6A 1FB8A 3SO6A 1EGXA 2M38A 5DIFB 5D3VA 2Z0PA 2EMTA 1UNQA 3ULBA 4QJ4B 4HAXB 1FGYA 4GNKB 2OQBA 1X1FA 5FI1A 2J0MA 4P7IA 4A6KA 2FJLA 1LW3A 3TCAA 5I2SA 5D3XA 4GPTB 2R2YA 1QQGA 3N7CA 2LYDA 5HE1A 4A6HA 5DH9B 2J0KA 1DDWA 5C16A 1WVHA 4PNKA 4HB0B 4KHBA 2ELAA 4B6HA 1KI1B 3DXCA 1Y5OA 2K8EA 1U5EA 2DTCA 1I2HA 2R0DA 3ML4A 1QC6A 4YL8A 3KY9A 2DKPA 4DX8A 4K17A 4H8SA 3NWAA 1V88A 2IYBA 2ADZA 1EAZA 2DA0A 5KQ1A 1WGUA 2GCJA 3KZ1A 2P0DA 1W1HA 3HSAA 5J3QA 2CODA 2MFQA 2Z0QA 4CYEA 1N3HA 1BWNA 1MAIA 3ODOA 2COFA 2GJYA 5L81A 2W2WA 1DDVA 1UEFA 1MPHA 1K5DB 3QIJA 3PZDA 2KUPA 1MKEA 2DX5A 3ODXA 1WGQA 2W2XD 3O96A 2D2QA 2IFSA 3NWDA 1PMSA 3A98B 2GS0A 5JHHA 4XWXA 2I1KA 4GZUA 1KZ7A 4KHAA 3TW1A 1IRSA 2FJUB 4GMXB 4GXBA 1V89A 2D9ZA 5J3TA 1ZM0A 2Z0OA 4WJ7A 2CRFA 2J0JA 1OMWA 5DHAB 1DBHA 2COAA 3GYPA 3SNHA 2P0FA 3U7DA 3KSYA 3QWMA 2LOZA 4CHJA 3LJUX 4MK0A 1V61A 2D10A 3HK0A 2KUQA 1WG7A 3RCPA 1AQCA 1H4RA 4Y94A 4QJ5B 3BINA 2MKRA 2D4QA 2Y8FA 4F7HA 4C0AA 3IVFA 5C5BA 1MK9B 4EMOA 5FI0A 2BCJA 4HAWB 1MIXA 2RNRB 3F5RA 1FAOA 3D8EA 1V5PA 1K5GB 2DN6A 2DHIA 4GN1A 2LKOA 5CLLB 4HB2B 3U8ZA 4GOUA 3TO1A 3D8DA 5I2MA 3FEHA 2EC1A 1XX0A 1PLSA 2YRYA 2H7EA 4A6FA 2DYQA 2KGXB 1FHWA 2DHKA 4ZRIA 1FGZA 4DX90 1U2BA 2NMBA 2ZKMX 3SYXA 2DHJA 4HAVB 3KRXA 3CXBB 3AU5A 2CY5A 3T06A 3PP2A 4F7UP 1U5GA 3FSSA 5D3WA 3D8FA 2D9XA 1B55A 4EKUA 1RJ2A 3NSUA 1OQNA 4TYZA 4IAPA 4IFSA 2KR0A 4Z2NA 2ZPYA 2KCJA 1PFJA 4KHBB 1UNPA 1U5FA 2I5FA 1P5TA 2I1JA 3AJ4A 3A58A 4MT7A 2HTHB 1XCGA 2Y8GA 5LONB 1MIZB 3PVWA 2H7DA 3P6AA 2DFKA 4A6FB 1FHOA 4PQ0A 1V5UA 3A8QA 2PZ1A 2YT0A 4BBKA 3G9WA 2R09A 3WA0A 1ZVRA 3ZVRA 1NTYA 1TXDA 5C6RA 2EMSA 1GC7A 2DKQA 1FOEA 2YT2A 2N23A 3ULCA 2GUMA 4QJ3B 4ZRKA 2Z14A 2KIEA 2ROVA 1H10A 4HAUB 4KVGB 2UZSA 1BAKA 2OTXA 3PG7A 1MK7B 3VOQA 3HIEA 3X23A 2YS3A 1GC6A 2E2XA 1U29A 2P0HA 2YT1A 5LG4B 1J0WA 1M7EA 4F7GA 4KHOA 2VKIA 1I7AA 3NW8A 3F0WA 2YS1A 2YF0A 5JP4A 2UZRA 2JP2A 2V76A 4K81A 4GMVA 3ZDTA 1X05A 2RSGA 3CIKA 1V5MA 5EFXA 1FHXA 3UZTA 2NBVA 1ISNA 5HE0A 4DIXA 1ZSQA 4WVFB 2J59M 2L1CA 1U27A 5DHFB 1OY2A 4D0NB 4DXAB 1W1GA 2D9WA 3WYFB 4K2PA 4CHMA 2AEHA 4ZRJA 2XQNM 3FM8C 1EF1A 1DDMA 4HAYB 3HQCA 5IRSA 2ELBA 5KCVA 5C5BB 2X18A 2Z59A 2COCA 2Y7BA 1BTKA 1P3RA 3ODWA 1UNRA 1WJ1A 1Y19B 3VIAA 1TQZA 1WI1A 1W1DA 5GOWB 1E5WA 2Z13A 3QBVB 4HB4B 3BJIA 5D27A 4HHVA 4A5KA 3B77A 1ZC3B 3MPXA 2CY4A 1SHCA 4D6WA 1UPQA 2D9YA 1AWEA 3AU4A 4KAXB 3PEGA 5HE2A 4HDQA 3U12A 1ZC4B 3MDBC 1RRPB 2VSZA 2I5CA 3PVLA 1X1GA 3GYOA 2Q13A 1GG3A 4Z2MB 5JLJB 3KRWA 1KZGA 5CLQB 4CSQA 1DROA 3DCXA 1LB1A 3OHMB 5C79A 3V5WA 2KIGA 2M14A 2QKLA 4HB3B 4NY0A 1U5DA 3NWFA 1XR0B 2LG1A 1NTVA 2DX1A 2YSZA 2K2JA 3DXEA 3SV1A 5LOPB 1M7RA
chains in the Genus database with same CATH topology
5DI9B 1DYNA 1P6SA 1X86A 3PSCA 4NSWA 1SGHA 4WSFA 2QKMA 2EJ8A 2LULA 1X11A 2W2XC 2ROZB 2RGNB 3SUZA 5J3YA 4DBBA 2RLOA 1UPRA 4HDOA 1NI2A 3A8PA 4IOYX 1XKEA 5D3YA 2N0YA 1XD4A 2YVCA 5JHGA 4EJNA 2RVBB 3PVUA 2CAYA 2G35A 3OANA 3TVVA 1XODA 2MDXA 3M1IB 2YS5A 1NU2A 1EVHA 2RUKB 4K2OA 2UVMA 4L6EA 1J19A 2D9VA 3P7ZA 4TKNA 2P8VA 2HE7A 1Q67A 2NZ8B 4YONA 1BTNA 2AL6A 1TJ6A 2K2UA 2DLWA 2MWNB 2DYNA 2VRWB 3TFMA 2K00A 4HAZB 4HATB 1WJMA 3DXDA 5HE3A 2GCLA 2LOXA 2L2IA 3HW2B 5KQ4A 2D11A 1Z87A 4MY6A 1FB8A 3SO6A 1EGXA 2M38A 5DIFB 5D3VA 2Z0PA 2EMTA 1UNQA 3ULBA 4HAXB 1FGYA 2OQBA 1X1FA 5FI1A 2J0MA 4P7IA 4A6KA 2FJLA 1LW3A 3TCAA 5D3XA 4GPTB 1QQGA 3N7CA 2LYDA 5HE1A 4A6HA 5DH9B 2J0KA 1DDWA 5C16A 1WVHA 4PNKA 4HB0B 2ELAA 4B6HA 1KI1B 3DXCA 1Y5OA 1U5EA 2DTCA 1I2HA 2R0DA 3ML4A 1QC6A 4YL8A 3KY9A 2DKPA 4DX8A 4K17A 4H8SA 1V88A 2IYBA 2ADZA 1EAZA 2DA0A 5KQ1A 1WGUA 2GCJA 3KZ1A 2P0DA 1W1HA 5J3QA 2CODA 2MFQA 2Z0QA 4CYEA 1N3HA 1BWNA 1MAIA 3ODOA 2COFA 2GJYA 5L81A 2W2WA 1DDVA 1UEFA 1MPHA 1K5DB 3QIJA 3PZDA 2KUPA 1MKEA 2DX5A 3ODXA 1WGQA 2W2XD 3O96A 3A98B 2D2QA 2IFSA 1PMSA 2GS0A 5JHHA 4XWXA 2I1KA 4GZUA 1KZ7A 4KHAA 3TW1A 4GXBA 1IRSA 4GMXB 1V89A 2D9ZA 5J3TA 1ZM0A 2Z0OA 4WJ7A 2CRFA 2J0JA 1OMWA 5DHAB 1DBHA 2COAA 3GYPA 3SNHA 2P0FA 3U7DA 3KSYA 3QWMA 2LOZA 4CHJA 3LJUX 4MK0A 1V61A 2D10A 3HK0A 1WG7A 3RCPA 1AQCA 1H4RA 4Y94A 3BINA 2MKRA 2D4QA 2Y8FA 4F7HA 4C0AA 3IVFA 5C5BA 1MK9B 4EMOA 5FI0A 2BCJA 4HAWB 1MIXA 2RNRB 3F5RA 1FAOA 3D8EA 1V5PA 1K5GB 2DN6A 2DHIA 4GN1A 2LKOA 5CLLB 4HB2B 3U8ZA 3TO1A 3D8DA 3FEHA 2EC1A 1XX0A 1PLSA 2YRYA 2H7EA 4A6FA 2DYQA 2KGXB 1FHWA 2DHKA 4ZRIA 1FGZA 4DX90 1U2BA 2NMBA 3SYXA 2DHJA 4HAVB 3KRXA 3CXBB 3AU5A 2CY5A 3T06A 3PP2A 4F7UP 1U5GA 3FSSA 5D3WA 3D8FA 2D9XA 1B55A 4EKUA 1RJ2A 3NSUA 1OQNA 4TYZA 4IAPA 4IFSA 4Z2NA 2ZPYA 2KCJA 1PFJA 4KHBB 1UNPA 1U5FA 2I5FA 1P5TA 2I1JA 3AJ4A 4MT7A 2HTHB 1XCGA 2Y8GA 5LONB 1MIZB 3PVWA 2H7DA 3P6AA 2DFKA 4A6FB 1FHOA 4PQ0A 1V5UA 3A8QA 2PZ1A 2YT0A 4BBKA 3G9WA 2R09A 3WA0A 1ZVRA 3ZVRA 1NTYA 1TXDA 5C6RA 2EMSA 1GC7A 2DKQA 1FOEA 2N23A 3ULCA 4ZRKA 2ROVA 1H10A 4HAUB 4KVGB 2UZSA 1BAKA 2OTXA 3PG7A 1MK7B 3VOQA 3X23A 2YS3A 1GC6A 2E2XA 1U29A 2P0HA 2YT1A 1J0WA 1M7EA 4F7GA 4KHOA 2VKIA 1I7AA 3F0WA 2YS1A 2YF0A 5JP4A 2UZRA 2JP2A 2V76A 4K81A 4GMVA 3ZDTA 1X05A 2RSGA 3CIKA 1V5MA 5EFXA 1FHXA 3UZTA 1ISNA 5HE0A 1ZSQA 4WVFB 2J59M 2L1CA 1U27A 5DHFB 1OY2A 4D0NB 4DXAB 1W1GA 2D9WA 3WYFB 4K2PA 4CHMA 2AEHA 4ZRJA 2XQNM 3FM8C 1EF1A 1DDMA 4HAYB 3HQCA 2ELBA 5KCVA 5C5BB 2X18A 2COCA 2Y7BA 1BTKA 1P3RA 3ODWA 1UNRA 1WJ1A 1Y19B 3VIAA 1TQZA 1WI1A 1W1DA 5GOWB 1E5WA 3QBVB 4HB4B 3BJIA 5D27A 4HHVA 4A5KA 1ZC3B 3MPXA 2CY4A 1SHCA 1UPQA 2D9YA 1AWEA 3AU4A 4KAXB 3PEGA 5HE2A 4HDQA 1ZC4B 3MDBC 1RRPB 2VSZA 2I5CA 3PVLA 1X1GA 3GYOA 2Q13A 1GG3A 4Z2MB 5JLJB 3KRWA 1KZGA 5CLQB 1DROA 1LB1A 5C79A 3V5WA 2M14A 2QKLA 4HB3B 4NY0A 1U5DA 1XR0B 2LG1A 1NTVA 2DX1A 2YSZA 2K2JA 3DXEA 3SV1A 5LOPB 1M7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DI9 B;  1DYN A;  1P6S A;  1X86 A;  3PSC A;  4NSW A;  1SGH A;  4WSF A;  2QKM A;  2EJ8 A;  2LUL A;  1X11 A;  2W2X C;  2ROZ B;  2RGN B;  3SUZ A;  5J3Y A;  4DBB A;  2RLO A;  1UPR A;  4HDO A;  1NI2 A;  3A8P A;  4IOY X;  1XKE A;  5D3Y A;  2N0Y A;  1XD4 A;  2YVC A;  5JHG A;  4EJN A;  2RVB B;  3PVU A;  2CAY A;  2G35 A;  3OAN A;  3TVV A;  1XOD A;  2MDX A;  3M1I B;  2YS5 A;  1NU2 A;  1EVH A;  2RUK B;  4K2O A;  2UVM A;  4L6E A;  1J19 A;  2D9V A;  3P7Z A;  4TKN A;  2P8V A;  2HE7 A;  1Q67 A;  2NZ8 B;  4YON A;  1BTN A;  2AL6 A;  1TJ6 A;  2K2U A;  2DLW A;  2MWN B;  2DYN A;  2VRW B;  3TFM A;  2K00 A;  4HAZ B;  4HAT B;  1WJM A;  3DXD A;  5HE3 A;  2GCL A;  2LOX A;  2L2I A;  3HW2 B;  5KQ4 A;  2D11 A;  1Z87 A;  4MY6 A;  1FB8 A;  3SO6 A;  1EGX A;  2M38 A;  5DIF B;  5D3V A;  2Z0P A;  2EMT A;  1UNQ A;  3ULB A;  4HAX B;  1FGY A;  2OQB A;  1X1F A;  5FI1 A;  2J0M A;  4P7I A;  4A6K A;  2FJL A;  1LW3 A;  3TCA A;  5D3X A;  4GPT B;  1QQG A;  3N7C A;  2LYD A;  5HE1 A;  4A6H A;  5DH9 B;  2J0K A;  1DDW A;  5C16 A;  1WVH A;  4PNK A;  4HB0 B;  2ELA A;  4B6H A;  1KI1 B;  3DXC A;  1Y5O A;  1U5E A;  2DTC A;  1I2H A;  2R0D A;  3ML4 A;  1QC6 A;  4YL8 A;  3KY9 A;  2DKP A;  4DX8 A;  4K17 A;  4H8S A;  1V88 A;  2IYB A;  2ADZ A;  1EAZ A;  2DA0 A;  5KQ1 A;  1WGU A;  2GCJ A;  3KZ1 A;  2P0D A;  1W1H A;  5J3Q A;  2COD A;  2MFQ A;  2Z0Q A;  4CYE A;  1N3H A;  1BWN A;  1MAI A;  3ODO A;  2COF A;  2GJY A;  5L81 A;  2W2W A;  1DDV A;  1UEF A;  1MPH A;  1K5D B;  3QIJ A;  3PZD A;  2KUP A;  1MKE A;  2DX5 A;  3ODX A;  1WGQ A;  2W2X D;  3O96 A;  3A98 B;  2D2Q A;  2IFS A;  1PMS A;  2GS0 A;  5JHH A;  4XWX A;  2I1K A;  4GZU A;  1KZ7 A;  4KHA A;  3TW1 A;  4GXB A;  1IRS A;  4GMX B;  1V89 A;  2D9Z A;  5J3T A;  1ZM0 A;  2Z0O A;  4WJ7 A;  2CRF A;  2J0J A;  1OMW A;  5DHA B;  1DBH A;  2COA A;  3GYP A;  3SNH A;  2P0F A;  3U7D A;  3KSY A;  3QWM A;  2LOZ A;  4CHJ A;  3LJU X;  4MK0 A;  1V61 A;  2D10 A;  3HK0 A;  1WG7 A;  3RCP A;  1AQC A;  1H4R A;  4Y94 A;  3BIN A;  2MKR A;  2D4Q A;  2Y8F A;  4F7H A;  4C0A A;  3IVF A;  5C5B A;  1MK9 B;  4EMO A;  5FI0 A;  2BCJ A;  4HAW B;  1MIX A;  2RNR B;  3F5R A;  1FAO A;  3D8E A;  1V5P A;  1K5G B;  2DN6 A;  2DHI A;  4GN1 A;  2LKO A;  5CLL B;  4HB2 B;  3U8Z A;  3TO1 A;  3D8D A;  3FEH A;  2EC1 A;  1XX0 A;  1PLS A;  2YRY A;  2H7E A;  4A6F A;  2DYQ A;  2KGX B;  1FHW A;  2DHK A;  4ZRI A;  1FGZ A;  4DX9 0;  1U2B A;  2NMB A;  3SYX A;  2DHJ A;  4HAV B;  3KRX A;  3CXB B;  3AU5 A;  2CY5 A;  3T06 A;  3PP2 A;  4F7U P;  1U5G A;  3FSS A;  5D3W A;  3D8F A;  2D9X A;  1B55 A;  4EKU A;  1RJ2 A;  3NSU A;  1OQN A;  4TYZ A;  4IAP A;  4IFS A;  4Z2N A;  2ZPY A;  2KCJ A;  1PFJ A;  4KHB B;  1UNP A;  1U5F A;  2I5F A;  1P5T A;  2I1J A;  3AJ4 A;  4MT7 A;  2HTH B;  1XCG A;  2Y8G A;  5LON B;  1MIZ B;  3PVW A;  2H7D A;  3P6A A;  2DFK A;  4A6F B;  1FHO A;  4PQ0 A;  1V5U A;  3A8Q A;  2PZ1 A;  2YT0 A;  4BBK A;  3G9W A;  2R09 A;  3WA0 A;  1ZVR A;  3ZVR A;  1NTY A;  1TXD A;  5C6R A;  2EMS A;  1GC7 A;  2DKQ A;  1FOE A;  2N23 A;  3ULC A;  4ZRK A;  2ROV A;  1H10 A;  4HAU B;  4KVG B;  2UZS A;  1BAK A;  2OTX A;  3PG7 A;  1MK7 B;  3VOQ A;  3X23 A;  2YS3 A;  1GC6 A;  2E2X A;  1U29 A;  2P0H A;  2YT1 A;  1J0W A;  1M7E A;  4F7G A;  4KHO A;  2VKI A;  1I7A A;  3F0W A;  2YS1 A;  2YF0 A;  5JP4 A;  2UZR A;  2JP2 A;  2V76 A;  4K81 A;  4GMV A;  3ZDT A;  1X05 A;  2RSG A;  3CIK A;  1V5M A;  5EFX A;  1FHX A;  3UZT A;  1ISN A;  5HE0 A;  1ZSQ A;  4WVF B;  2J59 M;  2L1C A;  1U27 A;  5DHF B;  1OY2 A;  4D0N B;  4DXA B;  1W1G A;  2D9W A;  3WYF B;  4K2P A;  4CHM A;  2AEH A;  4ZRJ A;  2XQN M;  3FM8 C;  1EF1 A;  1DDM A;  4HAY B;  3HQC A;  2ELB A;  5KCV A;  5C5B B;  2X18 A;  2COC A;  2Y7B A;  1BTK A;  1P3R A;  3ODW A;  1UNR A;  1WJ1 A;  1Y19 B;  3VIA A;  1TQZ A;  1WI1 A;  1W1D A;  5GOW B;  1E5W A;  3QBV B;  4HB4 B;  3BJI A;  5D27 A;  4HHV A;  4A5K A;  1ZC3 B;  3MPX A;  2CY4 A;  1SHC A;  1UPQ A;  2D9Y A;  1AWE A;  3AU4 A;  4KAX B;  3PEG A;  5HE2 A;  4HDQ A;  1ZC4 B;  3MDB C;  1RRP B;  2VSZ A;  2I5C A;  3PVL A;  1X1G A;  3GYO A;  2Q13 A;  1GG3 A;  4Z2M B;  5JLJ B;  3KRW A;  1KZG A;  5CLQ B;  1DRO A;  1LB1 A;  5C79 A;  3V5W A;  2M14 A;  2QKL A;  4HB3 B;  4NY0 A;  1U5D A;  1XR0 B;  2LG1 A;  1NTV A;  2DX1 A;  2YSZ A;  2K2J A;  3DXE A;  3SV1 A;  5LOP B;  1M7R A; 
#chains in the Genus database with same CATH topology
 5DI9 B;  1DYN A;  1MI1 A;  4OT1 A;  1P6S A;  1X86 A;  3PSC A;  4NSW A;  4OSN A;  1SGH A;  4WSF A;  2QKM A;  2EJ8 A;  2LUL A;  1X11 A;  2W2X C;  2ROZ B;  2RGN B;  3SUZ A;  5J3Y A;  4DBB A;  2RLO A;  1UPR A;  4HDO A;  4L1R A;  5M4Y B;  1NI2 A;  3A8P A;  4IOY X;  1XKE A;  5D3Y A;  2N0Y A;  1XD4 A;  2YVC A;  2K49 A;  5JHG A;  4EJN A;  2RVB B;  3PVU A;  2CAY A;  2G35 A;  3OAN A;  3TVV A;  2Z4D A;  1XOD A;  2MDX A;  1T77 A;  3M1I B;  2YS5 A;  1NU2 A;  1EVH A;  2RUK B;  4K2O A;  3FVC A;  2UVM A;  4L6E A;  1J19 A;  2D9V A;  3P7Z A;  4TKN A;  2P8V A;  2HE7 A;  1Q67 A;  2NZ8 B;  4YON A;  1BTN A;  4QXA B;  2AL6 A;  1TJ6 A;  2K2U A;  4HSI A;  2DLW A;  1ZYI A;  2MWN B;  2DYN A;  2VRW B;  3TFM A;  2K00 A;  4HAZ B;  4HAT B;  1WJM A;  3DXD A;  5HE3 A;  2GCL A;  2RRF A;  2LOX A;  2L2I A;  3HW2 B;  5KQ4 A;  2D11 A;  1Z87 A;  4MY6 A;  1FB8 A;  3SO6 A;  1EGX A;  2M38 A;  5DIF B;  5D3V A;  2Z0P A;  2EMT A;  1UNQ A;  3ULB A;  4QJ4 B;  4HAX B;  1FGY A;  4GNK B;  2OQB A;  1X1F A;  5FI1 A;  2J0M A;  4P7I A;  4A6K A;  2FJL A;  1LW3 A;  3TCA A;  5I2S A;  5D3X A;  4GPT B;  2R2Y A;  1QQG A;  3N7C A;  2LYD A;  5HE1 A;  4A6H A;  5DH9 B;  2J0K A;  1DDW A;  5C16 A;  1WVH A;  4PNK A;  4HB0 B;  4KHB A;  2ELA A;  4B6H A;  1KI1 B;  3DXC A;  1Y5O A;  2K8E A;  1U5E A;  2DTC A;  1I2H A;  2R0D A;  3ML4 A;  1QC6 A;  4YL8 A;  3KY9 A;  2DKP A;  4DX8 A;  4K17 A;  4H8S A;  3NWA A;  1V88 A;  2IYB A;  2ADZ A;  1EAZ A;  2DA0 A;  5KQ1 A;  1WGU A;  2GCJ A;  3KZ1 A;  2P0D A;  1W1H A;  3HSA A;  5J3Q A;  2COD A;  2MFQ A;  2Z0Q A;  4CYE A;  1N3H A;  1BWN A;  1MAI A;  3ODO A;  2COF A;  2GJY A;  5L81 A;  2W2W A;  1DDV A;  1UEF A;  1MPH A;  1K5D B;  3QIJ A;  3PZD A;  2KUP A;  1MKE A;  2DX5 A;  3ODX A;  1WGQ A;  2W2X D;  3O96 A;  2D2Q A;  2IFS A;  3NWD A;  1PMS A;  3A98 B;  2GS0 A;  5JHH A;  4XWX A;  2I1K A;  4GZU A;  1KZ7 A;  4KHA A;  3TW1 A;  1IRS A;  2FJU B;  4GMX B;  4GXB A;  1V89 A;  2D9Z A;  5J3T A;  1ZM0 A;  2Z0O A;  4WJ7 A;  2CRF A;  2J0J A;  1OMW A;  5DHA B;  1DBH A;  2COA A;  3GYP A;  3SNH A;  2P0F A;  3U7D A;  3KSY A;  3QWM A;  2LOZ A;  4CHJ A;  3LJU X;  4MK0 A;  1V61 A;  2D10 A;  3HK0 A;  2KUQ A;  1WG7 A;  3RCP A;  1AQC A;  1H4R A;  4Y94 A;  4QJ5 B;  3BIN A;  2MKR A;  2D4Q A;  2Y8F A;  4F7H A;  4C0A A;  3IVF A;  5C5B A;  1MK9 B;  4EMO A;  5FI0 A;  2BCJ A;  4HAW B;  1MIX A;  2RNR B;  3F5R A;  1FAO A;  3D8E A;  1V5P A;  1K5G B;  2DN6 A;  2DHI A;  4GN1 A;  2LKO A;  5CLL B;  4HB2 B;  3U8Z A;  4GOU A;  3TO1 A;  3D8D A;  5I2M A;  3FEH A;  2EC1 A;  1XX0 A;  1PLS A;  2YRY A;  2H7E A;  4A6F A;  2DYQ A;  2KGX B;  1FHW A;  2DHK A;  4ZRI A;  1FGZ A;  4DX9 0;  1U2B A;  2NMB A;  2ZKM X;  3SYX A;  2DHJ A;  4HAV B;  3KRX A;  3CXB B;  3AU5 A;  2CY5 A;  3T06 A;  3PP2 A;  4F7U P;  1U5G A;  3FSS A;  5D3W A;  3D8F A;  2D9X A;  1B55 A;  4EKU A;  1RJ2 A;  3NSU A;  1OQN A;  4TYZ A;  4IAP A;  4IFS A;  2KR0 A;  4Z2N A;  2ZPY A;  2KCJ A;  1PFJ A;  4KHB B;  1UNP A;  1U5F A;  2I5F A;  1P5T A;  2I1J A;  3AJ4 A;  3A58 A;  4MT7 A;  2HTH B;  1XCG A;  2Y8G A;  5LON B;  1MIZ B;  3PVW A;  2H7D A;  3P6A A;  2DFK A;  4A6F B;  1FHO A;  4PQ0 A;  1V5U A;  3A8Q A;  2PZ1 A;  2YT0 A;  4BBK A;  3G9W A;  2R09 A;  3WA0 A;  1ZVR A;  3ZVR A;  1NTY A;  1TXD A;  5C6R A;  2EMS A;  1GC7 A;  2DKQ A;  1FOE A;  2YT2 A;  2N23 A;  3ULC A;  2GUM A;  4QJ3 B;  4ZRK A;  2Z14 A;  2KIE A;  2ROV A;  1H10 A;  4HAU B;  4KVG B;  2UZS A;  1BAK A;  2OTX A;  3PG7 A;  1MK7 B;  3VOQ A;  3HIE A;  3X23 A;  2YS3 A;  1GC6 A;  2E2X A;  1U29 A;  2P0H A;  2YT1 A;  5LG4 B;  1J0W A;  1M7E A;  4F7G A;  4KHO A;  2VKI A;  1I7A A;  3NW8 A;  3F0W A;  2YS1 A;  2YF0 A;  5JP4 A;  2UZR A;  2JP2 A;  2V76 A;  4K81 A;  4GMV A;  3ZDT A;  1X05 A;  2RSG A;  3CIK A;  1V5M A;  5EFX A;  1FHX A;  3UZT A;  2NBV A;  1ISN A;  5HE0 A;  4DIX A;  1ZSQ A;  4WVF B;  2J59 M;  2L1C A;  1U27 A;  5DHF B;  1OY2 A;  4D0N B;  4DXA B;  1W1G A;  2D9W A;  3WYF B;  4K2P A;  4CHM A;  2AEH A;  4ZRJ A;  2XQN M;  3FM8 C;  1EF1 A;  1DDM A;  4HAY B;  3HQC A;  5IRS A;  2ELB A;  5KCV A;  5C5B B;  2X18 A;  2Z59 A;  2COC A;  2Y7B A;  1BTK A;  1P3R A;  3ODW A;  1UNR A;  1WJ1 A;  1Y19 B;  3VIA A;  1TQZ A;  1WI1 A;  1W1D A;  5GOW B;  1E5W A;  2Z13 A;  3QBV B;  4HB4 B;  3BJI A;  5D27 A;  4HHV A;  4A5K A;  3B77 A;  1ZC3 B;  3MPX A;  2CY4 A;  1SHC A;  4D6W A;  1UPQ A;  2D9Y A;  1AWE A;  3AU4 A;  4KAX B;  3PEG A;  5HE2 A;  4HDQ A;  3U12 A;  1ZC4 B;  3MDB C;  1RRP B;  2VSZ A;  2I5C A;  3PVL A;  1X1G A;  3GYO A;  2Q13 A;  1GG3 A;  4Z2M B;  5JLJ B;  3KRW A;  1KZG A;  5CLQ B;  4CSQ A;  1DRO A;  3DCX A;  1LB1 A;  3OHM B;  5C79 A;  3V5W A;  2KIG A;  2M14 A;  2QKL A;  4HB3 B;  4NY0 A;  1U5D A;  3NWF A;  1XR0 B;  2LG1 A;  1NTV A;  2DX1 A;  2YSZ A;  2K2J A;  3DXE A;  3SV1 A;  5LOP B;  1M7R A; 
#chains in the Genus database with same CATH homology
 5DI9 B;  1DYN A;  1P6S A;  1X86 A;  3PSC A;  4NSW A;  1SGH A;  4WSF A;  2QKM A;  2EJ8 A;  2LUL A;  1X11 A;  2W2X C;  2ROZ B;  2RGN B;  3SUZ A;  5J3Y A;  4DBB A;  2RLO A;  1UPR A;  4HDO A;  1NI2 A;  3A8P A;  4IOY X;  1XKE A;  5D3Y A;  2N0Y A;  1XD4 A;  2YVC A;  5JHG A;  4EJN A;  2RVB B;  3PVU A;  2CAY A;  2G35 A;  3OAN A;  3TVV A;  1XOD A;  2MDX A;  3M1I B;  2YS5 A;  1NU2 A;  1EVH A;  2RUK B;  4K2O A;  2UVM A;  4L6E A;  1J19 A;  2D9V A;  3P7Z A;  4TKN A;  2P8V A;  2HE7 A;  1Q67 A;  2NZ8 B;  4YON A;  1BTN A;  2AL6 A;  1TJ6 A;  2K2U A;  2DLW A;  2MWN B;  2DYN A;  2VRW B;  3TFM A;  2K00 A;  4HAZ B;  4HAT B;  1WJM A;  3DXD A;  5HE3 A;  2GCL A;  2LOX A;  2L2I A;  3HW2 B;  5KQ4 A;  2D11 A;  1Z87 A;  4MY6 A;  1FB8 A;  3SO6 A;  1EGX A;  2M38 A;  5DIF B;  5D3V A;  2Z0P A;  2EMT A;  1UNQ A;  3ULB A;  4HAX B;  1FGY A;  2OQB A;  1X1F A;  5FI1 A;  2J0M A;  4P7I A;  4A6K A;  2FJL A;  1LW3 A;  3TCA A;  5D3X A;  4GPT B;  1QQG A;  3N7C A;  2LYD A;  5HE1 A;  4A6H A;  5DH9 B;  2J0K A;  1DDW A;  5C16 A;  1WVH A;  4PNK A;  4HB0 B;  2ELA A;  4B6H A;  1KI1 B;  3DXC A;  1Y5O A;  1U5E A;  2DTC A;  1I2H A;  2R0D A;  3ML4 A;  1QC6 A;  4YL8 A;  3KY9 A;  2DKP A;  4DX8 A;  4K17 A;  4H8S A;  1V88 A;  2IYB A;  2ADZ A;  1EAZ A;  2DA0 A;  5KQ1 A;  1WGU A;  2GCJ A;  3KZ1 A;  2P0D A;  1W1H A;  5J3Q A;  2COD A;  2MFQ A;  2Z0Q A;  4CYE A;  1N3H A;  1BWN A;  1MAI A;  3ODO A;  2COF A;  2GJY A;  5L81 A;  2W2W A;  1DDV A;  1UEF A;  1MPH A;  1K5D B;  3QIJ A;  3PZD A;  2KUP A;  1MKE A;  2DX5 A;  3ODX A;  1WGQ A;  2W2X D;  3O96 A;  3A98 B;  2D2Q A;  2IFS A;  1PMS A;  2GS0 A;  5JHH A;  4XWX A;  2I1K A;  4GZU A;  1KZ7 A;  4KHA A;  3TW1 A;  4GXB A;  1IRS A;  4GMX B;  1V89 A;  2D9Z A;  5J3T A;  1ZM0 A;  2Z0O A;  4WJ7 A;  2CRF A;  2J0J A;  1OMW A;  5DHA B;  1DBH A;  2COA A;  3GYP A;  3SNH A;  2P0F A;  3U7D A;  3KSY A;  3QWM A;  2LOZ A;  4CHJ A;  3LJU X;  4MK0 A;  1V61 A;  2D10 A;  3HK0 A;  1WG7 A;  3RCP A;  1AQC A;  1H4R A;  4Y94 A;  3BIN A;  2MKR A;  2D4Q A;  2Y8F A;  4F7H A;  4C0A A;  3IVF A;  5C5B A;  1MK9 B;  4EMO A;  5FI0 A;  2BCJ A;  4HAW B;  1MIX A;  2RNR B;  3F5R A;  1FAO A;  3D8E A;  1V5P A;  1K5G B;  2DN6 A;  2DHI A;  4GN1 A;  2LKO A;  5CLL B;  4HB2 B;  3U8Z A;  3TO1 A;  3D8D A;  3FEH A;  2EC1 A;  1XX0 A;  1PLS A;  2YRY A;  2H7E A;  4A6F A;  2DYQ A;  2KGX B;  1FHW A;  2DHK A;  4ZRI A;  1FGZ A;  4DX9 0;  1U2B A;  2NMB A;  3SYX A;  2DHJ A;  4HAV B;  3KRX A;  3CXB B;  3AU5 A;  2CY5 A;  3T06 A;  3PP2 A;  4F7U P;  1U5G A;  3FSS A;  5D3W A;  3D8F A;  2D9X A;  1B55 A;  4EKU A;  1RJ2 A;  3NSU A;  1OQN A;  4TYZ A;  4IAP A;  4IFS A;  4Z2N A;  2ZPY A;  2KCJ A;  1PFJ A;  4KHB B;  1UNP A;  1U5F A;  2I5F A;  1P5T A;  2I1J A;  3AJ4 A;  4MT7 A;  2HTH B;  1XCG A;  2Y8G A;  5LON B;  1MIZ B;  3PVW A;  2H7D A;  3P6A A;  2DFK A;  4A6F B;  1FHO A;  4PQ0 A;  1V5U A;  3A8Q A;  2PZ1 A;  2YT0 A;  4BBK A;  3G9W A;  2R09 A;  3WA0 A;  1ZVR A;  3ZVR A;  1NTY A;  1TXD A;  5C6R A;  2EMS A;  1GC7 A;  2DKQ A;  1FOE A;  2N23 A;  3ULC A;  4ZRK A;  2ROV A;  1H10 A;  4HAU B;  4KVG B;  2UZS A;  1BAK A;  2OTX A;  3PG7 A;  1MK7 B;  3VOQ A;  3X23 A;  2YS3 A;  1GC6 A;  2E2X A;  1U29 A;  2P0H A;  2YT1 A;  1J0W A;  1M7E A;  4F7G A;  4KHO A;  2VKI A;  1I7A A;  3F0W A;  2YS1 A;  2YF0 A;  5JP4 A;  2UZR A;  2JP2 A;  2V76 A;  4K81 A;  4GMV A;  3ZDT A;  1X05 A;  2RSG A;  3CIK A;  1V5M A;  5EFX A;  1FHX A;  3UZT A;  1ISN A;  5HE0 A;  1ZSQ A;  4WVF B;  2J59 M;  2L1C A;  1U27 A;  5DHF B;  1OY2 A;  4D0N B;  4DXA B;  1W1G A;  2D9W A;  3WYF B;  4K2P A;  4CHM A;  2AEH A;  4ZRJ A;  2XQN M;  3FM8 C;  1EF1 A;  1DDM A;  4HAY B;  3HQC A;  2ELB A;  5KCV A;  5C5B B;  2X18 A;  2COC A;  2Y7B A;  1BTK A;  1P3R A;  3ODW A;  1UNR A;  1WJ1 A;  1Y19 B;  3VIA A;  1TQZ A;  1WI1 A;  1W1D A;  5GOW B;  1E5W A;  3QBV B;  4HB4 B;  3BJI A;  5D27 A;  4HHV A;  4A5K A;  1ZC3 B;  3MPX A;  2CY4 A;  1SHC A;  1UPQ A;  2D9Y A;  1AWE A;  3AU4 A;  4KAX B;  3PEG A;  5HE2 A;  4HDQ A;  1ZC4 B;  3MDB C;  1RRP B;  2VSZ A;  2I5C A;  3PVL A;  1X1G A;  3GYO A;  2Q13 A;  1GG3 A;  4Z2M B;  5JLJ B;  3KRW A;  1KZG A;  5CLQ B;  1DRO A;  1LB1 A;  5C79 A;  3V5W A;  2M14 A;  2QKL A;  4HB3 B;  4NY0 A;  1U5D A;  1XR0 B;  2LG1 A;  1NTV A;  2DX1 A;  2YSZ A;  2K2J A;  3DXE A;  3SV1 A;  5LOP B;  1M7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...