2DA2A

Solution structure of the second homeobox domain of at-binding transcription factor 1 (atbf1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
b'GSSGSSGRSSRTRFTDYQLRVLQDFFDANAYPKDDEFEQLSNLLNLPTRVIVVWFQNARQKARKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-fetoprotein enhancer binding protein
publication title Solution structure of the second homeobox domain of AT-binding transcription factor 1 (ATBF1)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da2A01
4I76A 1JTXA 2HOAA 3S1NJ 1AHDP 5C4XJ 4A3MJ 4FCYA 4AC0A 3A02A 4M3EA 3SFIA 1DU0A 5K7FA 5IOYA 1I6HJ 4BKXA 5FKNA 2E19A 5M3MJ 1IC8A 2HDDA 3TW6A 4RDUA 1JKQC 2L7FP 2R92J 2CU7A 1Z77A 3M3YJ 1ENHA 2LK2A 2L9RA 1BW5A 4D7NA 2FX0A 3HOXJ 2GLOA 4MFEA 4BXXJ 2KDZA 2CRGA 3W6VA 3I4NJ 2Y9ZA 1ETQA 4XK4A 3K7AJ 1JJ6C 1ITYA 2ECBA 4A3JJ 1AKHB 1BJZA 1JUMA 4A3LJ 2HQ5A 5J1YA 1AKHA 2Y30A 5IOZA 2E1OA 3CMYA 2GM4A 1MSEC 1Y1WJ 3HOYJ 5K7ZA 5M5YJ 5IYCJ 1JUPA 3LSPA 2MGQA 5IP9J 1MBFA 4JX4A 1OJLA 5FKLA 2R5YA 5IYBJ 3JRFA 1LE8A 2JA5J 1H89C 5GPCA 3O8HA 4XRSA 2DMNA 2DJNA 2JA8J 4XICA 1RPWA 2R93J 1GV5A 3ZQFA 5FKOA 2HXIA 1ZR4A 3NARA 1IDYA 3C2BA 3G1MA 2HOSA 1PUFB 1MNMC 5F08A 2IAIA 2WAQN 1HOMA 4M3BA 2LLKA 1ETVA 1WPKA 1ETWA 5IP6A 1RKTA 3SDGA 4A3EJ 4UUSB 3PO3J 1JT6A 4QIWN 3HOWJ 3DEWA 1HDPA 1JT0A 3SJMA 4D7MA 4UUSA 1HLVA 2EBIA 2DA7A 1K61A 1UHSA 2RAEA 4X1EA 3LSRA 1XG1A 1LFBA 1TWFJ 1NK3P 1TWCJ 1ZQ3P 1MH4A 4J19A 3OIOA 4DYCA 3HOVJ 2ME0A 2KT0A 4A3DJ 3IH4A 2NVQJ 1ZKGA 3G1LA 3B6AA 1TWAJ 1VNDA 3TW7A 4A3GJ 1O4XA 2NOGA 1BL0A 4DW6A 3HOZJ 2HYJA 3O8GA 4FTHA 3WHBA 5E3NA 4V2FA 4V2GA 5FKKA 3ZOBA 5C4JJ 1IGNA 1TWHJ 4FE4A 3PM1A 4CYCB 3B6CA 2AO9A 5IYDJ 2K9QA 3S1RJ 2DMUA 4M3GA 1WH5A 1POGA 1X58A 4A3IJ 1W0TA 3S16J 1A5JA 2ECCA 5HODA 1S7EA 3BG9A 4GFBA 4IHXA 1X2NA 5J1RA 5EGOB 2NS8A 1MH3A 3GTGJ 2JJ7A 9ANTA 2OF7A 1NTCA 2AHQA 2LTPA 3HB9A 1QRYA 1GVDA 5EGOA 1IV6A 1FIPA 2JK3A 5J3LA 1B8IA 1X2MA 2XGCA 5JLXA 1Z0XA 1JGGA 2OPTA 3IV5A 2X6OA 3GTPJ 3OSFA 1WH7A 3ZQGA 2LD5A 3OSGA 1U78A 4C3HJ 3A01B 5EG0A 3QPLA 2FD5A 1SFOJ 3BR5A 3IH3A 4IEJA 1B72B 1QPIA 3S1MJ 2DA5A 2Y9YA 3A01A 3JRCA 2E2HJ 1OFCX 3H0GJ 2ID6A 1B72A 4BBRJ 2NVXJ 5F27A 5E3LA 2LVSA 2CQQA 3UKGA 1NK2P 2Y2ZA 5BNGA 1SANA 1JTYA 2MW8A 3ZQHA 1GT0C 5M5XJ 5FLMJ 2B63J 1CQTA 4S0HB 1DU6A 4M3FA 2NS7A 3LOCA 1IJWC 2R5YB 2H8RA 1LE8B 2XSDC 1ZGWA 2XPUA 2L0KA 1W0UA 2HOTA 4XRMA 5EF6A 4Y7NJ 4A69C 2VI6A 2R7ZJ 2CQXA 4A3BJ 3MVPA 3BTCA 1F43A 4MO7A 1ETXA 4XIDA 2R5ZA 3GTMJ 1U9OA 2HXOA 1U8BA 3TEDA 3VPRA 4IHVA 3Q0UA 2VUMJ 4JX5A 2K9NA 4DYRA 5F1JA 3HEFA 1I50J 3JREA 5EZHA 5M3FJ 2G0EA 5DTDA 3GTQJ 2E2IJ 2L7MP 1ZR2A 1MBKA 1JJ8C 2X48A 5IPAA 1HF0A 3BG3A 3K2AA 2QCOA 3S14J 3BTLA 3ZQLA 2M34A 3JRBA 2XPWA 1BW6A 1IG7A 2LFBA 1ETYA 1ZK8A 2DMTA 4A93J 4I6ZA 1MBJA 4BY7J 1UMQA 1MBHA 1ORKA 2M8GX 4FISA 2NVYJ 1IDZA 4A3FJ 1LFUP 2M9HA 3RZDJ 1WI3A 2N8GA 2PMZN 2YU9J 1FTZA 1H8AC 2I10A 1MBGA 3PO2J 2VPRA 5EZGA 2XB0X 1JKRC 5E3MA 1T33A 4XRSG 3BQYA 3RKQA 2EH3A 1AU7A 3HDDA 3A03A 4M3DA 3CCYA 1FIAA 3DCFA 2L7ZA 1QVUA 3WHCA 3JRDA 2LKXA 3GTKJ 1APLC 4QTRA 3S15J 4B4CA 5DS9A 2EZHA 4AUXA 1D5YA 2VKEA 2XB5A 4JP0A 3NAUA 3H3VK 4DYQA 2EZKA 2MG4A 3HM5A 4D5FA 2VKVA 3JR9A 1ETOA 3F0CA 1YRNA 5F0FA 3LSJA 2D5VA 3M4OJ 3Q0WA 1B8IB 2JA7J 2LP0A 1EF4A 1K83J 5E3OA 2W48A 1JKPC 2EZLA 2NVTJ 3GTLJ 1XC5A 5EG0B 5GPAA 2Y31A 5F0HA 3HGGA 4FE7A 1R9TJ 2XGEA 1E3OC 3HOUJ 3FK7A 3BTJA 3GTOJ 2WV1A 5JLWA 2DTZA 3L1PA 2JN6A 3ZQCA 1MSFC 2O7OA 2FJ1A 4HNVA 1FEXA 1VI0A 2DA1A 3G1OA 2DA3A 5F0CA 5J1UA 2IBDA 1FJLA 2DA2A 2MSYA 2ZB9A 3I4MJ 1I3QJ 2HI3A 5F04A 2O8KA 4RBOA 1T56A 2K9SA 1VF9A 5EYRA 2LY9A 2YS9A 3RQIA 4MIMA 2FQ4A 3Q0VA 3GTJJ 2CUFA 4L5EA 2E2JJ 4BY1J 3E7LA 4AYBN 1P7IA 2K40A 2YUSA 2R5ZB 3S17J 3FK6A 3FISA 4UUTA 3FKIJ 1WGXA 4W97A 4C3JJ 3BR2A 4QSHA 5IP7J 1HDDC 2EZIA 3JRHA 4X6AJ 2EQRA 3MKLA 2TRTA 3MN2A 4JX6A 5C3EJ 1IUFA 1TWGJ 1OCPA 3BTIA 1VFCA 4A3CJ 2COBA 1JKOC 2JA6J 4Y52J 3IH2A 1BA5A 3BT9A 3HKZN 4C2MJ 2ELKA 4MFDA 4W1UA 2IEKA 1P7JA 2LR8A 1G2HA 4BBSJ 4EEFG 4JYKA 3D1NI 3BG5A 1RKWA 2XPVA 3HBLA 3CQZJ 3BQZA 1Y1VJ 1JUSA 1HCRA 3S2HJ 4C3IJ 5K7HA 3JRAA 1OCTC 4LOCA 4MLOA 4IHWA 4M6VA 2X9DA 5GP9A 2P81A 1PUFA 1H88C 3LSGA 5FJ8J 3QPSA 5FKMA 3TP3A 3BR6A 1WCMJ 2QF7A 3FIWA 5EDNA 2TCTA 1ETKA 4G12A 1GDTA 1RETA 4NDLA 3TP0A 2M2EA 3Q3SA 2JMWA 3CDLA 1ZTRA 4A3KJ 1A6IA 1UG2A 4B1RA 2Y0SN 3RZOJ 3BR3A 2R0QC 2XRLA 2GBYA 3GBGA 1MBEA 2DMQA 4B3AA 2ME6A 1F36A 1RESA 1Q1VA 4D5CA 5C44J 2JWTA 3BR1A 3S2DJ 4DZJA 1QVTA 2XGDA 3LNQA 3QQAA 2CJJA 2DA6A 3HGYA 1YRNB 1IRZA 2CUEA 5FLVA 1XS9A 2DMPA 3JRGA 5M5WJ 4IHYA 3BR0A 3JRIA 2DA4A 1RR7A 3OOUA 2ID3A 4DZPA 2DN0A 3S1QJ 1TC3C 1GUUA 4CYCA 3ZQIA 2H1KA 4ABZA 5EEAA 2M0CA 1FTTA 1U9NA 2O9LA 2WB1N 1GV2A
chains in the Genus database with same CATH superfamily
2HYGD 1RR8C 3CD6I 1WFXA 2PX9A 3TBIA 5ICEA 3DEUA 3OS1A 1AHDP 4A3MJ 1WZ2A 3S1NJ 4XLHA 4M3EA 1DU0A 5K7FA 1IV8A 4R8HA 1W7PB 4BAYA 2DPDA 2ZXJA 3QRFF 2BZTA 3TDUC 4UVBA 1B1BA 3ZGKA 2R92J 4RAZA 1CGPA 2ZKZA 3H9JA 3SQNA 2F5FA 2L9RA 2GA2A 2J5OA 3A0HC 3NEUA 4CO8A 3L2RA 1BW5A 1U5TA 2KL4A 1D5VA 1NG6A 3S8PA 1BI3A 2BGCA 3L09A 4MFEA 2HWVA 4P55A 3U1KA 2W84A 2HVRA 3I4NJ 4LG3A 2DQRA 3IKVA 4ZTJA 2O0YA 2LSOA 2FMLA 2VJIA 3A2KA 2GZWA 4MTDA 1LVAA 4B43A 1BR1A 2FE3A 2UXNA 4PCQA 4BHCA 1JUMA 5E20A 3JW4A 1AKHA 3ZR8X 2JVGA 2QQBA 3KFWX 1BC7C 2YSRA 3BY6A 3KYCB 1WQ2A 2E1OA 4F93B 3CMYA 2IGKA 3HOYJ 1S29A 5M5YJ 2MGQA 4JX4A 3HTUA 2CGPA 3TDZC 1DQUA 5D5XB 1OMIA 3JRFA 3PNVA 2H8WA 1SFUA 3O8HA 4XRSA 3ASOH 1EV7A 3BWGA 3LQQA 1UFMA 4RLQA 3M7GA 4YRVA 2L4AA 1GV5A 3EQLF 2HXIA 3GX4X 4I09A 1OYYA 1A36A 2RREA 5EJCA 1P4WA 3BLYA 3C2BA 1FSHA 5KAIC 3ECOA 1QPMA 2BHZA 5FLXZ 3L2QA 1LEBA 3HIFA 3F72A 2LY2A 1MNMC 2JRTA 4JOMA 5ERIA 2IP2A 3FXJA 4AYBA 1A35A 1SFEA 3FM3A 1ETVA 1IN4A 2RNGA 2EFQA 1Y8RB 1S9HA 1MMNA 4NC8A 2HU9A 3CP2A 1VQ6I 1JT0A 4HV6A 1W7PD 1YW8A 3CO7C 3OYIA 2CUZA 3F9KA 1R58A 3GFLA 2NNYA 3GYHX 4I0AA 1LFBA 1N78A 4EM0B 1R4MB 1TWCJ 3HKZA 4XSXF 1MH4A 1BOBA 1FYKA 2NNNA 2Z9OA 2WADA 2ME0A 4G7HF 5BMZA 2DPUA 2ZSIB 4U7DA 1N25A 4Z2YA 4XLEA 4HZFA 2XAJA 3IHUA 4XORA 1VNDA 3I53A 5J6XA 4A3GJ 1O4XA 2NOGA 3GZNB 2IGMA 2EIJH 4PJNA 5E79C 3O8GA 2R7FA 2V9VA 2WAFA 5AIPA 1ZYRF 3AG3H 3QP5A 3HRUA 4LFUA 3OR2C 2PMHA 4U88A 3DBRB 3B6CA 3TOBA 2K9QA 2CYYA 1CF7A 1WH5A 4PDKA 4XKCA 2DBBA 1POGA 4LIUA 5DYMA 1YJWI 1ZRDA 5L3FA 5LGUA 4A3IJ 1XGNA 2LKPA 2WY8Q 3CJNA 1FOYA 5LEKA 3JAMZ 2MABA 2M7BA 5IY5H 2VONA 1S7EA 4XLCA 3BG9A 3DTEA 2DO7A 4CZCA 3P9IA 5J1RA 5EGOB 2VBWA 4NC7A 3GXOA 1V5EA 2OQRA 2AHQA 2LTPA 2XSJC 4GO1A 1B8IA 5GAHJ 1ZG3A 2JK3A 4QWQA 5J3LA 1X2MA 2XGCA 1Z0XA 4BHPA 1XPXA 4E7IA 3OSFA 1R22A 1IUYA 2F6CA 3ZQGA 4G94A 3C2GA 4BQAA 4ENMA 3C2HA 2ZMEA 4M6XA 1R5HA 2FD5A 1SFOJ 3BR5A 5FROA 1HKQA 1JI8A 1MMSA 4CCKA 1QPIA 2Y9YA 3A01A 3JRCA 1OFCX 3ZN1A 1B72A 3RYPA 1F4KA 3S3OA 1SVOA 2R3SA 5F27A 5E8GA 2CQQA 4YFXF 3WGGA 3QWLA 3I0TA 2Z3YA 2R7WA 1QZEA 2NXNB 2BY1A 2RQPA 1JTYA 2V4JC 2VJJA 2VT3A 4XNFA 2QZ8A 3ZQHA 5M5XJ 1CQTA 1Y0NA 3QYEA 4M3FA 1UHMA 2XKOA 1Z67A 2ZBKA 1JGSA 2H8RA 3SFZA 2W57A 5E1WA 2Q2EB 2V26A 2L0KA 3OYFA 1W0UA 1K4TA 1UB9A 1SMYF 2X0LA 4CZZA 3WTYC 3GZ6A 4EM1A 4A3BJ 4MQVA 3BTCA 3CJTB 1F43A 5FO5A 1ETXA 4P96A 4B3XA 4XIDA 2PQ8A 2R5ZA 1VQ4I 3EYIA 4HNTA 1U8BA 3AG1H 1D0XA 3VPRA 1D8JA 2CUJA 2XV4S 3Q0UA 3HRSA 1Z6TA 2P0WA 4PSXA 2VUMJ 4YIFA 3BJ6A 1X3ZB 3EUKL 4DYRA 4F91B 4CH7A 1S5LC 3PNTA 1BR4A 1FT9A 2QQ8A 4Y15A 1N77A 1I50J 5M3FJ 1IO2A 3HPGA 5DTDA 4KN7X 1KQ0A 5D4RA 5E17F 4XL9A 1J0RA 1ZR2A 4BS9A 1Z91A 3K4BA 4BQQA 2QA4I 1MNDA 4Q4ZF 1L3LA 2GIVA 2QCOA 4BH9A 3K4LA 5LHHA 1R1UA 1I39A 3HYIA 2XAFA 3JRBA 4WXCA 2OUMA 3I54A 1RI7A 4OMYA 4CDGA 2W85A 3V8JA 1KGSA 2A61A 4LLNA 2XAQA 2DMTA 1MBJA 2XC7A 4DNCA 3G73A 1FZPB 1ORKA 2JVHA 1U8RA 1IDZA 2EJRA 1I27A 4F52A 5JR3A 3RZDJ 3I5UA 5F64A 2KZVA 3K1NA 2XB0X 1P2FA 3MQ0A 3FXLA 4ENJA 3IP4B 4Y17A 4J00A 1PYVA 1FNNA 2EPFA 3S3MA 2BVLA 3RKQA 1OQYA 2IS6A 2EH3A 1XDSA 1AU7A 4CHUA 2R7TA 1FBUA 4IZZA 3DCFA 1R6RA 3PIOF 1CF7B 3FWEA 1K4SA 2LKXA 2COMA 3UNGC 4B4CA 2DW4A 2EZHA 2IW5A 2XAUA 4JP0A 1VQOI 3OYCA 1XSXA 2EZKA 2VBYA 3D5LA 1KZHA 3ZN0A 1OYWA 1SD4A 3M1EA 3Q9SA 2PEXA 1USTA 4B44A 1DPUA 4M9XA 3M4OJ 4HBLA 1B8IB 2LBFA 1MW7A 4Q5SF 3DTIA 4A0YA 4HF2A 1R5ID 1X3UA 3R6SA 1JKPC 2K7LA 4L9TA 4CA0A 2Z2SB 2R7RA 3I64A 2X1DA 3HL2A 1TT5B 1LDDA 1R1VA 5J4YA 3WG9A 2Y31A 4E4HA 5F0HA 2DT5A 2Z5UA 4IRGA 3DKYA 3AG2H 1WJAA 3J7YJ 1Z3XA 3VFZA 2QKLB 4I7HA 3TQNA 5LLQA 2AS5F 3K1MA 2W24A 1R23A 2Y48A 4MTEA 2VOOA 4ON0A 2QEXI 4OAYA 2FJ1A 4WCGA 1S8NA 1K79A 2P7VB 3ZMSA 2IBDA 2MSYA 1FX7A 5F6FA 1YHQI 2KFDA 4ESJA 1R71A 1PP7U 1WJCA 4UB8C 3LL7A 4EJUA 4G6TB 3ZMVA 2R7VA 3RQIA 2STWA 1R4NB 3JTHA 4KISA 2HDCA 2V9PA 3BPXA 3FBNB 4L5EA 2DT7B 3VSLA 1IN7A 1DUXC 3S17J 2R5ZB 5H2FC 3QYFA 5KK1A 5HS8A 4W97A 2M4GA 4QSHA 4IQ4A 2EZIA 3OL3A 3CMMA 3O3KA 1ZARA 3MKLA 3MN2A 5KAFC 5C3EJ 2FU4A 4I2OA 3L2WA 3CTAA 5DDGA 4A3CJ 2COBA 5JVTA 5HLTA 5FRMA 1BA5A 3ROUA 2ELKA 4EM2A 4W1UA 1P7JA 1WI9A 1Z7UA 2LR8A 2IA2A 3W3CA 1AWCA 2LC2A 3E6CC 4JYKA 3SXYA 2E35A 3WGHA 1RIOH 3CQZJ 4KN4X 2E34A 2M4KA 4HF1A 4BGDA 4MLOA 4M6VA 2QVOA 5DD4A 5BPDA 1VQPI 2O6GE 4CCNA 3VYTB 3TP3A 2WC2A 3ESWB 2EFPA 2HPMA 1GDTA 1MDMB 2OV7A 3KZZA 2LKSA 3CDLA 3H3UA 3QPTA 3HOSA 3QODA 4E7KA 4A3KJ 2STTA 3DF8A 2XF6A 4B1RA 2Y0SN 2Y69H 3QOPA 4DBRA 1RUNA 3UR3C 4JBAA 3OYNA 3OWTA 2KP6A 3S3NA 4F55A 4UHTA 2XRLA 1FP2A 1X1DA 2VB6A 2G7UA 3LFKA 1F36A 1RESA 1WJFA 3BG6A 4LGWA 4YEJA 5B3SH 5TJJA 5D5WB 2DODA 2X51A 2XAHA 1T38A 4NBQA 1H9TA 3S2DJ 1L0OC 4XMYA 4LB6B 4BDYA 1QVTA 3QQAA 1LDJA 4HX8A 4OAZA 5ICGA 1EH6A 2VE8A 3HUGA 2ZJ2A 1LPQA 4GYGA 1MJBA 2R4GA 5FLVA 1XS9A 2HOEA 3SYTA 3U1DA 1LVKA 5M5WJ 2LBFB 2DFIA 2DA4A 1VQ7I 3S32A 2P6SA 2RC4A 1LQ1A 1G3WA 4DZPA 3S1QJ 1NG7A 1XMAA 2FEZA 1P9QC 4CYCA 2VJ5A 2DTRA 5L3EA 2KLOA 3N97A 4XONA 1U9NA 2O9LA 3B02A 2CO5A 4I76A 5DCMA 4L9JA 4A6EA 1SVMA 1S7OA 4OIRF 4AC0A 3SFIA 5FD5A 3IL2A 4FCYA 5IOYA 2GXAA 1RNLA 3CJQB 3PNYA 3FX3A 3PJRA 5M3MJ 4XQFA 5E1ZB 2HDDA 1YW7A 3REOA 1AA7A 1W7PA 1JKQC 2LREA 2CU7A 3M3YJ 2FX0A 3EUHA 2Q1ZB 3DXJF 3LSKA 3M9AA 2GLOA 2IS2A 3WG7H 3H36A 1T8IA 4A12A 1UJ8A 3H5NA 3H9GA 2CRGA 3W6VA 3KLOA 3GLLA 1BI2A 3A1YA 1ETQA 2VE9A 2JA2A 2KZGA 3OYBA 4KT6A 2E7XA 3HJEA 4AD9A 1BJZA 4H0EA 2Q8KA 2HQ5A 4WXDA 2O03A 4ZJZA 2EA4A 4AIDA 5J1YA 3FDYA 1U2WA 4FASD 1PUEE 2XVCA 3H0DA 4MGRA 2GQQA 2W82A 2L9VA 1K6OA 3AG4H 5CVRA 5HOOA 4NQWA 3K4JA 4Y13A 1JUPA 3LSPA 2IGOA 2RVCA 1OJLA 5FKLA 1BJAA 5J8CA 2KJBA 2R5YA 1LE8A 1T39A 1N75A 2JA5J 2JPCA 1LEAA 4P9UA 3HXLA 2EIKH 5LGTA 1FOXA 1ZRFA 2F5EA 2JA8J 3ABKH 2F4MB 5H6RA 2D1HA 3DU5A 2UZKA 3E5QA 1Z3YA 1Z1DA 1G59A 2D2WA 4HEA2 1IDYA 2LMDA 2VQHA 3E6DA 3G1MA 1JXSA 4I01A 2OAZA 4LD5A 4Y4RA 1FMVA 2TDXA 4BQOA 4M6YA 2X4HA 5F08A 5LD2C 1D0YA 2IAIA 2L3DA 2DOFA 2WAQN 1P92A 5KNLA 2E1MC 2LLKA 1MMGA 3WU2C 4UUVA 1ETWA 3ABMH 4L5JA 2O5RA 2E71A 1RKTA 3ERMA 3SDGA 3PO3J 1WJ5A 5LRSA 4H4KC 3HOWJ 4D7MA 3IRRA 2A69F 1LJ9A 2EBIA 2NRAC 3H1CA 1T0FA 3D5RC 4X1EA 2EV5A 3OV8A 3LSRA 3OYEA 2QGUA 1XG1A 1TWFJ 4UY8I 1V3FA 1VQ5I 2QSFX 3K1PA 3BCAA 3LA3A 3Q9VA 1B9MA 3I59B 3LAJA 1YW9A 2OD5A 5A2QK 3J81K 1EH8A 2NVQJ 2HQRA 2WY7Q 3G1LA 1TWAJ 3HUGB 3L00A 3H9QA 1SAXA 4BE2A 2IRFG 1W1WE 3TW7A 3HOZJ 1IN8A 4V2GA 5FKKA 1UAAA 3AL0B 4RB3C 4KMFA 1E0EA 1IGNA 1ZLJA 5CVVA 4LG0A 4CYCB 3ZMZA 4B09A 3SEQA 3JSOA 2IS1A 2HR3A 2VBXA 1TT0A 2DMUA 4M3GA 2I5UA 1U3EM 4MHGA 1OISA 4J01A 2A68F 2CSOA 4G6QA 5DCMB 2FF4A 1BI0A 4IRHA 3BC8A 3LSHA 3VOEA 3D0SA 1KU2A 4IHXA 1STZA 4ZYAA 3OY9A 2H09A 1PP8F 2EB7A 3FF5A 1NTCA 1GHCA 1QRYA 1GVDA 5EGOA 3TO6A 3WTSC 2KPMA 2MD5A 4KIGA 3BZ6A 4XLAA 2OPTA 3IV5A 1RRJA 2DYRH 2MFZA 2X6OA 4YFKF 2QM3A 3V4GA 2EILH 1BIAA 2W7NA 2M8EA 1KU3A 3PL8A 1YI2I 1V54H 1XB4A 5EG0A 4B48A 3KP2A 3CCRI 1MJ9A 3S1MJ 2DA5A 3W2AA 2PG4A 2ZXWH 4BBRJ 2NVXJ 4PZJA 5E3LA 2CV2A 2LVSA 3BCBA 3VEPA 2V6EA 1ZHFA 5TISC 1SAUA 4BJ6C 2X6WA 2VKHA 4E70A 4E7LA 3VWBA 2MW8A 4NQWB 2B63J 4EGYA 3JCUC 1TNTA 1HKSA 2R5YB 2MH9A 2WB1A 1LE8B 1W5TA 3HC7A 3ONQA 2ZXIA 4N9IA 4PJLA 1TP4A 4L0ZB 2OCCH 4LITA 2K5CA 4XRMA 5EF6A 4Y7NJ 4HG2A 4ZYDA 2Q2EA 3GW2A 3SDBA 4BHBA 2VI6A 1T95A 4I02A 2R7XA 3MVPA 2ELJA 1YJ9I 3H3ZA 5HS7A 3CCJI 2ADUA 5EEGA 2GIZA 5CKTA 2A6HF 3ULQB 3TEDA 3MKZA 4L9VA 4CCLA 2FXAA 4IHVA 2VODA 1H0MA 1TW3A 3PUBA 4A6DA 1ULYA 4WXHA 5F1JA 1R49A 2R7SA 1OCCH 5B1BH 1G4DA 4ENKA 3VODA 2H27A 5EZHA 1ON2A 3GLXA 4RAYA 2EFOA 4EMSA 2WA0A 2IA1A 2EV0A 1FBSA 3BG3A 2OCEA 2Q0OA 2MLGA 3BTLA 2M34A 4Q47A 3ASNH 2H1LA 3KCCA 5D8LB 3QAHA 1ZK8A 4G9YA 3WE3A 4A93J 2M3AA 3CC7I 2E60A 4RA2A 2HKOA 3BROA 4XLNF 1HBXG 5FGMA 1ACIA 4M71A 2XHKA 2XIGA 1BN5A 4GDFA 2PMZN 2IGNA 5HLHA 4LB5A 5GAGJ 5GADJ 5D5UB 2A5YB 5KHDA 5KVRA 1EH7A 2DAOA 3L2CA 4BXFA 1T33A 2K85A 2UV1A 4B8XA 4XRSG 1DGRM 4LG0B 3A03A 4M3DA 1XMXA 5HDNA 3WHCA 1EKEA 2HTJA 1SD6A 4EGZA 3S15J 4L9NA 1FOKA 3OYDA 2ISZA 2BXYA 4BQNA 2XB5A 1MGTA 2CQKA 2VKDA 3NAUA 1O3SA 1KYWA 4IHTA 4N0BA 4DYQA 3KYLA 2L02A 3I3LA 4HDVA 1K7AA 3VSKA 1SD7A 4C9YA 4D5FA 2VKVA 4IOCF 1ETOA 3CMEI 2D1VA 3D5SC 2D5VA 5L3BA 1A6QA 2CW7A 5BOXA 5A2QZ 1X4OA 3KIOA 3J81Z 2LP0A 1Y39A 3WTXC 1TQMA 4PK4A 3K4KA 1E3HA 4ZYHA 3LMMA 2NVTJ 1A31A 1SMTA 1IXRC 2G7HA 5GPAA 3SHFA 5EG0B 3OYMA 4FE7A 5FD6A 4Z6YA 1KU9A 1ON1A 1VTNC 3GTOJ 2WV1A 1HSTA 1TLHB 2JN6A 3E6MA 4XOTA 3G6EI 2O7OA 3RTRA 2FMYA 4BU2A 3M8EA 3KP5A 5D4SA 1VI0A 4O5VA 3OR1C 2XASA 3ZQ7A 2ELHA 2DA2A 3I4MJ 3ELKA 1T2KA 2P6TA 2E1NA 2DDBA 1T56A 2RV8A 4AM3A 5ICFA 3FM5A 5EYRA 2M45A 4EATA 4MIMA 2FQ4A 4HA8A 3GTJJ 2O3FA 4BY1J 2DU9A 2X6YA 2HVSA 3GVAA 4LJZF 1QGPA 3CCQI 1BBYA 2K40A 3FISA 4EJWA 4UUTA 5AONA 3OYHA 2O61A 1UG0A 3MKYB 1HDDC 3E6BA 3JRHA 4RM3A 3CJRB 3PQKA 2EQRA 4X6AJ 3H92A 2TRTA 4P9FA 3K4CA 4JX6A 3GMEA 1TWGJ 2VASA 2WBMA 3BTIA 1VFCA 1OLTA 3QOEA 3RPUD 1S7AA 4B47A 4RLFA 3L9FA 3K10A 1ERDA 4MFDA 2IEKA 2HTSA 3ABTA 2KRHA 1YIOA 4I98B 3BG5A 1RKWA 2LDUA 2YX4A 1Y1VJ 4IO9F 1JUSA 4BNCA 4C3IJ 1IXCA 4LOCA 4GCVA 2IA0A 3F8CA 2FQ3A 3E3VA 2WTEA 2X9DA 1GXPA 1U5TC 3OIQA 1JHFA 1PUFA 1H88C 4KYWA 5FJ8J 3KP4A 1OR7A 3QPSA 5FKMA 3KETA 5EDNA 4G12A 3E1SA 1VQMI 2B0LA 1KU7A 3TP0A 2Z16A 2AQFA 5LRRA 3DKWA 3F21A 5CJ9A 2JMWA 4KA4A 1ZTRA 4NB5A 1MDMA 3JSPA 5AIQA 4MEYF 1WKMA 2R0QC 1O57A 5DM7F 1KYZA 2FBKA 2GBYA 2L2OA 2DMQA 2JPBA 1XX5A 3T1BA 2R7OA 1Q1VA 3X2QH 2PJPA 4D5CA 4R1HA 4JQFA 1YTYA 3TL4X 3ZXSA 2XGDA 3B73A 3HGYA 2DA6A 2EA2A 2ZC2A 1BR2A 1OCOH 1IRZA 3NWSA 5ILVA 5BS6A 3GWZA 2DMPA 2H6BA 2JT1A 4KIFA 4C2UA 3R4KA 3BR0A 5F1RA 4Q48A 2GOXB 1W4MA 5EEHA 3OOUA 1HW1A 3R0AA 4M9SA 5LEJA 1T98A 2YU3A 2MLKA 2VXDA 1TW2A 3CDIA 4FHTA 1MIJA 3BZKA 1R7JA 2H1KA 5H6QA 1MZBA 3A0BC 3MFKA 2PN6A 3RJPA 2DOAA 2L9SA 2M0CA 4A5MA 4YIIA 2P4WA 3RKYA 1FC3A 3I4PA 3HRMA 4YG2F 1ZREA 2K9LA 1JTXA 2B9SA 2HOAA 3LSMA 2VBZA 1XGOA 2OZ6A 4AIJA 3A02A 1TNSA 2E19A 2MH2A 2P7CB 1IC8A 3TW6A 3F8FA 1R5GA 3K4NA 2ZFWA 4CYDA 3ZP5A 5LHGA 2L7FP 2L01A 3U21A 1QNTA 3KEYA 2LK2A 2E5ZA 1F1ZA 1X3WB 1QHHD 2CWEA 2OTLI 1QZZA 4LMYA 3HOXJ 5CVUA 3FMQA 2BY2A 2F4OB 4BXXJ 3NWTA 1YO5C 2KDZA 2JSCA 4HV5A 2KIUA 5D6FA 3CUQA 4FQGA 4XK4A 3K7AJ 2XDVA 1K6YA 1ITYA 2ECBA 1G8XA 3FXRA 2RGVA 4PJJA 1YITI 1U0JA 3TKYA 1XSDA 5GTHC 4NHJA 3OYKA 2RN7A 5D6EA 3PFYA 2DYSH 4U87A 4LK1F 1T08B 3BJAA 5E8IA 2Y30A 4U7BA 3FXQA 5H20A 5LFAA 5IOZA 3QPHA 2W25A 4RAGA 4RB1A 2EK5A 1MSEC 2GM4A 4IHSA 3H35A 4CCJA 5IYCJ 3IC7A 4E6KG 1HW2A 1OCZH 2GWRA 1MBFA 1XGMA 2J5PA 2BYVE 2KDOA 2LG4A 4CICA 5LGNA 4ASNA 5IYBJ 1O7LA 1SFKA 2QKMB 2R7DA 1H89C 2MC4A 2OBPA 2W00A 2XRNA 4RGSA 5HNHA 2DMNA 1YFHA 2OJED 2D45A 4MEXF 4XICA 1E2XA 1FLIA 1QZYA 1SVLA 5CQEA 5FKOA 3RQ4A 2XAGA 4LIVA 2V1UA 1VQ9I 2QBYA 1C0WA 4G6DA 3HPHA 2HOSA 1PUFB 2F5VA 5BQTA 1W36C 2MYSA 1R1TA 2BXZA 4ESFA 1H9GA 2ZMEC 4HLYA 2ZJRF 1Z6RA 4EQQA 1WPKA 3C1DA 3W2VA 5FB2A 2PI0A 3M8JA 3DPTA 2XF5A 5IP6A 3F22A 4A3EJ 3E97A 4UUSB 1JT6A 4QIWN 3DEWA 2EINH 2KQRA 3CCVI 5IT9K 2RQQA 5BPIA 1HLVA 2IVMA 1JHHA 4A5NA 1K61A 1UHSA 1NK3P 2NAZA 4HLXA 1Z05A 2BOLA 2KT0A 2EIMH 4RGXA 3ZRGA 2ZNYA 1BC8C 3I59A 3OYGA 1XD7A 1DGWY 2QYOA 3F6OA 2XGXA 2HPIA 4DOZA 4ZZLA 1X19A 2HYJA 2X1EA 1EA3A 3WHBA 1IN6A 1Z9CA 3KEQA 4IQJA 3ZOBA 2BV6A 2IXSA 1TWHJ 3U2RA 2AO9A 3AKZA 1NH3A 1K78A 3CC4I 5IYDJ 3S1RJ 2ZJQF 4OIPF 1HSJA 3C18A 2G9WA 2M0MA 3FXKA 1JE8A 1X58A 2ECCA 3EUAA 2Y0SA 4ZYGA 3OL4A 4KT5C 2CV1A 3KX2A 4GFBA 4PUSA 1X2NA 5DUIA 2NS8A 3GTGJ 2JJ7A 4D1QA 3C7JA 3HB9A 4M74A 4KNYA 2CH0A 1IV6A 2FUG2 1FIPA 1FYMA 3EDPA 3J7ZI 3G4SI 3LA7A 3GZ5A 1FP1D 1DDNA 2E1MB 3OYLA 5HLIA 3CUQB 4XOPA 2HFHA 4EJOA 1XCBA 1FMWA 1G3YA 2HVQA 3QPLA 5DUKA 3CC2I 3K69A 2KJCA 5E1XA 4UNOA 2EV6A 2Z99A 3VYSB 2ZO4A 1YX5A 5J8FA 2ID6A 4CUGA 1I3AA 3UKGA 2QLZA 2JUCA 3IRQA 4D0PA 2A6TA 4PFPA 4HRIA 4KMUX 4CSWA 3WODF 3HOTA 2GXBA 2IS4A 4Y3OA 1IN5A 1MNEA 2VPLA 2HKXA 2KHMA 2ACJA 3LOCA 4ZYEA 1IJWC 5LBQA 1ZG5A 3BZCA 2JTVA 3OMYA 2XSDC 2L4MA 2XPUA 2HOTA 2MC3A 1LDKB 2LY1A 2Y0MA 2MD0A 4AIKA 2GXGA 2NS0A 1HKTA 4CXFA 2R7ZJ 2OTJI 2CQXA 4MO7A 2QBYB 1RZ4A 3PFIA 1U9OA 2BW3A 4E7JA 1HW5A 4ZC3A 3MZYA 3V8KA 4WX9A 1OPCA 2BEOA 4OIOF 3VDXA 1S6LA 2YR2A 2RKHA 3R60A 3OS0A 3J7AO 1FYLA 4IVNA 2W1OA 3CP8A 4BL0B 1P4AA 5HS9A 2BBYA 3KEOA 3GTQJ 2CFXA 2KKOA 3ZMDA 4S05A 1TQIA 1YJNI 2E2IJ 2L7MP 4YELA 3CDHA 3PUFA 1MD0A 2X48A 5IPAA 3IWZA 3K2AA 1TZLA 1YX3A 2LF8A 3S14J 1Y0UA 1QHGA 1YQAA 2E1CA 2XPWA 5DV5A 1ETYA 1WJEA 2VJ4A 2VC0A 4L18B 3R61A 1UMQA 1MBHA 4FISA 2NVYJ 4A3FJ 1LFUP 2O8XA 1LFPA 1WJBA 1D1BA 4AVPA 3PIPF 1WI3A 3I9V2 2I10A 3F6VA 5ILSA 4F7ZA 3PO2J 2VPRA 5EZGA 3W6JB 5D5VB 4E7HA 5J47A 3ML6A 3P9KA 2JSPA 2ESHA 3KYDB 5CVJA 3K4MA 3FHNA 4II3A 3HDDA 4HPQA 4WF2A 2L7ZA 1K78B 2WAQA 4FETA 2HS5A 3PQJA 2CS3A 3K6GA 3JRDA 5CPRB 1QA6A 1V4RA 1SFXA 1D3YA 2QSHX 5DS9A 2E7WA 2BY3A 3RPUA 2VKEA 4AUXA 1D5YA 3H3VK 4JK1X 2DK5A 3L2VA 3GUDA 4A2UA 3P5JA 3HM5A 4HX7A 4II2A 1BI1A 3CF5F 3JR9A 3WGIA 4E7SA 1TQPA 1Y56A 4ANJA 4ITVA 4NUBA 2OZUA 3ZPLA 2K9MA 2FNPA 3TO7A 2W48A 3V7SA 4HX4A 3OYJA 2DI3A 2R7QA 5TRDA 3BP8A 1XC5A 4EV0A 5HLGA 1I6XA 4XR6A 4G8XA 3HGGA 1R9TJ 4QPOA 5CQGA 1E3OC 3JTGA 3HOUJ 4NC6A 3CCMI 1UZCA 3GFIA 3RDIA 3TOAA 1GXQA 2OQGA 2FNAA 5JLWA 1XMKA 2DTZA 4EVIA 4XBFA 2DDAA 2VL8A 3ZQCA 3FXMA 2UXXA 4HNVA 1FEXA 5F0CA 1FJLA 3SZPA 2BVMA 3K70C 2O8KA 1IXSB 4K2EA 3T0YA 1V55H 2V6CA 4XLPF 2K9SA 4IKFA 2X85A 4IJAA 2LY9A 2YS9A 4GYIA 1IRGA 4L0YB 1DP3A 3CZ6A 4IOAF 2VXZA 2E2JJ 4C2TA 2M1BA 2JQ7A 3N05A 4AYBN 3OS2A 3C3WA 3EETA 3QU6A 1P7IA 2DJIA 2YUSA 3LAPA 2AXTC 4ETSA 2LYCA 1V5FA 3FKIJ 2BW3B 1WGXA 4C3JJ 5K5RA 2X1CA 2DT6A 2V1NA 3HHHA 1WSUA 3K70D 1X1BA 1TL8A 4U0VA 2KRFA 3AL0C 2HGCA 4P5OA 4IXAA 1ZN2A 3G3ZA 2H6CA 6PAXA 3EPZA 4DBQA 4ZH4F 4I99C 1JKOC 4Y52J 1QO0D 2LNBA 2MBFA 3KZIC 3BT9A 3HKZN 1O3TA 4XKBA 4G7OF 3F23A 5JVGF 3NQOA 1G2HA 2HQNA 2Y75A 3DV8A 4UB6C 4BBSJ 4D9JA 1ZGAA 2FA5A 4EEFG 4HNUA 4ENNA 4M9ZA 3HZJA 3KE2A 1UHWA 3W6KB 2M87A 3HBLA 5HDKA 3E0JB 4PJMA 1YOVB 3VYRB 1SC7A 3S2HJ 1VQKI 4PJ0C 3JRAA 2M7AA 1OCTC 3WTVC 1GLNA 1KA8A 5K5QA 1XCVA 3H5AA 2JUGA 1BOAA 5GP9A 3RYRA 3EUHC 3G71I 1MMDA 2B7EA 3LSGA 2K02A 4F92B 3MZHA 4XM3A 3N4MA 4HAMA 3BR6A 4LLGF 5HNFA 3FIWA 3IAS2 2LH9A 2TCTA 2NVUB 5K5OA 2A05A 1RETA 3H5RA 2M2EA 1J5YA 3DKXA 3Q3SA 3DWLE 5LHIA 1UG2A 4BUPA 3GO5A 2LRDA 3RZOJ 3NRVA 4P1WA 4G7ZF 1XN7A 3GBGA 2Z1DA 4HSTA 4HW0A 4B3AA 4ZTFA 1B9NA 4Y33A 3CCLI 4ZDPA 2PBIA 4TV7A 4IL6C 4L5IA 5JHUA 2QQ9A 3FXOA 3HTSB 4BACA 3GFJA 2BHYA 2FOKA 1WHUA 4ZZDA 3L2UA 2VQLA 1YIJI 4IHYA 3JRIA 1FOWA 1VQ8I 5FFXA 2ZSHB 2RNJA 2CMPA 2OC6A 4S04A 1OKRA 2F5CA 2PMZA 1FWZA 2DN0A 2IJLA 3G2BA 4DQ2A 5GAEJ 1GUUA 2CQNA 2ESNA 3L7WA 3Q5FA 2ICWG 5EEAA 4EJTA 4U0YA 1S72I 1FTTA 2E36A 4PGHA 3GCMA 2DXIA 2PMUA 2HQAA 3KPHA 1ZRCA 5C4XJ 2L5QA 1I6HJ 1IW7F 4BKXA 5FKNA 1DP7P 3LSIA 3FMRA 4CGZA 1J75A 1T0FC 2LOOA 4RDUA 2Z33A 4LK0F 1IRXA 1U5TB 2WAEA 2L54A 1Z77A 3QP6A 1ENHA 5HVQC 4D7NA 4RB0A 2CW0F 4BE0A 2CV0A 5D8KB 2XF7A 4M73A 1KONA 3CCEI 1J59A 2CW8A 1BM9A 2Y9ZA 3HSRA 2I8DA 1JJ6C 4A0ZA 3O2PE 1LKXA 3RCOA 4BEHA 4A3JJ 1AKHB 2V79A 4A3LJ 4OINF 3ZQQA 2DFHA 4BJ5C 3HHGA 4UV8A 1UELB 1Y1WJ 5K7ZA 1O3RA 3E5UA 3F3XA 3HSFA 3FKJA 5IP9J 4XKVA 4HOBA 5DM6F 5GPCA 3AFHA 4WWCA 2DJNA 1RPWA 2R93J 2FBIA 3QYBA 3TMOA 2HDWA 5GTIC 3ZQFA 4RB2C 4WK8F 3ZMUA 2E5NA 1ZR4A 2PFBA 5ICCA 3NARA 1USSA 4GGGA 1I1GA 3MCZA 2JZYA 1HXDA 3COAC 4IX7A 3F8MA 3DLLF 2DFEA 3VB2A 5JHFA 1SEUA 1HOMA 2CQ7A 3HSEA 3KP3A 4M3BA 1QQIA 4A0XA 2DCEA 4E7ZA 2GA1A 3KZYA 3IWFA 4AVZA 3WTTC 1P4XA 1HDPA 3BG7A 3SJMA 4M72A 3CCUI 4UUSA 1LUJB 4XN0A 2DA7A 2KMUA 5E18F 4ZDOA 1W5SA 1YLFA 2RAEA 3GF2A 3WU1B 1LB2A 3CLQA 2A07F 3LA2A 3BDDA 4MQ9F 1GVJA 5DD8A 1ZQ3P 3SZGA 4J19A 3OIOA 3U9GA 4DYCA 1J09A 3HOVJ 2FRHA 5IT3A 3PSFA 4A3DJ 2OA4A 3IH4A 4UV9A 1ZKGA 1J7KA 2VT2A 4HQEA 3B6AA 2DK8A 3LSTA 2PJRA 1WWXA 1HA8A 4AIHA 1BL0A 2RDPA 4DW6A 2ETHA 4MNUA 4FTHA 5E3NA 4V2FA 1KQ8A 3SZTA 4NNJA 1Z7LA 5C4JJ 2QUFA 5K1YA 4FE4A 4UXNA 3PM1A 1J2XA 4KDPA 4C30A 2A6EF 3KP7A 5DCFA 2W4SA 1W0TA 3S16J 1A5JA 3TGNA 1MKMA 5HODA 1ZELA 3BJOA 2X6XA 2IT0A 1U6GA 4N4OB 1KQ9A 2L9NA 1ZGJA 1MH3A 2QQAA 1FSEA 3DFGA 5KCMA 3VYUB 3I56I 9ANTA 3K0LA 2OF7A 3MZ8A 4GRIA 1QU3A 2R7UA 2NOJB 3T8RA 1TTYA 4DIQA 5JLXA 1JGGA 2EWNA 3GTPJ 2ZMEB 1WH7A 2F4IA 2LD5A 3OSGA 1U78A 2AQEA 2A5WA 3DP7A 4C3HJ 3A01B 2DOEA 3IH3A 4IEJA 4BEHB 1B72B 5CYVA 1QBJA 1Y8QB 2F5DA 2E2HJ 1Q1HA 4O3MA 3H0GJ 1O3QA 1PVEA 3CO6C 3M1CA 2P8TA 3MKWB 4AU7A 1NK2P 2V7FA 2VN2A 2Y2ZA 2GOMA 1G6NA 5BNGA 4QLCU 1SANA 3O6BB 4IRIA 4I0BA 1GT0C 5FLMJ 4S0HB 1DU6A 5B66C 2VQCA 3E5XA 2NS7A 2V1DA 4RAFA 3ECHA 1ZAOA 4IF4A 4PFOA 1S3JA 2P5LC 1VQLI 2L7KA 1ZGWA 3V8LA 1E17A 2A3SA 2DFFA 3I58A 5L3DA 2YX7A 4A69C 2F2EA 4OOIA 1X1PA 3BOQA 3IKTA 4BJTA 3GTMJ 2QSGX 2HXOA 3CUOA 2M5WA 2QWWA 3V7RA 3W2WA 4OMZA 1R36A 4JX5A 2K9NA 3M8FA 3GFMA 3IUOA 4R79A 3HEFA 2ISYA 3JREA 1IAWA 2G0EA 3A4CA 3DBLB 3CESA 2K3PA 1MBKA 4IPAA 5JFRA 1JJ8C 5HDGA 3J80K 4OWRB 1HF0A 3WTUC 1Z21A 3ZQLA 1BIBA 1BW6A 1SD5A 2LFBA 4U0WA 4BE1A 1IG7A 3P9CA 5FFZA 4I6ZA 4BY7J 2M8GX 3P7NA 1W36D 2M9HA 1OYIA 3FBIB 2ZNZA 2N8GA 2YU9J 2AXLA 1FTZA 1H8AC 2PJRB 1O7FA 1G3TA 4XLFA 1MBGA 1YE9A 1YS6A 1JKRC 5E3MA 1LNWA 3R0JA 3HRTA 3BQYA 4O6JA 2M30A 2BE5F 4OU0A 2FBHA 2LF7A 2XKPA 1XGSA 3CCYA 1FIAA 1B6AA 3ISPA 3V42A 1QVUA 3GTKJ 2FOWA 1APLC 4QTRA 1XTAA 3I71A 3RIRA 3T5XA 3DQVC 1WJDA 1FBQA 2DLLA 3SEZA 2QENA 3MD2A 2KISA 4FT8A 4KJZA 4KIBA 4N4NB 2MG4A 2UUZA 3LFUA 5TGTA 1YG2A 1RC9A 3F0CA 4HYEA 1YRNA 1D0ZA 5F0FA 1F5TA 3LSJA 1Y6IA 2K4BA 2VOPA 3KP6A 3Q0WA 3PSIA 4XKWA 3S93A 1OCRH 4EJVA 4DJAA 2JA7J 2KIMA 1EF4A 1I5ZA 1XDUA 2K86A 2ZFUA 2HZTA 1K83J 1PJRA 1P6RA 3GEZA 5E3OA 1VZ0A 4XRFA 4BYYA 1RUOA 2EZLA 3GTLJ 1FY7A 1OR7C 5ED4A 4UVAA 3F8BA 1FPQA 3V7CA 2XGEA 3MAJA 3CMAI 5JI6A 3FK7A 3BTJA 3L1PA 1R00A 1MSFC 2HYFA 2UWMA 1YYVA 3G1OA 1X1CA 2DA1A 2DA3A 3ABLH 1TBXA 5J1UA 1REPC 2ZB9A 1I3QJ 2HI3A 5F04A 2WWYA 4RBOA 4LLLA 3CF2A 5B1AH 1D1CA 1VF9A 1ODDA 2KIFA 2MA3A 4YIRX 1IZ1A 2ZJPF 5CLSA 1I1SA 2K3FA 3MWMA 3FHZA 3Q0VA 2CUFA 4HDUA 3E7LA 5CVIA 4BDZA 1YS7A 5FLXK 4QPQA 3WTZA 3FK6A 2C6YA 3LWFA 3CCSI 1ZG1A 3BR2A 3WE2A 1UCRA 2KIQA 4RGUA 4KITB 5IP7J 1B59A 2K27A 2V9KA 1ZH5A 2PLYA 4ZDLA 2F48A 3M07A 1IUFA 2HEOA 3I55I 4YFNF 1MJAA 1OCPA 4BXUA 3S2WA 3FMSA 1J9IA 3T8TA 3F8NA 4OIQF 2JA6J 2JRMA 3IH2A 3FXUA 4C2MJ 2EFWA 2ZXHA 1NHAA 3WTWC 5L3GA 2DQLA 2VQGA 1W5CC 3D1NI 3OIPA 3MEXA 2XPVA 3J7AY 4XN3A 3EYYA 2H94A 3BQZA 1AOYA 2KRCA 2HZDA 1HCRA 4KFCA 3CLOA 5K7HA 4RMNA 4RS8A 4IHWA 4RGRA 1HC8A 3MMYB 3WU0A 2P81A 5ILUA 3ABUA 1ZLKA 1HQCA 4FX0A 4XSZF 3IAM2 3DTKA 4FX4A 2XROA 4CCMA 3TO9A 3CUQC 3K9TA 1WCMJ 2BY0A 2QF7A 4RM2A 1ETKA 4PGGA 5J40A 2VIXA 4PSWA 4NDLA 2ZCWA 3DPLC 4CCOA 4DGWB 1F9NA 2K4JA 5B5EC 2VLAA 3DEEA 3ERED 1A6IA 3DBHB 1IRFA 1X1AA 5FRNA 3ZCOA 4V19K 1WVRA 2HNHA 4KUMA 1MMAA 3BR3A 2P5VA 3JAMK 4F3QA 2NYXA 1PDNC 5L3CA 1T6SA 3J80Z 2GAUA 3ZMTA 1MBEA 1VQNI 2ME6A 2P5KA 2VC1A 3K2ZA 3AAFA 4HF0A 3OOPA 5C44J 2CG4A 1DPRA 3DLAA 4X0GA 5IT9Z 2JWTA 3RPQA 1B4AA 3BR1A 4DZJA 1A04A 3LNQA 2XUBA 2CJJA 3RKXA 4GXOA 3RSNA 1YRNB 4AWXB 2CUEA 1WRJA 3FZVA 2IPQX 2FSWA 1D8KA 1D1AA 3HG9A 3QU3A 3JRGA 3OYAA 3DPUA 1X4PA 2EFNA 4ESBA 1IF1A 1M1EB 3KLNA 4UVCA 1RR7A 2ID3A 2YPRA 1E3PA 3RI4A 2OU2A 2WV0A 2V1XA 3DU6A 4HQMA 2CFOA 3BPVA 4N9HA 4KICA 1TC3C 4HSRA 5J4VA 1V5GA 3ZQIA 5DEQA 4ABZA 1G3SA 3LQRA 1ONVA 3RKWA 1EJ9A 1XSVA 2WB1N 1GV2A
chains in the Genus database with same CATH topology
4I76A 1JTXA 2HOAA 3S1NJ 1AHDP 5C4XJ 4A3MJ 4FCYA 4AC0A 3A02A 4M3EA 3SFIA 1DU0A 5K7FA 5IOYA 1I6HJ 4BKXA 5FKNA 2E19A 5M3MJ 1IC8A 2HDDA 3TW6A 4RDUA 1JKQC 2L7FP 2R92J 2CU7A 1Z77A 3M3YJ 1ENHA 2LK2A 2L9RA 1BW5A 4D7NA 2FX0A 3HOXJ 2GLOA 4MFEA 4BXXJ 2KDZA 2CRGA 3W6VA 3I4NJ 2Y9ZA 1ETQA 4XK4A 3K7AJ 1JJ6C 1ITYA 2ECBA 4A3JJ 1AKHB 1BJZA 1JUMA 4A3LJ 2HQ5A 5J1YA 1AKHA 2Y30A 5IOZA 2E1OA 3CMYA 2GM4A 1MSEC 1Y1WJ 3HOYJ 5K7ZA 5M5YJ 5IYCJ 1JUPA 3LSPA 2MGQA 5IP9J 1MBFA 4JX4A 1OJLA 5FKLA 2R5YA 5IYBJ 3JRFA 1LE8A 2JA5J 1H89C 5GPCA 3O8HA 4XRSA 2DMNA 2DJNA 2JA8J 4XICA 1RPWA 2R93J 1GV5A 3ZQFA 5FKOA 2HXIA 1ZR4A 3NARA 1IDYA 3C2BA 3G1MA 2HOSA 1PUFB 1MNMC 5F08A 2IAIA 2WAQN 1HOMA 4M3BA 2LLKA 1ETVA 1WPKA 1ETWA 5IP6A 1RKTA 3SDGA 4A3EJ 4UUSB 3PO3J 1JT6A 4QIWN 3HOWJ 3DEWA 1HDPA 1JT0A 3SJMA 4D7MA 4UUSA 1HLVA 2EBIA 2DA7A 1K61A 1UHSA 2RAEA 4X1EA 3LSRA 1XG1A 1LFBA 1TWFJ 1NK3P 1TWCJ 1ZQ3P 1MH4A 4J19A 3OIOA 4DYCA 3HOVJ 2ME0A 2KT0A 4A3DJ 3IH4A 2NVQJ 1ZKGA 3G1LA 3B6AA 1TWAJ 1VNDA 3TW7A 4A3GJ 1O4XA 2NOGA 1BL0A 4DW6A 3HOZJ 2HYJA 3O8GA 4FTHA 3WHBA 5E3NA 4V2FA 4V2GA 5FKKA 3ZOBA 5C4JJ 1IGNA 1TWHJ 4FE4A 3PM1A 4CYCB 3B6CA 2AO9A 5IYDJ 2K9QA 3S1RJ 2DMUA 4M3GA 1WH5A 1POGA 1X58A 4A3IJ 1W0TA 3S16J 1A5JA 2ECCA 5HODA 1S7EA 3BG9A 4GFBA 4IHXA 1X2NA 5J1RA 5EGOB 2NS8A 1MH3A 3GTGJ 2JJ7A 9ANTA 2OF7A 1NTCA 2AHQA 2LTPA 3HB9A 1QRYA 1GVDA 5EGOA 1IV6A 1FIPA 2JK3A 5J3LA 1B8IA 1X2MA 2XGCA 5JLXA 1Z0XA 1JGGA 2OPTA 3IV5A 2X6OA 3GTPJ 3OSFA 1WH7A 3ZQGA 2LD5A 3OSGA 1U78A 4C3HJ 3A01B 5EG0A 3QPLA 2FD5A 1SFOJ 3BR5A 3IH3A 4IEJA 1B72B 1QPIA 3S1MJ 2DA5A 2Y9YA 3A01A 3JRCA 2E2HJ 1OFCX 3H0GJ 2ID6A 1B72A 4BBRJ 2NVXJ 5F27A 5E3LA 2LVSA 2CQQA 3UKGA 1NK2P 2Y2ZA 5BNGA 1SANA 1JTYA 2MW8A 3ZQHA 1GT0C 5M5XJ 5FLMJ 2B63J 1CQTA 4S0HB 1DU6A 4M3FA 2NS7A 3LOCA 1IJWC 2R5YB 2H8RA 1LE8B 2XSDC 1ZGWA 2XPUA 2L0KA 1W0UA 2HOTA 4XRMA 5EF6A 4Y7NJ 4A69C 2VI6A 2R7ZJ 2CQXA 4A3BJ 3MVPA 3BTCA 1F43A 4MO7A 1ETXA 4XIDA 2R5ZA 3GTMJ 1U9OA 2HXOA 1U8BA 3TEDA 3VPRA 4IHVA 3Q0UA 2VUMJ 4JX5A 2K9NA 4DYRA 5F1JA 3HEFA 1I50J 3JREA 5EZHA 5M3FJ 2G0EA 5DTDA 3GTQJ 2E2IJ 2L7MP 1ZR2A 1MBKA 1JJ8C 2X48A 5IPAA 1HF0A 3BG3A 3K2AA 2QCOA 3S14J 3BTLA 3ZQLA 2M34A 3JRBA 2XPWA 1BW6A 1IG7A 2LFBA 1ETYA 1ZK8A 2DMTA 4A93J 4I6ZA 1MBJA 4BY7J 1UMQA 1MBHA 1ORKA 2M8GX 4FISA 2NVYJ 1IDZA 4A3FJ 1LFUP 2M9HA 3RZDJ 1WI3A 2N8GA 2PMZN 2YU9J 1FTZA 1H8AC 2I10A 1MBGA 3PO2J 2VPRA 5EZGA 2XB0X 1JKRC 5E3MA 1T33A 4XRSG 3BQYA 3RKQA 2EH3A 1AU7A 3HDDA 3A03A 4M3DA 3CCYA 1FIAA 3DCFA 2L7ZA 1QVUA 3WHCA 3JRDA 2LKXA 3GTKJ 1APLC 4QTRA 3S15J 4B4CA 5DS9A 2EZHA 4AUXA 1D5YA 2VKEA 2XB5A 4JP0A 3NAUA 3H3VK 4DYQA 2EZKA 2MG4A 3HM5A 4D5FA 2VKVA 3JR9A 1ETOA 3F0CA 1YRNA 5F0FA 3LSJA 2D5VA 3M4OJ 3Q0WA 1B8IB 2JA7J 2LP0A 1EF4A 1K83J 5E3OA 2W48A 1JKPC 2EZLA 2NVTJ 3GTLJ 1XC5A 5EG0B 5GPAA 2Y31A 5F0HA 3HGGA 4FE7A 1R9TJ 2XGEA 1E3OC 3HOUJ 3FK7A 3BTJA 3GTOJ 2WV1A 5JLWA 2DTZA 3L1PA 2JN6A 3ZQCA 1MSFC 2O7OA 2FJ1A 4HNVA 1FEXA 1VI0A 2DA1A 3G1OA 2DA3A 5F0CA 5J1UA 2IBDA 1FJLA 2DA2A 2MSYA 2ZB9A 3I4MJ 1I3QJ 2HI3A 5F04A 2O8KA 4RBOA 1T56A 2K9SA 1VF9A 5EYRA 2LY9A 2YS9A 3RQIA 4MIMA 2FQ4A 3Q0VA 3GTJJ 2CUFA 4L5EA 2E2JJ 4BY1J 3E7LA 4AYBN 1P7IA 2K40A 2YUSA 2R5ZB 3S17J 3FK6A 3FISA 4UUTA 3FKIJ 1WGXA 4W97A 4C3JJ 3BR2A 4QSHA 5IP7J 1HDDC 2EZIA 3JRHA 4X6AJ 2EQRA 3MKLA 2TRTA 3MN2A 4JX6A 5C3EJ 1IUFA 1TWGJ 1OCPA 3BTIA 1VFCA 4A3CJ 2COBA 1JKOC 2JA6J 4Y52J 3IH2A 1BA5A 3BT9A 3HKZN 4C2MJ 2ELKA 4MFDA 4W1UA 2IEKA 1P7JA 2LR8A 1G2HA 4BBSJ 4EEFG 4JYKA 3D1NI 3BG5A 1RKWA 2XPVA 3HBLA 3CQZJ 3BQZA 1Y1VJ 1JUSA 1HCRA 3S2HJ 4C3IJ 5K7HA 3JRAA 1OCTC 4LOCA 4MLOA 4IHWA 4M6VA 2X9DA 5GP9A 2P81A 1PUFA 1H88C 3LSGA 5FJ8J 3QPSA 5FKMA 3TP3A 3BR6A 1WCMJ 2QF7A 3FIWA 5EDNA 2TCTA 1ETKA 4G12A 1GDTA 1RETA 4NDLA 3TP0A 2M2EA 3Q3SA 2JMWA 3CDLA 1ZTRA 4A3KJ 1A6IA 1UG2A 4B1RA 2Y0SN 3RZOJ 3BR3A 2R0QC 2XRLA 2GBYA 3GBGA 1MBEA 2DMQA 4B3AA 2ME6A 1F36A 1RESA 1Q1VA 4D5CA 5C44J 2JWTA 3BR1A 3S2DJ 4DZJA 1QVTA 2XGDA 3LNQA 3QQAA 2CJJA 2DA6A 3HGYA 1YRNB 1IRZA 2CUEA 5FLVA 1XS9A 2DMPA 3JRGA 5M5WJ 4IHYA 3BR0A 3JRIA 2DA4A 1RR7A 3OOUA 2ID3A 4DZPA 2DN0A 3S1QJ 1TC3C 1GUUA 4CYCA 3ZQIA 2H1KA 4ABZA 5EEAA 2M0CA 1FTTA 1U9NA 2O9LA 2WB1N 1GV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I76 A;  1JTX A;  2HOA A;  3S1N J;  1AHD P;  5C4X J;  4A3M J;  4FCY A;  4AC0 A;  3A02 A;  4M3E A;  3SFI A;  1DU0 A;  5K7F A;  5IOY A;  1I6H J;  4BKX A;  5FKN A;  2E19 A;  5M3M J;  1IC8 A;  2HDD A;  3TW6 A;  4RDU A;  1JKQ C;  2L7F P;  2R92 J;  2CU7 A;  1Z77 A;  3M3Y J;  1ENH A;  2LK2 A;  2L9R A;  1BW5 A;  4D7N A;  2FX0 A;  3HOX J;  2GLO A;  4MFE A;  4BXX J;  2KDZ A;  2CRG A;  3W6V A;  3I4N J;  2Y9Z A;  1ETQ A;  4XK4 A;  3K7A J;  1JJ6 C;  1ITY A;  2ECB A;  4A3J J;  1AKH B;  1BJZ A;  1JUM A;  4A3L J;  2HQ5 A;  5J1Y A;  1AKH A;  2Y30 A;  5IOZ A;  2E1O A;  3CMY A;  2GM4 A;  1MSE C;  1Y1W J;  3HOY J;  5K7Z A;  5M5Y J;  5IYC J;  1JUP A;  3LSP A;  2MGQ A;  5IP9 J;  1MBF A;  4JX4 A;  1OJL A;  5FKL A;  2R5Y A;  5IYB J;  3JRF A;  1LE8 A;  2JA5 J;  1H89 C;  5GPC A;  3O8H A;  4XRS A;  2DMN A;  2DJN A;  2JA8 J;  4XIC A;  1RPW A;  2R93 J;  1GV5 A;  3ZQF A;  5FKO A;  2HXI A;  1ZR4 A;  3NAR A;  1IDY A;  3C2B A;  3G1M A;  2HOS A;  1PUF B;  1MNM C;  5F08 A;  2IAI A;  2WAQ N;  1HOM A;  4M3B A;  2LLK A;  1ETV A;  1WPK A;  1ETW A;  5IP6 A;  1RKT A;  3SDG A;  4A3E J;  4UUS B;  3PO3 J;  1JT6 A;  4QIW N;  3HOW J;  3DEW A;  1HDP A;  1JT0 A;  3SJM A;  4D7M A;  4UUS A;  1HLV A;  2EBI A;  2DA7 A;  1K61 A;  1UHS A;  2RAE A;  4X1E A;  3LSR A;  1XG1 A;  1LFB A;  1TWF J;  1NK3 P;  1TWC J;  1ZQ3 P;  1MH4 A;  4J19 A;  3OIO A;  4DYC A;  3HOV J;  2ME0 A;  2KT0 A;  4A3D J;  3IH4 A;  2NVQ J;  1ZKG A;  3G1L A;  3B6A A;  1TWA J;  1VND A;  3TW7 A;  4A3G J;  1O4X A;  2NOG A;  1BL0 A;  4DW6 A;  3HOZ J;  2HYJ A;  3O8G A;  4FTH A;  3WHB A;  5E3N A;  4V2F A;  4V2G A;  5FKK A;  3ZOB A;  5C4J J;  1IGN A;  1TWH J;  4FE4 A;  3PM1 A;  4CYC B;  3B6C A;  2AO9 A;  5IYD J;  2K9Q A;  3S1R J;  2DMU A;  4M3G A;  1WH5 A;  1POG A;  1X58 A;  4A3I J;  1W0T A;  3S16 J;  1A5J A;  2ECC A;  5HOD A;  1S7E A;  3BG9 A;  4GFB A;  4IHX A;  1X2N A;  5J1R A;  5EGO B;  2NS8 A;  1MH3 A;  3GTG J;  2JJ7 A;  9ANT A;  2OF7 A;  1NTC A;  2AHQ A;  2LTP A;  3HB9 A;  1QRY A;  1GVD A;  5EGO A;  1IV6 A;  1FIP A;  2JK3 A;  5J3L A;  1B8I A;  1X2M A;  2XGC A;  5JLX A;  1Z0X A;  1JGG A;  2OPT A;  3IV5 A;  2X6O A;  3GTP J;  3OSF A;  1WH7 A;  3ZQG A;  2LD5 A;  3OSG A;  1U78 A;  4C3H J;  3A01 B;  5EG0 A;  3QPL A;  2FD5 A;  1SFO J;  3BR5 A;  3IH3 A;  4IEJ A;  1B72 B;  1QPI A;  3S1M J;  2DA5 A;  2Y9Y A;  3A01 A;  3JRC A;  2E2H J;  1OFC X;  3H0G J;  2ID6 A;  1B72 A;  4BBR J;  2NVX J;  5F27 A;  5E3L A;  2LVS A;  2CQQ A;  3UKG A;  1NK2 P;  2Y2Z A;  5BNG A;  1SAN A;  1JTY A;  2MW8 A;  3ZQH A;  1GT0 C;  5M5X J;  5FLM J;  2B63 J;  1CQT A;  4S0H B;  1DU6 A;  4M3F A;  2NS7 A;  3LOC A;  1IJW C;  2R5Y B;  2H8R A;  1LE8 B;  2XSD C;  1ZGW A;  2XPU A;  2L0K A;  1W0U A;  2HOT A;  4XRM A;  5EF6 A;  4Y7N J;  4A69 C;  2VI6 A;  2R7Z J;  2CQX A;  4A3B J;  3MVP A;  3BTC A;  1F43 A;  4MO7 A;  1ETX A;  4XID A;  2R5Z A;  3GTM J;  1U9O A;  2HXO A;  1U8B A;  3TED A;  3VPR A;  4IHV A;  3Q0U A;  2VUM J;  4JX5 A;  2K9N A;  4DYR A;  5F1J A;  3HEF A;  1I50 J;  3JRE A;  5EZH A;  5M3F J;  2G0E A;  5DTD A;  3GTQ J;  2E2I J;  2L7M P;  1ZR2 A;  1MBK A;  1JJ8 C;  2X48 A;  5IPA A;  1HF0 A;  3BG3 A;  3K2A A;  2QCO A;  3S14 J;  3BTL A;  3ZQL A;  2M34 A;  3JRB A;  2XPW A;  1BW6 A;  1IG7 A;  2LFB A;  1ETY A;  1ZK8 A;  2DMT A;  4A93 J;  4I6Z A;  1MBJ A;  4BY7 J;  1UMQ A;  1MBH A;  1ORK A;  2M8G X;  4FIS A;  2NVY J;  1IDZ A;  4A3F J;  1LFU P;  2M9H A;  3RZD J;  1WI3 A;  2N8G A;  2PMZ N;  2YU9 J;  1FTZ A;  1H8A C;  2I10 A;  1MBG A;  3PO2 J;  2VPR A;  5EZG A;  2XB0 X;  1JKR C;  5E3M A;  1T33 A;  4XRS G;  3BQY A;  3RKQ A;  2EH3 A;  1AU7 A;  3HDD A;  3A03 A;  4M3D A;  3CCY A;  1FIA A;  3DCF A;  2L7Z A;  1QVU A;  3WHC A;  3JRD A;  2LKX A;  3GTK J;  1APL C;  4QTR A;  3S15 J;  4B4C A;  5DS9 A;  2EZH A;  4AUX A;  1D5Y A;  2VKE A;  2XB5 A;  4JP0 A;  3NAU A;  3H3V K;  4DYQ A;  2EZK A;  2MG4 A;  3HM5 A;  4D5F A;  2VKV A;  3JR9 A;  1ETO A;  3F0C A;  1YRN A;  5F0F A;  3LSJ A;  2D5V A;  3M4O J;  3Q0W A;  1B8I B;  2JA7 J;  2LP0 A;  1EF4 A;  1K83 J;  5E3O A;  2W48 A;  1JKP C;  2EZL A;  2NVT J;  3GTL J;  1XC5 A;  5EG0 B;  5GPA A;  2Y31 A;  5F0H A;  3HGG A;  4FE7 A;  1R9T J;  2XGE A;  1E3O C;  3HOU J;  3FK7 A;  3BTJ A;  3GTO J;  2WV1 A;  5JLW A;  2DTZ A;  3L1P A;  2JN6 A;  3ZQC A;  1MSF C;  2O7O A;  2FJ1 A;  4HNV A;  1FEX A;  1VI0 A;  2DA1 A;  3G1O A;  2DA3 A;  5F0C A;  5J1U A;  2IBD A;  1FJL A;  2DA2 A;  2MSY A;  2ZB9 A;  3I4M J;  1I3Q J;  2HI3 A;  5F04 A;  2O8K A;  4RBO A;  1T56 A;  2K9S A;  1VF9 A;  5EYR A;  2LY9 A;  2YS9 A;  3RQI A;  4MIM A;  2FQ4 A;  3Q0V A;  3GTJ J;  2CUF A;  4L5E A;  2E2J J;  4BY1 J;  3E7L A;  4AYB N;  1P7I A;  2K40 A;  2YUS A;  2R5Z B;  3S17 J;  3FK6 A;  3FIS A;  4UUT A;  3FKI J;  1WGX A;  4W97 A;  4C3J J;  3BR2 A;  4QSH A;  5IP7 J;  1HDD C;  2EZI A;  3JRH A;  4X6A J;  2EQR A;  3MKL A;  2TRT A;  3MN2 A;  4JX6 A;  5C3E J;  1IUF A;  1TWG J;  1OCP A;  3BTI A;  1VFC A;  4A3C J;  2COB A;  1JKO C;  2JA6 J;  4Y52 J;  3IH2 A;  1BA5 A;  3BT9 A;  3HKZ N;  4C2M J;  2ELK A;  4MFD A;  4W1U A;  2IEK A;  1P7J A;  2LR8 A;  1G2H A;  4BBS J;  4EEF G;  4JYK A;  3D1N I;  3BG5 A;  1RKW A;  2XPV A;  3HBL A;  3CQZ J;  3BQZ A;  1Y1V J;  1JUS A;  1HCR A;  3S2H J;  4C3I J;  5K7H A;  3JRA A;  1OCT C;  4LOC A;  4MLO A;  4IHW A;  4M6V A;  2X9D A;  5GP9 A;  2P81 A;  1PUF A;  1H88 C;  3LSG A;  5FJ8 J;  3QPS A;  5FKM A;  3TP3 A;  3BR6 A;  1WCM J;  2QF7 A;  3FIW A;  5EDN A;  2TCT A;  1ETK A;  4G12 A;  1GDT A;  1RET A;  4NDL A;  3TP0 A;  2M2E A;  3Q3S A;  2JMW A;  3CDL A;  1ZTR A;  4A3K J;  1A6I A;  1UG2 A;  4B1R A;  2Y0S N;  3RZO J;  3BR3 A;  2R0Q C;  2XRL A;  2GBY A;  3GBG A;  1MBE A;  2DMQ A;  4B3A A;  2ME6 A;  1F36 A;  1RES A;  1Q1V A;  4D5C A;  5C44 J;  2JWT A;  3BR1 A;  3S2D J;  4DZJ A;  1QVT A;  2XGD A;  3LNQ A;  3QQA A;  2CJJ A;  2DA6 A;  3HGY A;  1YRN B;  1IRZ A;  2CUE A;  5FLV A;  1XS9 A;  2DMP A;  3JRG A;  5M5W J;  4IHY A;  3BR0 A;  3JRI A;  2DA4 A;  1RR7 A;  3OOU A;  2ID3 A;  4DZP A;  2DN0 A;  3S1Q J;  1TC3 C;  1GUU A;  4CYC A;  3ZQI A;  2H1K A;  4ABZ A;  5EEA A;  2M0C A;  1FTT A;  1U9N A;  2O9L A;  2WB1 N;  1GV2 A; 
#chains in the Genus database with same CATH topology
 2HYG D;  1RR8 C;  3CD6 I;  1WFX A;  2PX9 A;  3TBI A;  5ICE A;  3DEU A;  3OS1 A;  1AHD P;  4A3M J;  1WZ2 A;  3S1N J;  4XLH A;  4M3E A;  1DU0 A;  5K7F A;  1IV8 A;  4R8H A;  1W7P B;  4BAY A;  2DPD A;  2ZXJ A;  3QRF F;  2BZT A;  3TDU C;  4UVB A;  1B1B A;  3ZGK A;  2R92 J;  4RAZ A;  1CGP A;  2ZKZ A;  3H9J A;  3SQN A;  2F5F A;  2L9R A;  2GA2 A;  2J5O A;  3A0H C;  3NEU A;  4CO8 A;  3L2R A;  1BW5 A;  1U5T A;  2KL4 A;  1D5V A;  1NG6 A;  3S8P A;  1BI3 A;  2BGC A;  3L09 A;  4MFE A;  2HWV A;  4P55 A;  3U1K A;  2W84 A;  2HVR A;  3I4N J;  4LG3 A;  2DQR A;  3IKV A;  4ZTJ A;  2O0Y A;  2LSO A;  2FML A;  2VJI A;  3A2K A;  2GZW A;  4MTD A;  1LVA A;  4B43 A;  1BR1 A;  2FE3 A;  2UXN A;  4PCQ A;  4BHC A;  1JUM A;  5E20 A;  3JW4 A;  1AKH A;  3ZR8 X;  2JVG A;  2QQB A;  3KFW X;  1BC7 C;  2YSR A;  3BY6 A;  3KYC B;  1WQ2 A;  2E1O A;  4F93 B;  3CMY A;  2IGK A;  3HOY J;  1S29 A;  5M5Y J;  2MGQ A;  4JX4 A;  3HTU A;  2CGP A;  3TDZ C;  1DQU A;  5D5X B;  1OMI A;  3JRF A;  3PNV A;  2H8W A;  1SFU A;  3O8H A;  4XRS A;  3ASO H;  1EV7 A;  3BWG A;  3LQQ A;  1UFM A;  4RLQ A;  3M7G A;  4YRV A;  2L4A A;  1GV5 A;  3EQL F;  2HXI A;  3GX4 X;  4I09 A;  1OYY A;  1A36 A;  2RRE A;  5EJC A;  1P4W A;  3BLY A;  3C2B A;  1FSH A;  5KAI C;  3ECO A;  1QPM A;  2BHZ A;  5FLX Z;  3L2Q A;  1LEB A;  3HIF A;  3F72 A;  2LY2 A;  1MNM C;  2JRT A;  4JOM A;  5ERI A;  2IP2 A;  3FXJ A;  4AYB A;  1A35 A;  1SFE A;  3FM3 A;  1ETV A;  1IN4 A;  2RNG A;  2EFQ A;  1Y8R B;  1S9H A;  1MMN A;  4NC8 A;  2HU9 A;  3CP2 A;  1VQ6 I;  1JT0 A;  4HV6 A;  1W7P D;  1YW8 A;  3CO7 C;  3OYI A;  2CUZ A;  3F9K A;  1R58 A;  3GFL A;  2NNY A;  3GYH X;  4I0A A;  1LFB A;  1N78 A;  4EM0 B;  1R4M B;  1TWC J;  3HKZ A;  4XSX F;  1MH4 A;  1BOB A;  1FYK A;  2NNN A;  2Z9O A;  2WAD A;  2ME0 A;  4G7H F;  5BMZ A;  2DPU A;  2ZSI B;  4U7D A;  1N25 A;  4Z2Y A;  4XLE A;  4HZF A;  2XAJ A;  3IHU A;  4XOR A;  1VND A;  3I53 A;  5J6X A;  4A3G J;  1O4X A;  2NOG A;  3GZN B;  2IGM A;  2EIJ H;  4PJN A;  5E79 C;  3O8G A;  2R7F A;  2V9V A;  2WAF A;  5AIP A;  1ZYR F;  3AG3 H;  3QP5 A;  3HRU A;  4LFU A;  3OR2 C;  2PMH A;  4U88 A;  3DBR B;  3B6C A;  3TOB A;  2K9Q A;  2CYY A;  1CF7 A;  1WH5 A;  4PDK A;  4XKC A;  2DBB A;  1POG A;  4LIU A;  5DYM A;  1YJW I;  1ZRD A;  5L3F A;  5LGU A;  4A3I J;  1XGN A;  2LKP A;  2WY8 Q;  3CJN A;  1FOY A;  5LEK A;  3JAM Z;  2MAB A;  2M7B A;  5IY5 H;  2VON A;  1S7E A;  4XLC A;  3BG9 A;  3DTE A;  2DO7 A;  4CZC A;  3P9I A;  5J1R A;  5EGO B;  2VBW A;  4NC7 A;  3GXO A;  1V5E A;  2OQR A;  2AHQ A;  2LTP A;  2XSJ C;  4GO1 A;  1B8I A;  5GAH J;  1ZG3 A;  2JK3 A;  4QWQ A;  5J3L A;  1X2M A;  2XGC A;  1Z0X A;  4BHP A;  1XPX A;  4E7I A;  3OSF A;  1R22 A;  1IUY A;  2F6C A;  3ZQG A;  4G94 A;  3C2G A;  4BQA A;  4ENM A;  3C2H A;  2ZME A;  4M6X A;  1R5H A;  2FD5 A;  1SFO J;  3BR5 A;  5FRO A;  1HKQ A;  1JI8 A;  1MMS A;  4CCK A;  1QPI A;  2Y9Y A;  3A01 A;  3JRC A;  1OFC X;  3ZN1 A;  1B72 A;  3RYP A;  1F4K A;  3S3O A;  1SVO A;  2R3S A;  5F27 A;  5E8G A;  2CQQ A;  4YFX F;  3WGG A;  3QWL A;  3I0T A;  2Z3Y A;  2R7W A;  1QZE A;  2NXN B;  2BY1 A;  2RQP A;  1JTY A;  2V4J C;  2VJJ A;  2VT3 A;  4XNF A;  2QZ8 A;  3ZQH A;  5M5X J;  1CQT A;  1Y0N A;  3QYE A;  4M3F A;  1UHM A;  2XKO A;  1Z67 A;  2ZBK A;  1JGS A;  2H8R A;  3SFZ A;  2W57 A;  5E1W A;  2Q2E B;  2V26 A;  2L0K A;  3OYF A;  1W0U A;  1K4T A;  1UB9 A;  1SMY F;  2X0L A;  4CZZ A;  3WTY C;  3GZ6 A;  4EM1 A;  4A3B J;  4MQV A;  3BTC A;  3CJT B;  1F43 A;  5FO5 A;  1ETX A;  4P96 A;  4B3X A;  4XID A;  2PQ8 A;  2R5Z A;  1VQ4 I;  3EYI A;  4HNT A;  1U8B A;  3AG1 H;  1D0X A;  3VPR A;  1D8J A;  2CUJ A;  2XV4 S;  3Q0U A;  3HRS A;  1Z6T A;  2P0W A;  4PSX A;  2VUM J;  4YIF A;  3BJ6 A;  1X3Z B;  3EUK L;  4DYR A;  4F91 B;  4CH7 A;  1S5L C;  3PNT A;  1BR4 A;  1FT9 A;  2QQ8 A;  4Y15 A;  1N77 A;  1I50 J;  5M3F J;  1IO2 A;  3HPG A;  5DTD A;  4KN7 X;  1KQ0 A;  5D4R A;  5E17 F;  4XL9 A;  1J0R A;  1ZR2 A;  4BS9 A;  1Z91 A;  3K4B A;  4BQQ A;  2QA4 I;  1MND A;  4Q4Z F;  1L3L A;  2GIV A;  2QCO A;  4BH9 A;  3K4L A;  5LHH A;  1R1U A;  1I39 A;  3HYI A;  2XAF A;  3JRB A;  4WXC A;  2OUM A;  3I54 A;  1RI7 A;  4OMY A;  4CDG A;  2W85 A;  3V8J A;  1KGS A;  2A61 A;  4LLN A;  2XAQ A;  2DMT A;  1MBJ A;  2XC7 A;  4DNC A;  3G73 A;  1FZP B;  1ORK A;  2JVH A;  1U8R A;  1IDZ A;  2EJR A;  1I27 A;  4F52 A;  5JR3 A;  3RZD J;  3I5U A;  5F64 A;  2KZV A;  3K1N A;  2XB0 X;  1P2F A;  3MQ0 A;  3FXL A;  4ENJ A;  3IP4 B;  4Y17 A;  4J00 A;  1PYV A;  1FNN A;  2EPF A;  3S3M A;  2BVL A;  3RKQ A;  1OQY A;  2IS6 A;  2EH3 A;  1XDS A;  1AU7 A;  4CHU A;  2R7T A;  1FBU A;  4IZZ A;  3DCF A;  1R6R A;  3PIO F;  1CF7 B;  3FWE A;  1K4S A;  2LKX A;  2COM A;  3UNG C;  4B4C A;  2DW4 A;  2EZH A;  2IW5 A;  2XAU A;  4JP0 A;  1VQO I;  3OYC A;  1XSX A;  2EZK A;  2VBY A;  3D5L A;  1KZH A;  3ZN0 A;  1OYW A;  1SD4 A;  3M1E A;  3Q9S A;  2PEX A;  1UST A;  4B44 A;  1DPU A;  4M9X A;  3M4O J;  4HBL A;  1B8I B;  2LBF A;  1MW7 A;  4Q5S F;  3DTI A;  4A0Y A;  4HF2 A;  1R5I D;  1X3U A;  3R6S A;  1JKP C;  2K7L A;  4L9T A;  4CA0 A;  2Z2S B;  2R7R A;  3I64 A;  2X1D A;  3HL2 A;  1TT5 B;  1LDD A;  1R1V A;  5J4Y A;  3WG9 A;  2Y31 A;  4E4H A;  5F0H A;  2DT5 A;  2Z5U A;  4IRG A;  3DKY A;  3AG2 H;  1WJA A;  3J7Y J;  1Z3X A;  3VFZ A;  2QKL B;  4I7H A;  3TQN A;  5LLQ A;  2AS5 F;  3K1M A;  2W24 A;  1R23 A;  2Y48 A;  4MTE A;  2VOO A;  4ON0 A;  2QEX I;  4OAY A;  2FJ1 A;  4WCG A;  1S8N A;  1K79 A;  2P7V B;  3ZMS A;  2IBD A;  2MSY A;  1FX7 A;  5F6F A;  1YHQ I;  2KFD A;  4ESJ A;  1R71 A;  1PP7 U;  1WJC A;  4UB8 C;  3LL7 A;  4EJU A;  4G6T B;  3ZMV A;  2R7V A;  3RQI A;  2STW A;  1R4N B;  3JTH A;  4KIS A;  2HDC A;  2V9P A;  3BPX A;  3FBN B;  4L5E A;  2DT7 B;  3VSL A;  1IN7 A;  1DUX C;  3S17 J;  2R5Z B;  5H2F C;  3QYF A;  5KK1 A;  5HS8 A;  4W97 A;  2M4G A;  4QSH A;  4IQ4 A;  2EZI A;  3OL3 A;  3CMM A;  3O3K A;  1ZAR A;  3MKL A;  3MN2 A;  5KAF C;  5C3E J;  2FU4 A;  4I2O A;  3L2W A;  3CTA A;  5DDG A;  4A3C J;  2COB A;  5JVT A;  5HLT A;  5FRM A;  1BA5 A;  3ROU A;  2ELK A;  4EM2 A;  4W1U A;  1P7J A;  1WI9 A;  1Z7U A;  2LR8 A;  2IA2 A;  3W3C A;  1AWC A;  2LC2 A;  3E6C C;  4JYK A;  3SXY A;  2E35 A;  3WGH A;  1RIO H;  3CQZ J;  4KN4 X;  2E34 A;  2M4K A;  4HF1 A;  4BGD A;  4MLO A;  4M6V A;  2QVO A;  5DD4 A;  5BPD A;  1VQP I;  2O6G E;  4CCN A;  3VYT B;  3TP3 A;  2WC2 A;  3ESW B;  2EFP A;  2HPM A;  1GDT A;  1MDM B;  2OV7 A;  3KZZ A;  2LKS A;  3CDL A;  3H3U A;  3QPT A;  3HOS A;  3QOD A;  4E7K A;  4A3K J;  2STT A;  3DF8 A;  2XF6 A;  4B1R A;  2Y0S N;  2Y69 H;  3QOP A;  4DBR A;  1RUN A;  3UR3 C;  4JBA A;  3OYN A;  3OWT A;  2KP6 A;  3S3N A;  4F55 A;  4UHT A;  2XRL A;  1FP2 A;  1X1D A;  2VB6 A;  2G7U A;  3LFK A;  1F36 A;  1RES A;  1WJF A;  3BG6 A;  4LGW A;  4YEJ A;  5B3S H;  5TJJ A;  5D5W B;  2DOD A;  2X51 A;  2XAH A;  1T38 A;  4NBQ A;  1H9T A;  3S2D J;  1L0O C;  4XMY A;  4LB6 B;  4BDY A;  1QVT A;  3QQA A;  1LDJ A;  4HX8 A;  4OAZ A;  5ICG A;  1EH6 A;  2VE8 A;  3HUG A;  2ZJ2 A;  1LPQ A;  4GYG A;  1MJB A;  2R4G A;  5FLV A;  1XS9 A;  2HOE A;  3SYT A;  3U1D A;  1LVK A;  5M5W J;  2LBF B;  2DFI A;  2DA4 A;  1VQ7 I;  3S32 A;  2P6S A;  2RC4 A;  1LQ1 A;  1G3W A;  4DZP A;  3S1Q J;  1NG7 A;  1XMA A;  2FEZ A;  1P9Q C;  4CYC A;  2VJ5 A;  2DTR A;  5L3E A;  2KLO A;  3N97 A;  4XON A;  1U9N A;  2O9L A;  3B02 A;  2CO5 A;  4I76 A;  5DCM A;  4L9J A;  4A6E A;  1SVM A;  1S7O A;  4OIR F;  4AC0 A;  3SFI A;  5FD5 A;  3IL2 A;  4FCY A;  5IOY A;  2GXA A;  1RNL A;  3CJQ B;  3PNY A;  3FX3 A;  3PJR A;  5M3M J;  4XQF A;  5E1Z B;  2HDD A;  1YW7 A;  3REO A;  1AA7 A;  1W7P A;  1JKQ C;  2LRE A;  2CU7 A;  3M3Y J;  2FX0 A;  3EUH A;  2Q1Z B;  3DXJ F;  3LSK A;  3M9A A;  2GLO A;  2IS2 A;  3WG7 H;  3H36 A;  1T8I A;  4A12 A;  1UJ8 A;  3H5N A;  3H9G A;  2CRG A;  3W6V A;  3KLO A;  3GLL A;  1BI2 A;  3A1Y A;  1ETQ A;  2VE9 A;  2JA2 A;  2KZG A;  3OYB A;  4KT6 A;  2E7X A;  3HJE A;  4AD9 A;  1BJZ A;  4H0E A;  2Q8K A;  2HQ5 A;  4WXD A;  2O03 A;  4ZJZ A;  2EA4 A;  4AID A;  5J1Y A;  3FDY A;  1U2W A;  4FAS D;  1PUE E;  2XVC A;  3H0D A;  4MGR A;  2GQQ A;  2W82 A;  2L9V A;  1K6O A;  3AG4 H;  5CVR A;  5HOO A;  4NQW A;  3K4J A;  4Y13 A;  1JUP A;  3LSP A;  2IGO A;  2RVC A;  1OJL A;  5FKL A;  1BJA A;  5J8C A;  2KJB A;  2R5Y A;  1LE8 A;  1T39 A;  1N75 A;  2JA5 J;  2JPC A;  1LEA A;  4P9U A;  3HXL A;  2EIK H;  5LGT A;  1FOX A;  1ZRF A;  2F5E A;  2JA8 J;  3ABK H;  2F4M B;  5H6R A;  2D1H A;  3DU5 A;  2UZK A;  3E5Q A;  1Z3Y A;  1Z1D A;  1G59 A;  2D2W A;  4HEA 2;  1IDY A;  2LMD A;  2VQH A;  3E6D A;  3G1M A;  1JXS A;  4I01 A;  2OAZ A;  4LD5 A;  4Y4R A;  1FMV A;  2TDX A;  4BQO A;  4M6Y A;  2X4H A;  5F08 A;  5LD2 C;  1D0Y A;  2IAI A;  2L3D A;  2DOF A;  2WAQ N;  1P92 A;  5KNL A;  2E1M C;  2LLK A;  1MMG A;  3WU2 C;  4UUV A;  1ETW A;  3ABM H;  4L5J A;  2O5R A;  2E71 A;  1RKT A;  3ERM A;  3SDG A;  3PO3 J;  1WJ5 A;  5LRS A;  4H4K C;  3HOW J;  4D7M A;  3IRR A;  2A69 F;  1LJ9 A;  2EBI A;  2NRA C;  3H1C A;  1T0F A;  3D5R C;  4X1E A;  2EV5 A;  3OV8 A;  3LSR A;  3OYE A;  2QGU A;  1XG1 A;  1TWF J;  4UY8 I;  1V3F A;  1VQ5 I;  2QSF X;  3K1P A;  3BCA A;  3LA3 A;  3Q9V A;  1B9M A;  3I59 B;  3LAJ A;  1YW9 A;  2OD5 A;  5A2Q K;  3J81 K;  1EH8 A;  2NVQ J;  2HQR A;  2WY7 Q;  3G1L A;  1TWA J;  3HUG B;  3L00 A;  3H9Q A;  1SAX A;  4BE2 A;  2IRF G;  1W1W E;  3TW7 A;  3HOZ J;  1IN8 A;  4V2G A;  5FKK A;  1UAA A;  3AL0 B;  4RB3 C;  4KMF A;  1E0E A;  1IGN A;  1ZLJ A;  5CVV A;  4LG0 A;  4CYC B;  3ZMZ A;  4B09 A;  3SEQ A;  3JSO A;  2IS1 A;  2HR3 A;  2VBX A;  1TT0 A;  2DMU A;  4M3G A;  2I5U A;  1U3E M;  4MHG A;  1OIS A;  4J01 A;  2A68 F;  2CSO A;  4G6Q A;  5DCM B;  2FF4 A;  1BI0 A;  4IRH A;  3BC8 A;  3LSH A;  3VOE A;  3D0S A;  1KU2 A;  4IHX A;  1STZ A;  4ZYA A;  3OY9 A;  2H09 A;  1PP8 F;  2EB7 A;  3FF5 A;  1NTC A;  1GHC A;  1QRY A;  1GVD A;  5EGO A;  3TO6 A;  3WTS C;  2KPM A;  2MD5 A;  4KIG A;  3BZ6 A;  4XLA A;  2OPT A;  3IV5 A;  1RRJ A;  2DYR H;  2MFZ A;  2X6O A;  4YFK F;  2QM3 A;  3V4G A;  2EIL H;  1BIA A;  2W7N A;  2M8E A;  1KU3 A;  3PL8 A;  1YI2 I;  1V54 H;  1XB4 A;  5EG0 A;  4B48 A;  3KP2 A;  3CCR I;  1MJ9 A;  3S1M J;  2DA5 A;  3W2A A;  2PG4 A;  2ZXW H;  4BBR J;  2NVX J;  4PZJ A;  5E3L A;  2CV2 A;  2LVS A;  3BCB A;  3VEP A;  2V6E A;  1ZHF A;  5TIS C;  1SAU A;  4BJ6 C;  2X6W A;  2VKH A;  4E70 A;  4E7L A;  3VWB A;  2MW8 A;  4NQW B;  2B63 J;  4EGY A;  3JCU C;  1TNT A;  1HKS A;  2R5Y B;  2MH9 A;  2WB1 A;  1LE8 B;  1W5T A;  3HC7 A;  3ONQ A;  2ZXI A;  4N9I A;  4PJL A;  1TP4 A;  4L0Z B;  2OCC H;  4LIT A;  2K5C A;  4XRM A;  5EF6 A;  4Y7N J;  4HG2 A;  4ZYD A;  2Q2E A;  3GW2 A;  3SDB A;  4BHB A;  2VI6 A;  1T95 A;  4I02 A;  2R7X A;  3MVP A;  2ELJ A;  1YJ9 I;  3H3Z A;  5HS7 A;  3CCJ I;  2ADU A;  5EEG A;  2GIZ A;  5CKT A;  2A6H F;  3ULQ B;  3TED A;  3MKZ A;  4L9V A;  4CCL A;  2FXA A;  4IHV A;  2VOD A;  1H0M A;  1TW3 A;  3PUB A;  4A6D A;  1ULY A;  4WXH A;  5F1J A;  1R49 A;  2R7S A;  1OCC H;  5B1B H;  1G4D A;  4ENK A;  3VOD A;  2H27 A;  5EZH A;  1ON2 A;  3GLX A;  4RAY A;  2EFO A;  4EMS A;  2WA0 A;  2IA1 A;  2EV0 A;  1FBS A;  3BG3 A;  2OCE A;  2Q0O A;  2MLG A;  3BTL A;  2M34 A;  4Q47 A;  3ASN H;  2H1L A;  3KCC A;  5D8L B;  3QAH A;  1ZK8 A;  4G9Y A;  3WE3 A;  4A93 J;  2M3A A;  3CC7 I;  2E60 A;  4RA2 A;  2HKO A;  3BRO A;  4XLN F;  1HBX G;  5FGM A;  1ACI A;  4M71 A;  2XHK A;  2XIG A;  1BN5 A;  4GDF A;  2PMZ N;  2IGN A;  5HLH A;  4LB5 A;  5GAG J;  5GAD J;  5D5U B;  2A5Y B;  5KHD A;  5KVR A;  1EH7 A;  2DAO A;  3L2C A;  4BXF A;  1T33 A;  2K85 A;  2UV1 A;  4B8X A;  4XRS G;  1DGR M;  4LG0 B;  3A03 A;  4M3D A;  1XMX A;  5HDN A;  3WHC A;  1EKE A;  2HTJ A;  1SD6 A;  4EGZ A;  3S15 J;  4L9N A;  1FOK A;  3OYD A;  2ISZ A;  2BXY A;  4BQN A;  2XB5 A;  1MGT A;  2CQK A;  2VKD A;  3NAU A;  1O3S A;  1KYW A;  4IHT A;  4N0B A;  4DYQ A;  3KYL A;  2L02 A;  3I3L A;  4HDV A;  1K7A A;  3VSK A;  1SD7 A;  4C9Y A;  4D5F A;  2VKV A;  4IOC F;  1ETO A;  3CME I;  2D1V A;  3D5S C;  2D5V A;  5L3B A;  1A6Q A;  2CW7 A;  5BOX A;  5A2Q Z;  1X4O A;  3KIO A;  3J81 Z;  2LP0 A;  1Y39 A;  3WTX C;  1TQM A;  4PK4 A;  3K4K A;  1E3H A;  4ZYH A;  3LMM A;  2NVT J;  1A31 A;  1SMT A;  1IXR C;  2G7H A;  5GPA A;  3SHF A;  5EG0 B;  3OYM A;  4FE7 A;  5FD6 A;  4Z6Y A;  1KU9 A;  1ON1 A;  1VTN C;  3GTO J;  2WV1 A;  1HST A;  1TLH B;  2JN6 A;  3E6M A;  4XOT A;  3G6E I;  2O7O A;  3RTR A;  2FMY A;  4BU2 A;  3M8E A;  3KP5 A;  5D4S A;  1VI0 A;  4O5V A;  3OR1 C;  2XAS A;  3ZQ7 A;  2ELH A;  2DA2 A;  3I4M J;  3ELK A;  1T2K A;  2P6T A;  2E1N A;  2DDB A;  1T56 A;  2RV8 A;  4AM3 A;  5ICF A;  3FM5 A;  5EYR A;  2M45 A;  4EAT A;  4MIM A;  2FQ4 A;  4HA8 A;  3GTJ J;  2O3F A;  4BY1 J;  2DU9 A;  2X6Y A;  2HVS A;  3GVA A;  4LJZ F;  1QGP A;  3CCQ I;  1BBY A;  2K40 A;  3FIS A;  4EJW A;  4UUT A;  5AON A;  3OYH A;  2O61 A;  1UG0 A;  3MKY B;  1HDD C;  3E6B A;  3JRH A;  4RM3 A;  3CJR B;  3PQK A;  2EQR A;  4X6A J;  3H92 A;  2TRT A;  4P9F A;  3K4C A;  4JX6 A;  3GME A;  1TWG J;  2VAS A;  2WBM A;  3BTI A;  1VFC A;  1OLT A;  3QOE A;  3RPU D;  1S7A A;  4B47 A;  4RLF A;  3L9F A;  3K10 A;  1ERD A;  4MFD A;  2IEK A;  2HTS A;  3ABT A;  2KRH A;  1YIO A;  4I98 B;  3BG5 A;  1RKW A;  2LDU A;  2YX4 A;  1Y1V J;  4IO9 F;  1JUS A;  4BNC A;  4C3I J;  1IXC A;  4LOC A;  4GCV A;  2IA0 A;  3F8C A;  2FQ3 A;  3E3V A;  2WTE A;  2X9D A;  1GXP A;  1U5T C;  3OIQ A;  1JHF A;  1PUF A;  1H88 C;  4KYW A;  5FJ8 J;  3KP4 A;  1OR7 A;  3QPS A;  5FKM A;  3KET A;  5EDN A;  4G12 A;  3E1S A;  1VQM I;  2B0L A;  1KU7 A;  3TP0 A;  2Z16 A;  2AQF A;  5LRR A;  3DKW A;  3F21 A;  5CJ9 A;  2JMW A;  4KA4 A;  1ZTR A;  4NB5 A;  1MDM A;  3JSP A;  5AIQ A;  4MEY F;  1WKM A;  2R0Q C;  1O57 A;  5DM7 F;  1KYZ A;  2FBK A;  2GBY A;  2L2O A;  2DMQ A;  2JPB A;  1XX5 A;  3T1B A;  2R7O A;  1Q1V A;  3X2Q H;  2PJP A;  4D5C A;  4R1H A;  4JQF A;  1YTY A;  3TL4 X;  3ZXS A;  2XGD A;  3B73 A;  3HGY A;  2DA6 A;  2EA2 A;  2ZC2 A;  1BR2 A;  1OCO H;  1IRZ A;  3NWS A;  5ILV A;  5BS6 A;  3GWZ A;  2DMP A;  2H6B A;  2JT1 A;  4KIF A;  4C2U A;  3R4K A;  3BR0 A;  5F1R A;  4Q48 A;  2GOX B;  1W4M A;  5EEH A;  3OOU A;  1HW1 A;  3R0A A;  4M9S A;  5LEJ A;  1T98 A;  2YU3 A;  2MLK A;  2VXD A;  1TW2 A;  3CDI A;  4FHT A;  1MIJ A;  3BZK A;  1R7J A;  2H1K A;  5H6Q A;  1MZB A;  3A0B C;  3MFK A;  2PN6 A;  3RJP A;  2DOA A;  2L9S A;  2M0C A;  4A5M A;  4YII A;  2P4W A;  3RKY A;  1FC3 A;  3I4P A;  3HRM A;  4YG2 F;  1ZRE A;  2K9L A;  1JTX A;  2B9S A;  2HOA A;  3LSM A;  2VBZ A;  1XGO A;  2OZ6 A;  4AIJ A;  3A02 A;  1TNS A;  2E19 A;  2MH2 A;  2P7C B;  1IC8 A;  3TW6 A;  3F8F A;  1R5G A;  3K4N A;  2ZFW A;  4CYD A;  3ZP5 A;  5LHG A;  2L7F P;  2L01 A;  3U21 A;  1QNT A;  3KEY A;  2LK2 A;  2E5Z A;  1F1Z A;  1X3W B;  1QHH D;  2CWE A;  2OTL I;  1QZZ A;  4LMY A;  3HOX J;  5CVU A;  3FMQ A;  2BY2 A;  2F4O B;  4BXX J;  3NWT A;  1YO5 C;  2KDZ A;  2JSC A;  4HV5 A;  2KIU A;  5D6F A;  3CUQ A;  4FQG A;  4XK4 A;  3K7A J;  2XDV A;  1K6Y A;  1ITY A;  2ECB A;  1G8X A;  3FXR A;  2RGV A;  4PJJ A;  1YIT I;  1U0J A;  3TKY A;  1XSD A;  5GTH C;  4NHJ A;  3OYK A;  2RN7 A;  5D6E A;  3PFY A;  2DYS H;  4U87 A;  4LK1 F;  1T08 B;  3BJA A;  5E8I A;  2Y30 A;  4U7B A;  3FXQ A;  5H20 A;  5LFA A;  5IOZ A;  3QPH A;  2W25 A;  4RAG A;  4RB1 A;  2EK5 A;  1MSE C;  2GM4 A;  4IHS A;  3H35 A;  4CCJ A;  5IYC J;  3IC7 A;  4E6K G;  1HW2 A;  1OCZ H;  2GWR A;  1MBF A;  1XGM A;  2J5P A;  2BYV E;  2KDO A;  2LG4 A;  4CIC A;  5LGN A;  4ASN A;  5IYB J;  1O7L A;  1SFK A;  2QKM B;  2R7D A;  1H89 C;  2MC4 A;  2OBP A;  2W00 A;  2XRN A;  4RGS A;  5HNH A;  2DMN A;  1YFH A;  2OJE D;  2D45 A;  4MEX F;  4XIC A;  1E2X A;  1FLI A;  1QZY A;  1SVL A;  5CQE A;  5FKO A;  3RQ4 A;  2XAG A;  4LIV A;  2V1U A;  1VQ9 I;  2QBY A;  1C0W A;  4G6D A;  3HPH A;  2HOS A;  1PUF B;  2F5V A;  5BQT A;  1W36 C;  2MYS A;  1R1T A;  2BXZ A;  4ESF A;  1H9G A;  2ZME C;  4HLY A;  2ZJR F;  1Z6R A;  4EQQ A;  1WPK A;  3C1D A;  3W2V A;  5FB2 A;  2PI0 A;  3M8J A;  3DPT A;  2XF5 A;  5IP6 A;  3F22 A;  4A3E J;  3E97 A;  4UUS B;  1JT6 A;  4QIW N;  3DEW A;  2EIN H;  2KQR A;  3CCV I;  5IT9 K;  2RQQ A;  5BPI A;  1HLV A;  2IVM A;  1JHH A;  4A5N A;  1K61 A;  1UHS A;  1NK3 P;  2NAZ A;  4HLX A;  1Z05 A;  2BOL A;  2KT0 A;  2EIM H;  4RGX A;  3ZRG A;  2ZNY A;  1BC8 C;  3I59 A;  3OYG A;  1XD7 A;  1DGW Y;  2QYO A;  3F6O A;  2XGX A;  2HPI A;  4DOZ A;  4ZZL A;  1X19 A;  2HYJ A;  2X1E A;  1EA3 A;  3WHB A;  1IN6 A;  1Z9C A;  3KEQ A;  4IQJ A;  3ZOB A;  2BV6 A;  2IXS A;  1TWH J;  3U2R A;  2AO9 A;  3AKZ A;  1NH3 A;  1K78 A;  3CC4 I;  5IYD J;  3S1R J;  2ZJQ F;  4OIP F;  1HSJ A;  3C18 A;  2G9W A;  2M0M A;  3FXK A;  1JE8 A;  1X58 A;  2ECC A;  3EUA A;  2Y0S A;  4ZYG A;  3OL4 A;  4KT5 C;  2CV1 A;  3KX2 A;  4GFB A;  4PUS A;  1X2N A;  5DUI A;  2NS8 A;  3GTG J;  2JJ7 A;  4D1Q A;  3C7J A;  3HB9 A;  4M74 A;  4KNY A;  2CH0 A;  1IV6 A;  2FUG 2;  1FIP A;  1FYM A;  3EDP A;  3J7Z I;  3G4S I;  3LA7 A;  3GZ5 A;  1FP1 D;  1DDN A;  2E1M B;  3OYL A;  5HLI A;  3CUQ B;  4XOP A;  2HFH A;  4EJO A;  1XCB A;  1FMW A;  1G3Y A;  2HVQ A;  3QPL A;  5DUK A;  3CC2 I;  3K69 A;  2KJC A;  5E1X A;  4UNO A;  2EV6 A;  2Z99 A;  3VYS B;  2ZO4 A;  1YX5 A;  5J8F A;  2ID6 A;  4CUG A;  1I3A A;  3UKG A;  2QLZ A;  2JUC A;  3IRQ A;  4D0P A;  2A6T A;  4PFP A;  4HRI A;  4KMU X;  4CSW A;  3WOD F;  3HOT A;  2GXB A;  2IS4 A;  4Y3O A;  1IN5 A;  1MNE A;  2VPL A;  2HKX A;  2KHM A;  2ACJ A;  3LOC A;  4ZYE A;  1IJW C;  5LBQ A;  1ZG5 A;  3BZC A;  2JTV A;  3OMY A;  2XSD C;  2L4M A;  2XPU A;  2HOT A;  2MC3 A;  1LDK B;  2LY1 A;  2Y0M A;  2MD0 A;  4AIK A;  2GXG A;  2NS0 A;  1HKT A;  4CXF A;  2R7Z J;  2OTJ I;  2CQX A;  4MO7 A;  2QBY B;  1RZ4 A;  3PFI A;  1U9O A;  2BW3 A;  4E7J A;  1HW5 A;  4ZC3 A;  3MZY A;  3V8K A;  4WX9 A;  1OPC A;  2BEO A;  4OIO F;  3VDX A;  1S6L A;  2YR2 A;  2RKH A;  3R60 A;  3OS0 A;  3J7A O;  1FYL A;  4IVN A;  2W1O A;  3CP8 A;  4BL0 B;  1P4A A;  5HS9 A;  2BBY A;  3KEO A;  3GTQ J;  2CFX A;  2KKO A;  3ZMD A;  4S05 A;  1TQI A;  1YJN I;  2E2I J;  2L7M P;  4YEL A;  3CDH A;  3PUF A;  1MD0 A;  2X48 A;  5IPA A;  3IWZ A;  3K2A A;  1TZL A;  1YX3 A;  2LF8 A;  3S14 J;  1Y0U A;  1QHG A;  1YQA A;  2E1C A;  2XPW A;  5DV5 A;  1ETY A;  1WJE A;  2VJ4 A;  2VC0 A;  4L18 B;  3R61 A;  1UMQ A;  1MBH A;  4FIS A;  2NVY J;  4A3F J;  1LFU P;  2O8X A;  1LFP A;  1WJB A;  1D1B A;  4AVP A;  3PIP F;  1WI3 A;  3I9V 2;  2I10 A;  3F6V A;  5ILS A;  4F7Z A;  3PO2 J;  2VPR A;  5EZG A;  3W6J B;  5D5V B;  4E7H A;  5J47 A;  3ML6 A;  3P9K A;  2JSP A;  2ESH A;  3KYD B;  5CVJ A;  3K4M A;  3FHN A;  4II3 A;  3HDD A;  4HPQ A;  4WF2 A;  2L7Z A;  1K78 B;  2WAQ A;  4FET A;  2HS5 A;  3PQJ A;  2CS3 A;  3K6G A;  3JRD A;  5CPR B;  1QA6 A;  1V4R A;  1SFX A;  1D3Y A;  2QSH X;  5DS9 A;  2E7W A;  2BY3 A;  3RPU A;  2VKE A;  4AUX A;  1D5Y A;  3H3V K;  4JK1 X;  2DK5 A;  3L2V A;  3GUD A;  4A2U A;  3P5J A;  3HM5 A;  4HX7 A;  4II2 A;  1BI1 A;  3CF5 F;  3JR9 A;  3WGI A;  4E7S A;  1TQP A;  1Y56 A;  4ANJ A;  4ITV A;  4NUB A;  2OZU A;  3ZPL A;  2K9M A;  2FNP A;  3TO7 A;  2W48 A;  3V7S A;  4HX4 A;  3OYJ A;  2DI3 A;  2R7Q A;  5TRD A;  3BP8 A;  1XC5 A;  4EV0 A;  5HLG A;  1I6X A;  4XR6 A;  4G8X A;  3HGG A;  1R9T J;  4QPO A;  5CQG A;  1E3O C;  3JTG A;  3HOU J;  4NC6 A;  3CCM I;  1UZC A;  3GFI A;  3RDI A;  3TOA A;  1GXQ A;  2OQG A;  2FNA A;  5JLW A;  1XMK A;  2DTZ A;  4EVI A;  4XBF A;  2DDA A;  2VL8 A;  3ZQC A;  3FXM A;  2UXX A;  4HNV A;  1FEX A;  5F0C A;  1FJL A;  3SZP A;  2BVM A;  3K70 C;  2O8K A;  1IXS B;  4K2E A;  3T0Y A;  1V55 H;  2V6C A;  4XLP F;  2K9S A;  4IKF A;  2X85 A;  4IJA A;  2LY9 A;  2YS9 A;  4GYI A;  1IRG A;  4L0Y B;  1DP3 A;  3CZ6 A;  4IOA F;  2VXZ A;  2E2J J;  4C2T A;  2M1B A;  2JQ7 A;  3N05 A;  4AYB N;  3OS2 A;  3C3W A;  3EET A;  3QU6 A;  1P7I A;  2DJI A;  2YUS A;  3LAP A;  2AXT C;  4ETS A;  2LYC A;  1V5F A;  3FKI J;  2BW3 B;  1WGX A;  4C3J J;  5K5R A;  2X1C A;  2DT6 A;  2V1N A;  3HHH A;  1WSU A;  3K70 D;  1X1B A;  1TL8 A;  4U0V A;  2KRF A;  3AL0 C;  2HGC A;  4P5O A;  4IXA A;  1ZN2 A;  3G3Z A;  2H6C A;  6PAX A;  3EPZ A;  4DBQ A;  4ZH4 F;  4I99 C;  1JKO C;  4Y52 J;  1QO0 D;  2LNB A;  2MBF A;  3KZI C;  3BT9 A;  3HKZ N;  1O3T A;  4XKB A;  4G7O F;  3F23 A;  5JVG F;  3NQO A;  1G2H A;  2HQN A;  2Y75 A;  3DV8 A;  4UB6 C;  4BBS J;  4D9J A;  1ZGA A;  2FA5 A;  4EEF G;  4HNU A;  4ENN A;  4M9Z A;  3HZJ A;  3KE2 A;  1UHW A;  3W6K B;  2M87 A;  3HBL A;  5HDK A;  3E0J B;  4PJM A;  1YOV B;  3VYR B;  1SC7 A;  3S2H J;  1VQK I;  4PJ0 C;  3JRA A;  2M7A A;  1OCT C;  3WTV C;  1GLN A;  1KA8 A;  5K5Q A;  1XCV A;  3H5A A;  2JUG A;  1BOA A;  5GP9 A;  3RYR A;  3EUH C;  3G71 I;  1MMD A;  2B7E A;  3LSG A;  2K02 A;  4F92 B;  3MZH A;  4XM3 A;  3N4M A;  4HAM A;  3BR6 A;  4LLG F;  5HNF A;  3FIW A;  3IAS 2;  2LH9 A;  2TCT A;  2NVU B;  5K5O A;  2A05 A;  1RET A;  3H5R A;  2M2E A;  1J5Y A;  3DKX A;  3Q3S A;  3DWL E;  5LHI A;  1UG2 A;  4BUP A;  3GO5 A;  2LRD A;  3RZO J;  3NRV A;  4P1W A;  4G7Z F;  1XN7 A;  3GBG A;  2Z1D A;  4HST A;  4HW0 A;  4B3A A;  4ZTF A;  1B9N A;  4Y33 A;  3CCL I;  4ZDP A;  2PBI A;  4TV7 A;  4IL6 C;  4L5I A;  5JHU A;  2QQ9 A;  3FXO A;  3HTS B;  4BAC A;  3GFJ A;  2BHY A;  2FOK A;  1WHU A;  4ZZD A;  3L2U A;  2VQL A;  1YIJ I;  4IHY A;  3JRI A;  1FOW A;  1VQ8 I;  5FFX A;  2ZSH B;  2RNJ A;  2CMP A;  2OC6 A;  4S04 A;  1OKR A;  2F5C A;  2PMZ A;  1FWZ A;  2DN0 A;  2IJL A;  3G2B A;  4DQ2 A;  5GAE J;  1GUU A;  2CQN A;  2ESN A;  3L7W A;  3Q5F A;  2ICW G;  5EEA A;  4EJT A;  4U0Y A;  1S72 I;  1FTT A;  2E36 A;  4PGH A;  3GCM A;  2DXI A;  2PMU A;  2HQA A;  3KPH A;  1ZRC A;  5C4X J;  2L5Q A;  1I6H J;  1IW7 F;  4BKX A;  5FKN A;  1DP7 P;  3LSI A;  3FMR A;  4CGZ A;  1J75 A;  1T0F C;  2LOO A;  4RDU A;  2Z33 A;  4LK0 F;  1IRX A;  1U5T B;  2WAE A;  2L54 A;  1Z77 A;  3QP6 A;  1ENH A;  5HVQ C;  4D7N A;  4RB0 A;  2CW0 F;  4BE0 A;  2CV0 A;  5D8K B;  2XF7 A;  4M73 A;  1KON A;  3CCE I;  1J59 A;  2CW8 A;  1BM9 A;  2Y9Z A;  3HSR A;  2I8D A;  1JJ6 C;  4A0Z A;  3O2P E;  1LKX A;  3RCO A;  4BEH A;  4A3J J;  1AKH B;  2V79 A;  4A3L J;  4OIN F;  3ZQQ A;  2DFH A;  4BJ5 C;  3HHG A;  4UV8 A;  1UEL B;  1Y1W J;  5K7Z A;  1O3R A;  3E5U A;  3F3X A;  3HSF A;  3FKJ A;  5IP9 J;  4XKV A;  4HOB A;  5DM6 F;  5GPC A;  3AFH A;  4WWC A;  2DJN A;  1RPW A;  2R93 J;  2FBI A;  3QYB A;  3TMO A;  2HDW A;  5GTI C;  3ZQF A;  4RB2 C;  4WK8 F;  3ZMU A;  2E5N A;  1ZR4 A;  2PFB A;  5ICC A;  3NAR A;  1USS A;  4GGG A;  1I1G A;  3MCZ A;  2JZY A;  1HXD A;  3COA C;  4IX7 A;  3F8M A;  3DLL F;  2DFE A;  3VB2 A;  5JHF A;  1SEU A;  1HOM A;  2CQ7 A;  3HSE A;  3KP3 A;  4M3B A;  1QQI A;  4A0X A;  2DCE A;  4E7Z A;  2GA1 A;  3KZY A;  3IWF A;  4AVZ A;  3WTT C;  1P4X A;  1HDP A;  3BG7 A;  3SJM A;  4M72 A;  3CCU I;  4UUS A;  1LUJ B;  4XN0 A;  2DA7 A;  2KMU A;  5E18 F;  4ZDO A;  1W5S A;  1YLF A;  2RAE A;  3GF2 A;  3WU1 B;  1LB2 A;  3CLQ A;  2A07 F;  3LA2 A;  3BDD A;  4MQ9 F;  1GVJ A;  5DD8 A;  1ZQ3 P;  3SZG A;  4J19 A;  3OIO A;  3U9G A;  4DYC A;  1J09 A;  3HOV J;  2FRH A;  5IT3 A;  3PSF A;  4A3D J;  2OA4 A;  3IH4 A;  4UV9 A;  1ZKG A;  1J7K A;  2VT2 A;  4HQE A;  3B6A A;  2DK8 A;  3LST A;  2PJR A;  1WWX A;  1HA8 A;  4AIH A;  1BL0 A;  2RDP A;  4DW6 A;  2ETH A;  4MNU A;  4FTH A;  5E3N A;  4V2F A;  1KQ8 A;  3SZT A;  4NNJ A;  1Z7L A;  5C4J J;  2QUF A;  5K1Y A;  4FE4 A;  4UXN A;  3PM1 A;  1J2X A;  4KDP A;  4C30 A;  2A6E F;  3KP7 A;  5DCF A;  2W4S A;  1W0T A;  3S16 J;  1A5J A;  3TGN A;  1MKM A;  5HOD A;  1ZEL A;  3BJO A;  2X6X A;  2IT0 A;  1U6G A;  4N4O B;  1KQ9 A;  2L9N A;  1ZGJ A;  1MH3 A;  2QQA A;  1FSE A;  3DFG A;  5KCM A;  3VYU B;  3I56 I;  9ANT A;  3K0L A;  2OF7 A;  3MZ8 A;  4GRI A;  1QU3 A;  2R7U A;  2NOJ B;  3T8R A;  1TTY A;  4DIQ A;  5JLX A;  1JGG A;  2EWN A;  3GTP J;  2ZME B;  1WH7 A;  2F4I A;  2LD5 A;  3OSG A;  1U78 A;  2AQE A;  2A5W A;  3DP7 A;  4C3H J;  3A01 B;  2DOE A;  3IH3 A;  4IEJ A;  4BEH B;  1B72 B;  5CYV A;  1QBJ A;  1Y8Q B;  2F5D A;  2E2H J;  1Q1H A;  4O3M A;  3H0G J;  1O3Q A;  1PVE A;  3CO6 C;  3M1C A;  2P8T A;  3MKW B;  4AU7 A;  1NK2 P;  2V7F A;  2VN2 A;  2Y2Z A;  2GOM A;  1G6N A;  5BNG A;  4QLC U;  1SAN A;  3O6B B;  4IRI A;  4I0B A;  1GT0 C;  5FLM J;  4S0H B;  1DU6 A;  5B66 C;  2VQC A;  3E5X A;  2NS7 A;  2V1D A;  4RAF A;  3ECH A;  1ZAO A;  4IF4 A;  4PFO A;  1S3J A;  2P5L C;  1VQL I;  2L7K A;  1ZGW A;  3V8L A;  1E17 A;  2A3S A;  2DFF A;  3I58 A;  5L3D A;  2YX7 A;  4A69 C;  2F2E A;  4OOI A;  1X1P A;  3BOQ A;  3IKT A;  4BJT A;  3GTM J;  2QSG X;  2HXO A;  3CUO A;  2M5W A;  2QWW A;  3V7R A;  3W2W A;  4OMZ A;  1R36 A;  4JX5 A;  2K9N A;  3M8F A;  3GFM A;  3IUO A;  4R79 A;  3HEF A;  2ISY A;  3JRE A;  1IAW A;  2G0E A;  3A4C A;  3DBL B;  3CES A;  2K3P A;  1MBK A;  4IPA A;  5JFR A;  1JJ8 C;  5HDG A;  3J80 K;  4OWR B;  1HF0 A;  3WTU C;  1Z21 A;  3ZQL A;  1BIB A;  1BW6 A;  1SD5 A;  2LFB A;  4U0W A;  4BE1 A;  1IG7 A;  3P9C A;  5FFZ A;  4I6Z A;  4BY7 J;  2M8G X;  3P7N A;  1W36 D;  2M9H A;  1OYI A;  3FBI B;  2ZNZ A;  2N8G A;  2YU9 J;  2AXL A;  1FTZ A;  1H8A C;  2PJR B;  1O7F A;  1G3T A;  4XLF A;  1MBG A;  1YE9 A;  1YS6 A;  1JKR C;  5E3M A;  1LNW A;  3R0J A;  3HRT A;  3BQY A;  4O6J A;  2M30 A;  2BE5 F;  4OU0 A;  2FBH A;  2LF7 A;  2XKP A;  1XGS A;  3CCY A;  1FIA A;  1B6A A;  3ISP A;  3V42 A;  1QVU A;  3GTK J;  2FOW A;  1APL C;  4QTR A;  1XTA A;  3I71 A;  3RIR A;  3T5X A;  3DQV C;  1WJD A;  1FBQ A;  2DLL A;  3SEZ A;  2QEN A;  3MD2 A;  2KIS A;  4FT8 A;  4KJZ A;  4KIB A;  4N4N B;  2MG4 A;  2UUZ A;  3LFU A;  5TGT A;  1YG2 A;  1RC9 A;  3F0C A;  4HYE A;  1YRN A;  1D0Z A;  5F0F A;  1F5T A;  3LSJ A;  1Y6I A;  2K4B A;  2VOP A;  3KP6 A;  3Q0W A;  3PSI A;  4XKW A;  3S93 A;  1OCR H;  4EJV A;  4DJA A;  2JA7 J;  2KIM A;  1EF4 A;  1I5Z A;  1XDU A;  2K86 A;  2ZFU A;  2HZT A;  1K83 J;  1PJR A;  1P6R A;  3GEZ A;  5E3O A;  1VZ0 A;  4XRF A;  4BYY A;  1RUO A;  2EZL A;  3GTL J;  1FY7 A;  1OR7 C;  5ED4 A;  4UVA A;  3F8B A;  1FPQ A;  3V7C A;  2XGE A;  3MAJ A;  3CMA I;  5JI6 A;  3FK7 A;  3BTJ A;  3L1P A;  1R00 A;  1MSF C;  2HYF A;  2UWM A;  1YYV A;  3G1O A;  1X1C A;  2DA1 A;  2DA3 A;  3ABL H;  1TBX A;  5J1U A;  1REP C;  2ZB9 A;  1I3Q J;  2HI3 A;  5F04 A;  2WWY A;  4RBO A;  4LLL A;  3CF2 A;  5B1A H;  1D1C A;  1VF9 A;  1ODD A;  2KIF A;  2MA3 A;  4YIR X;  1IZ1 A;  2ZJP F;  5CLS A;  1I1S A;  2K3F A;  3MWM A;  3FHZ A;  3Q0V A;  2CUF A;  4HDU A;  3E7L A;  5CVI A;  4BDZ A;  1YS7 A;  5FLX K;  4QPQ A;  3WTZ A;  3FK6 A;  2C6Y A;  3LWF A;  3CCS I;  1ZG1 A;  3BR2 A;  3WE2 A;  1UCR A;  2KIQ A;  4RGU A;  4KIT B;  5IP7 J;  1B59 A;  2K27 A;  2V9K A;  1ZH5 A;  2PLY A;  4ZDL A;  2F48 A;  3M07 A;  1IUF A;  2HEO A;  3I55 I;  4YFN F;  1MJA A;  1OCP A;  4BXU A;  3S2W A;  3FMS A;  1J9I A;  3T8T A;  3F8N A;  4OIQ F;  2JA6 J;  2JRM A;  3IH2 A;  3FXU A;  4C2M J;  2EFW A;  2ZXH A;  1NHA A;  3WTW C;  5L3G A;  2DQL A;  2VQG A;  1W5C C;  3D1N I;  3OIP A;  3MEX A;  2XPV A;  3J7A Y;  4XN3 A;  3EYY A;  2H94 A;  3BQZ A;  1AOY A;  2KRC A;  2HZD A;  1HCR A;  4KFC A;  3CLO A;  5K7H A;  4RMN A;  4RS8 A;  4IHW A;  4RGR A;  1HC8 A;  3MMY B;  3WU0 A;  2P81 A;  5ILU A;  3ABU A;  1ZLK A;  1HQC A;  4FX0 A;  4XSZ F;  3IAM 2;  3DTK A;  4FX4 A;  2XRO A;  4CCM A;  3TO9 A;  3CUQ C;  3K9T A;  1WCM J;  2BY0 A;  2QF7 A;  4RM2 A;  1ETK A;  4PGG A;  5J40 A;  2VIX A;  4PSW A;  4NDL A;  2ZCW A;  3DPL C;  4CCO A;  4DGW B;  1F9N A;  2K4J A;  5B5E C;  2VLA A;  3DEE A;  3ERE D;  1A6I A;  3DBH B;  1IRF A;  1X1A A;  5FRN A;  3ZCO A;  4V19 K;  1WVR A;  2HNH A;  4KUM A;  1MMA A;  3BR3 A;  2P5V A;  3JAM K;  4F3Q A;  2NYX A;  1PDN C;  5L3C A;  1T6S A;  3J80 Z;  2GAU A;  3ZMT A;  1MBE A;  1VQN I;  2ME6 A;  2P5K A;  2VC1 A;  3K2Z A;  3AAF A;  4HF0 A;  3OOP A;  5C44 J;  2CG4 A;  1DPR A;  3DLA A;  4X0G A;  5IT9 Z;  2JWT A;  3RPQ A;  1B4A A;  3BR1 A;  4DZJ A;  1A04 A;  3LNQ A;  2XUB A;  2CJJ A;  3RKX A;  4GXO A;  3RSN A;  1YRN B;  4AWX B;  2CUE A;  1WRJ A;  3FZV A;  2IPQ X;  2FSW A;  1D8K A;  1D1A A;  3HG9 A;  3QU3 A;  3JRG A;  3OYA A;  3DPU A;  1X4P A;  2EFN A;  4ESB A;  1IF1 A;  1M1E B;  3KLN A;  4UVC A;  1RR7 A;  2ID3 A;  2YPR A;  1E3P A;  3RI4 A;  2OU2 A;  2WV0 A;  2V1X A;  3DU6 A;  4HQM A;  2CFO A;  3BPV A;  4N9H A;  4KIC A;  1TC3 C;  4HSR A;  5J4V A;  1V5G A;  3ZQI A;  5DEQ A;  4ABZ A;  1G3S A;  3LQR A;  1ONV A;  3RKW A;  1EJ9 A;  1XSV A;  2WB1 N;  1GV2 A; 
#chains in the Genus database with same CATH homology
 4I76 A;  1JTX A;  2HOA A;  3S1N J;  1AHD P;  5C4X J;  4A3M J;  4FCY A;  4AC0 A;  3A02 A;  4M3E A;  3SFI A;  1DU0 A;  5K7F A;  5IOY A;  1I6H J;  4BKX A;  5FKN A;  2E19 A;  5M3M J;  1IC8 A;  2HDD A;  3TW6 A;  4RDU A;  1JKQ C;  2L7F P;  2R92 J;  2CU7 A;  1Z77 A;  3M3Y J;  1ENH A;  2LK2 A;  2L9R A;  1BW5 A;  4D7N A;  2FX0 A;  3HOX J;  2GLO A;  4MFE A;  4BXX J;  2KDZ A;  2CRG A;  3W6V A;  3I4N J;  2Y9Z A;  1ETQ A;  4XK4 A;  3K7A J;  1JJ6 C;  1ITY A;  2ECB A;  4A3J J;  1AKH B;  1BJZ A;  1JUM A;  4A3L J;  2HQ5 A;  5J1Y A;  1AKH A;  2Y30 A;  5IOZ A;  2E1O A;  3CMY A;  2GM4 A;  1MSE C;  1Y1W J;  3HOY J;  5K7Z A;  5M5Y J;  5IYC J;  1JUP A;  3LSP A;  2MGQ A;  5IP9 J;  1MBF A;  4JX4 A;  1OJL A;  5FKL A;  2R5Y A;  5IYB J;  3JRF A;  1LE8 A;  2JA5 J;  1H89 C;  5GPC A;  3O8H A;  4XRS A;  2DMN A;  2DJN A;  2JA8 J;  4XIC A;  1RPW A;  2R93 J;  1GV5 A;  3ZQF A;  5FKO A;  2HXI A;  1ZR4 A;  3NAR A;  1IDY A;  3C2B A;  3G1M A;  2HOS A;  1PUF B;  1MNM C;  5F08 A;  2IAI A;  2WAQ N;  1HOM A;  4M3B A;  2LLK A;  1ETV A;  1WPK A;  1ETW A;  5IP6 A;  1RKT A;  3SDG A;  4A3E J;  4UUS B;  3PO3 J;  1JT6 A;  4QIW N;  3HOW J;  3DEW A;  1HDP A;  1JT0 A;  3SJM A;  4D7M A;  4UUS A;  1HLV A;  2EBI A;  2DA7 A;  1K61 A;  1UHS A;  2RAE A;  4X1E A;  3LSR A;  1XG1 A;  1LFB A;  1TWF J;  1NK3 P;  1TWC J;  1ZQ3 P;  1MH4 A;  4J19 A;  3OIO A;  4DYC A;  3HOV J;  2ME0 A;  2KT0 A;  4A3D J;  3IH4 A;  2NVQ J;  1ZKG A;  3G1L A;  3B6A A;  1TWA J;  1VND A;  3TW7 A;  4A3G J;  1O4X A;  2NOG A;  1BL0 A;  4DW6 A;  3HOZ J;  2HYJ A;  3O8G A;  4FTH A;  3WHB A;  5E3N A;  4V2F A;  4V2G A;  5FKK A;  3ZOB A;  5C4J J;  1IGN A;  1TWH J;  4FE4 A;  3PM1 A;  4CYC B;  3B6C A;  2AO9 A;  5IYD J;  2K9Q A;  3S1R J;  2DMU A;  4M3G A;  1WH5 A;  1POG A;  1X58 A;  4A3I J;  1W0T A;  3S16 J;  1A5J A;  2ECC A;  5HOD A;  1S7E A;  3BG9 A;  4GFB A;  4IHX A;  1X2N A;  5J1R A;  5EGO B;  2NS8 A;  1MH3 A;  3GTG J;  2JJ7 A;  9ANT A;  2OF7 A;  1NTC A;  2AHQ A;  2LTP A;  3HB9 A;  1QRY A;  1GVD A;  5EGO A;  1IV6 A;  1FIP A;  2JK3 A;  5J3L A;  1B8I A;  1X2M A;  2XGC A;  5JLX A;  1Z0X A;  1JGG A;  2OPT A;  3IV5 A;  2X6O A;  3GTP J;  3OSF A;  1WH7 A;  3ZQG A;  2LD5 A;  3OSG A;  1U78 A;  4C3H J;  3A01 B;  5EG0 A;  3QPL A;  2FD5 A;  1SFO J;  3BR5 A;  3IH3 A;  4IEJ A;  1B72 B;  1QPI A;  3S1M J;  2DA5 A;  2Y9Y A;  3A01 A;  3JRC A;  2E2H J;  1OFC X;  3H0G J;  2ID6 A;  1B72 A;  4BBR J;  2NVX J;  5F27 A;  5E3L A;  2LVS A;  2CQQ A;  3UKG A;  1NK2 P;  2Y2Z A;  5BNG A;  1SAN A;  1JTY A;  2MW8 A;  3ZQH A;  1GT0 C;  5M5X J;  5FLM J;  2B63 J;  1CQT A;  4S0H B;  1DU6 A;  4M3F A;  2NS7 A;  3LOC A;  1IJW C;  2R5Y B;  2H8R A;  1LE8 B;  2XSD C;  1ZGW A;  2XPU A;  2L0K A;  1W0U A;  2HOT A;  4XRM A;  5EF6 A;  4Y7N J;  4A69 C;  2VI6 A;  2R7Z J;  2CQX A;  4A3B J;  3MVP A;  3BTC A;  1F43 A;  4MO7 A;  1ETX A;  4XID A;  2R5Z A;  3GTM J;  1U9O A;  2HXO A;  1U8B A;  3TED A;  3VPR A;  4IHV A;  3Q0U A;  2VUM J;  4JX5 A;  2K9N A;  4DYR A;  5F1J A;  3HEF A;  1I50 J;  3JRE A;  5EZH A;  5M3F J;  2G0E A;  5DTD A;  3GTQ J;  2E2I J;  2L7M P;  1ZR2 A;  1MBK A;  1JJ8 C;  2X48 A;  5IPA A;  1HF0 A;  3BG3 A;  3K2A A;  2QCO A;  3S14 J;  3BTL A;  3ZQL A;  2M34 A;  3JRB A;  2XPW A;  1BW6 A;  1IG7 A;  2LFB A;  1ETY A;  1ZK8 A;  2DMT A;  4A93 J;  4I6Z A;  1MBJ A;  4BY7 J;  1UMQ A;  1MBH A;  1ORK A;  2M8G X;  4FIS A;  2NVY J;  1IDZ A;  4A3F J;  1LFU P;  2M9H A;  3RZD J;  1WI3 A;  2N8G A;  2PMZ N;  2YU9 J;  1FTZ A;  1H8A C;  2I10 A;  1MBG A;  3PO2 J;  2VPR A;  5EZG A;  2XB0 X;  1JKR C;  5E3M A;  1T33 A;  4XRS G;  3BQY A;  3RKQ A;  2EH3 A;  1AU7 A;  3HDD A;  3A03 A;  4M3D A;  3CCY A;  1FIA A;  3DCF A;  2L7Z A;  1QVU A;  3WHC A;  3JRD A;  2LKX A;  3GTK J;  1APL C;  4QTR A;  3S15 J;  4B4C A;  5DS9 A;  2EZH A;  4AUX A;  1D5Y A;  2VKE A;  2XB5 A;  4JP0 A;  3NAU A;  3H3V K;  4DYQ A;  2EZK A;  2MG4 A;  3HM5 A;  4D5F A;  2VKV A;  3JR9 A;  1ETO A;  3F0C A;  1YRN A;  5F0F A;  3LSJ A;  2D5V A;  3M4O J;  3Q0W A;  1B8I B;  2JA7 J;  2LP0 A;  1EF4 A;  1K83 J;  5E3O A;  2W48 A;  1JKP C;  2EZL A;  2NVT J;  3GTL J;  1XC5 A;  5EG0 B;  5GPA A;  2Y31 A;  5F0H A;  3HGG A;  4FE7 A;  1R9T J;  2XGE A;  1E3O C;  3HOU J;  3FK7 A;  3BTJ A;  3GTO J;  2WV1 A;  5JLW A;  2DTZ A;  3L1P A;  2JN6 A;  3ZQC A;  1MSF C;  2O7O A;  2FJ1 A;  4HNV A;  1FEX A;  1VI0 A;  2DA1 A;  3G1O A;  2DA3 A;  5F0C A;  5J1U A;  2IBD A;  1FJL A;  2DA2 A;  2MSY A;  2ZB9 A;  3I4M J;  1I3Q J;  2HI3 A;  5F04 A;  2O8K A;  4RBO A;  1T56 A;  2K9S A;  1VF9 A;  5EYR A;  2LY9 A;  2YS9 A;  3RQI A;  4MIM A;  2FQ4 A;  3Q0V A;  3GTJ J;  2CUF A;  4L5E A;  2E2J J;  4BY1 J;  3E7L A;  4AYB N;  1P7I A;  2K40 A;  2YUS A;  2R5Z B;  3S17 J;  3FK6 A;  3FIS A;  4UUT A;  3FKI J;  1WGX A;  4W97 A;  4C3J J;  3BR2 A;  4QSH A;  5IP7 J;  1HDD C;  2EZI A;  3JRH A;  4X6A J;  2EQR A;  3MKL A;  2TRT A;  3MN2 A;  4JX6 A;  5C3E J;  1IUF A;  1TWG J;  1OCP A;  3BTI A;  1VFC A;  4A3C J;  2COB A;  1JKO C;  2JA6 J;  4Y52 J;  3IH2 A;  1BA5 A;  3BT9 A;  3HKZ N;  4C2M J;  2ELK A;  4MFD A;  4W1U A;  2IEK A;  1P7J A;  2LR8 A;  1G2H A;  4BBS J;  4EEF G;  4JYK A;  3D1N I;  3BG5 A;  1RKW A;  2XPV A;  3HBL A;  3CQZ J;  3BQZ A;  1Y1V J;  1JUS A;  1HCR A;  3S2H J;  4C3I J;  5K7H A;  3JRA A;  1OCT C;  4LOC A;  4MLO A;  4IHW A;  4M6V A;  2X9D A;  5GP9 A;  2P81 A;  1PUF A;  1H88 C;  3LSG A;  5FJ8 J;  3QPS A;  5FKM A;  3TP3 A;  3BR6 A;  1WCM J;  2QF7 A;  3FIW A;  5EDN A;  2TCT A;  1ETK A;  4G12 A;  1GDT A;  1RET A;  4NDL A;  3TP0 A;  2M2E A;  3Q3S A;  2JMW A;  3CDL A;  1ZTR A;  4A3K J;  1A6I A;  1UG2 A;  4B1R A;  2Y0S N;  3RZO J;  3BR3 A;  2R0Q C;  2XRL A;  2GBY A;  3GBG A;  1MBE A;  2DMQ A;  4B3A A;  2ME6 A;  1F36 A;  1RES A;  1Q1V A;  4D5C A;  5C44 J;  2JWT A;  3BR1 A;  3S2D J;  4DZJ A;  1QVT A;  2XGD A;  3LNQ A;  3QQA A;  2CJJ A;  2DA6 A;  3HGY A;  1YRN B;  1IRZ A;  2CUE A;  5FLV A;  1XS9 A;  2DMP A;  3JRG A;  5M5W J;  4IHY A;  3BR0 A;  3JRI A;  2DA4 A;  1RR7 A;  3OOU A;  2ID3 A;  4DZP A;  2DN0 A;  3S1Q J;  1TC3 C;  1GUU A;  4CYC A;  3ZQI A;  2H1K A;  4ABZ A;  5EEA A;  2M0C A;  1FTT A;  1U9N A;  2O9L A;  2WB1 N;  1GV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...