2DA2A

Solution structure of the second homeobox domain of at-binding transcription factor 1 (atbf1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GSSGSSGRSSRTRFTDYQLRVLQDFFDANAYPKDDEFEQLSNLLNLPTRVIVVWFQNARQKARKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-fetoprotein enhancer binding protein
publication title Solution structure of the second homeobox domain of AT-binding transcription factor 1 (ATBF1)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da2A01
1B72B 2R5ZB 4M3DA 2EZLA 4BXXJ 4S0HB 2NVTJ 1MBFA 1O4XA 3E7LA 1WH7A 5C3EJ 3Q0WA 4A3MJ 3GTJJ 4JYKA 3Q3SA 3ZQIA 2HXIA 1TWGJ 4Y7NJ 2X9DA 2L7FP 5GP9A 2YS9A 3FK6A 5EF6A 1SFOJ 3HGYA 5DTDA 1B8IB 5IP7J 2COBA 4QIWN 1GVDA 2DA1A 4AUXA 4MFDA 1IDZA 4EEFG 4BKXA 3PO3J 5E3NA 1F43A 1ENHA 2R0QC 1E3OC 4V2GA 1TWCJ 1WGXA 3Q0UA 2AO9A 4G12A 2EZHA 3OOUA 1MBEA 2DA4A 2M0CA 1RR7A 3RKQA 1GT0C 1YRNB 1X58A 1NTCA 1X2MA 1IV6A 3FISA 2PMZN 2WV1A 2M8GX 3BQYA 2NVQJ 2WB1N 4A3LJ 1FTZA 1DU0A 2E1OA 2O9LA 4Y52J 1ETWA 1LE8B 1VI0A 2KT0A 5J1RA 2FQ4A 3GTQJ 4M3FA 4V2FA 2XPUA 2CJJA 1ORKA 2AHQA 2K9QA 1XC5A 1MBKA 5IOYA 4AYBN 5K7ZA 3BR1A 5IPAA 4A3JJ 5FLVA 4C3HJ 2ZB9A 1JUMA 4C2MJ 5GPCA 1ZGWA 1FEXA 1Y1VJ 2K40A 5EG0A 3S17J 1ETQA 3M4OJ 1MSEC 5M5WJ 3LNQA 1U9OA 1JGGA 3BR5A 4BY1J 1TWAJ 1JJ6C 3NARA 2JMWA 4IHXA 5DS9A 4ABZA 1HDDC 4NDLA 2LD5A 2FD5A 3SFIA 2HXOA 2RAEA 3S1QJ 1VNDA 3BR2A 4A3DJ 4C3IJ 3TW7A 2K9NA 2L0KA 3WHCA 3O8GA 4QSHA 2XSDC 1WPKA 3IH2A 4A3CJ 3JRHA 1HCRA 1MSFC 2XB5A 4C3JJ 1D5YA 1ETOA 5F0HA 1AHDP 3FKIJ 1EF4A 3A01A 1WH5A 2DMPA 4M3GA 2JA7J 3BR6A 1MNMC 1MBHA 2R5YA 3JRIA 5EGOA 4RBOA 1PUFA 5BNGA 1ZQ3P 3L1PA 2EBIA 4GFBA 4UUSA 1HLVA 4XIDA 2NVYJ 2LP0A 1RETA 3IV5A 2JJ7A 2DMTA 3G1LA 3HKZN 4RDUA 3HDDA 4JP0A 1H89C 1SANA 2LLKA 2ME0A 1MBJA 1UMQA 3RQIA 5K7HA 1GDTA 2HOAA 1JJ8C 2VKEA 4BBSJ 5EEAA 3MKLA 5EDNA 2GLOA 2VUMJ 2XB0X 2OPTA 1B72A 3MN2A 4I6ZA 3GTOJ 2R5ZA 1G2HA 2VPRA 5F1JA 3LSRA 4A3BJ 3MVPA 1IJWC 3TEDA 3DCFA 2XGEA 1JTXA 5EZGA 3JRAA 3BG3A 5M3FJ 2DMUA 1LFBA 3G1MA 3PO2J 3O8HA 4HNVA 4B4CA 3I4MJ 2ID3A 4X1EA 2DN0A 1B8IA 5J1UA 1WI3A 3OIOA 4MLOA 2YUSA 1IRZA 2KDZA 1I50J 1FIAA 4L5EA 4M3BA 2E2HJ 1AKHB 1DU6A 3A03A 4FTHA 3S16J 3BTJA 2LY9A 5FKNA 2TCTA 5J1YA 3B6AA 9ANTA 5IP9J 1ZK8A 1YRNA 2NVXJ 1JT0A 4M6VA 3B6CA 2VI6A 3GTMJ 4MIMA 2N8GA 5M3MJ 2LVSA 1I6HJ 5EZHA 4JX6A 3S1MJ 3K7AJ 3LSGA 1QVUA 1R9TJ 2L7ZA 1NK2P 1POGA 3D1NI 4IHVA 1H8AC 4CYCB 1JTYA 3JRBA 5IYDJ 1ETYA 1BW6A 2B63J 2L9RA 3GTKJ 1BW5A 1ZTRA 1RESA 2MSYA 3GTPJ 2Y30A 3ZQGA 3HOXJ 1BA5A 4LOCA 2P81A 3HB9A 4MO7A 1JUPA 4XICA 1LFUP 3ZQFA 1A5JA 3BR3A 1P7IA 5FKKA 3K2AA 2JA8J 3RZOJ 5GPAA 5JLXA 2LKXA 2R93J 5FKLA 3JRCA 2CRGA 2LR8A 2LK2A 4W97A 2ME6A 3BTLA 5F0CA 1TWHJ 1BL0A 2ECCA 3PM1A 2K9SA 1ZR4A 1AU7A 3BT9A 3JRDA 2HYJA 2JA5J 4A3FJ 5IOZA 3GTGJ 2L7MP 3BG9A 3S1RJ 1FJLA 1RKWA 2QF7A 2DMNA 2XPWA 2E19A 4XRSG 5IP6A 3BTCA 3TP0A 2Y9ZA 1CQTA 2IEKA 5F0FA 3BQZA 2R5YB 2YU9J 1JKRC 2EZKA 3CMYA 3WHBA 1GUUA 1RKTA 1MH4A 4DZPA 1NK3P 1TC3C 2GBYA 3HBLA 3S14J 4BY7J 2CU7A 4FE4A 3IH3A 2JK3A 4DZJA 5JLWA 3BR0A 3UKGA 2FX0A 2HOTA 4A3KJ 2CQXA 3A02A 2NOGA 1IGNA 1ETXA 4A3GJ 2ECBA 2WAQN 1VFCA 2JWTA 1JUSA 2TRTA 4W1UA 4A69C 3JREA 1Y1WJ 4X6AJ 3S2HJ 4FISA 3I4NJ 2XRLA 2XGCA 1APLC 5E3MA 4DYRA 4BBRJ 3H3VK 1X2NA 3JRGA 1QRYA 2W48A 3M3YJ 2DA3A 5FKOA 2NS8A 2EQRA 2Y2ZA 1QPIA 1IC8A 3CDLA 1MBGA 1RPWA 3ZOBA 4B1RA 1QVTA 2D5VA 2HDDA 1Z77A 3S2DJ 2DA2A 1FTTA 1ZR2A 4D7NA 5C4XJ 2XGDA 2OF7A 4A3IJ 3C2BA 1IG7A 2Y9YA 4AC0A 5M5YJ 3HOUJ 4IEJA 1JKPC 2O8KA 5FLMJ 3QPLA 1H88C 3HGGA 4D5CA 2MW8A 3TP3A 4XK4A 2XPVA 3JRFA 5E3LA 1P7JA 1I3QJ 1OFCX 4D7MA 3W6VA 5IYBJ 1XG1A 2JA6J 2CUFA 2O7OA 3CCYA 3Q0VA 1AKHA 3G1OA 5IYCJ 2M34A 2LFBA 5F08A 3LOCA 2Y31A 5C44J 1ITYA 2DJNA 1LE8A 1JKQC 2X6OA 3SDGA 1GV2A 3VPRA 3OSGA 3SJMA 2R7ZJ 2EH3A 1OJLA 5F27A 4DYQA 5FKMA 1GV5A 4UUTA 1F36A 3ZQCA 1IUFA 5EG0B 2GM4A 5M5XJ 4JX4A 3FK7A 1OCPA 2G0EA 3FIWA 3S1NJ 1W0TA 1MH3A 3GTLJ 2ELKA 3NAUA 1U9NA 2CQQA 4J19A 3F0CA 4CYCA 3QQAA 4XRMA 3LSJA 4MFEA 3HEFA 2ID6A 1U8BA 4JX5A 5J3LA 3HOWJ 3DEWA 2X48A 2M9HA 1Q1VA 4A3EJ 1JKOC 2Y0SN 1HOMA 1UG2A 2NS7A 5HODA 1ETVA 1ETKA 4B3AA 2H8RA 5K7FA 1VF9A 1WCMJ 4FCYA 2DA7A 2MGQA 3BG5A 2M2EA 4DW6A 3LSPA 2EZIA 1Z0XA 2E2IJ 1JT6A 5F04A 3CQZJ 3A01B 3HOZJ 5C4JJ 3IH4A 2IAIA 3RZDJ 4IHYA 3QPSA 2IBDA 1K61A 5FJ8J 2CUEA 3GBGA 2FJ1A 2DA5A 2QCOA 3TW6A 5EGOB 3OSFA 1PUFB 2MG4A 2JN6A 4DYCA 1T56A 3JR9A 2R92J 4IHWA 4UUSB 3ZQLA 4D5FA 2HQ5A 5E3OA 2E2JJ 2VKVA 1W0UA 3HOVJ 1UHSA 2DMQA 3S15J 4I76A 4FE7A 2I10A 5EYRA 3ZQHA 1TWFJ 1HDPA 2LTPA 3H0GJ 1K83J 1FIPA 1IDYA 4QTRA 4M3EA 1OCTC 3HM5A 3BTIA 4XRSA 1A6IA 1T33A 2H1KA 2DA6A 3HOYJ 4A93J 1S7EA 2HI3A 1ZKGA 1XS9A 1HF0A 1BJZA 1U78A 2DTZA 2HOSA
chains in the Genus database with same CATH superfamily
2UUZA 1R22A 2EZLA 3E6DA 5E20A 4XL9A 2NVTJ 4AIJA 2HQNA 3ESWB 1MBFA 1O4XA 2L7KA 2V1UA 4A3MJ 1IRXA 4JYKA 3CJTB 1TWGJ 1WKMA 1YLFA 2DQRA 2X9DA 1SFOJ 3K70C 2KRCA 1B8IB 2WAEA 4CXFA 3C1DA 4IQ4A 3ZN0A 2CQ7A 3B02A 4M71A 1YFHA 4OWRB 3V8KA 3Q9VA 4ZJZA 1FMVA 2BY2A 1OLTA 5D5VB 4WX9A 1F43A 2K4JA 2VXZA 3WTVC 3CCEI 3OS2A 5F1RA 2FNPA 1TWCJ 3RPQA 2LF7A 3CCQI 5LEKA 4G12A 4HW0A 2RDPA 4IKFA 3HOTA 1PUEE 2LH9A 2M0CA 1GT0C 3ZRGA 2Q2EB 1YRNB 2AXLA 3OYBA 3DEEA 5L3GA 2M8GX 3BQYA 3SZPA 2WB1N 3OYAA 4EQQA 1FTZA 1T38A 2M45A 2E1OA 4Y52J 1T39A 1LPQA 4CH7A 4N4NB 1ONVA 2F4OB 4M3FA 2XPUA 2AQFA 3W3CA 4ENNA 3D5SC 4HDVA 1MBKA 1V3FA 3PNTA 4UB8C 5IOYA 5K7ZA 5D8KB 2IA2A 4XKCA 2MYSA 4A3JJ 2ZB9A 1JUMA 4M6YA 1HC8A 2V7FA 2E5ZA 2EA2A 3DU5A 1U5TB 3ECOA 1MSEC 1TP4A 3SYTA 1JGGA 4ZH4F 4E7HA 1QBJA 2Y0SA 2OA4A 5FRNA 2QQ8A 1HXDA 1OR7A 3A0HC 1HDDC 4NDLA 2ACJA 2LD5A 2Z99A 2FD5A 3SFIA 5CPRB 2RAEA 4LIUA 1R00A 1I6XA 3DWLE 2A3SA 2K9NA 2F5CA 4CUGA 3HSRA 1WZ2A 2DCEA 3CUQB 4QSHA 3PQJA 3IH2A 3RPUA 1FZPB 3EUHA 2A5YB 4A3CJ 1FX7A 3J7ZI 1YIOA 3JRHA 3M1EA 1XGNA 2VQCA 5E1WA 4C3JJ 3ZP5A 2CW7A 5F0HA 4PJMA 4ASNA 2V9KA 4HV6A 2F48A 3FKIJ 2MH9A 3G2BA 1EF4A 3A01A 4IPAA 2XDVA 3ML6A 3TMOA 1IV8A 1X3ZB 2L54A 4DOZA 3M07A 4ZTJA 3WODF 2R5YA 3WGGA 3IKVA 2RVCA 5EGOA 3L1PA 3V42A 2LP0A 2XAFA 4E4HA 4B47A 2JJ7A 1DGRM 5IT3A 2PBIA 3M7GA 4J01A 3HKZN 3PIPF 3H3UA 1X4PA 1GXPA 4QLCU 2Q1ZB 1KZHA 2ZJQF 4EJWA 3T5XA 3IRRA 4F3QA 1GDTA 4KMUX 4CO8A 1JJ8C 3MEXA 3K70D 3E97A 2P7CB 5EDNA 4FX0A 1B72A 4I6ZA 5E1ZB 2CS3A 3IAS2 2VPRA 5H6RA 5ILSA 5F1JA 5GTHC 1IF1A 4UVBA 4A3BJ 1IJWC 2E1CA 2M8EA 4HG2A 3TEDA 3WTTC 4ITVA 3TGNA 3L2UA 2NNYA 2DMUA 2XAHA 2R7DA 1IN8A 2E1NA 2K85A 2XVCA 3FXLA 2ID3A 4X1EA 4TV7A 3CMAI 4EM0B 4ETSA 4N9HA 5AIPA 3DQVC 5D5UB 2H6BA 2L2OA 4IOAF 2HR3A 4OAYA 4CZZA 5LHHA 1WJAA 2ZBKA 2YUSA 2MLGA 2KFDA 4G6TB 4L5EA 4AVZA 1MMAA 1OISA 3KP3A 3C3WA 2DFEA 3VODA 1R4NB 1DU6A 4M6XA 4F7ZA 2CQNA 3NQOA 2P5KA 2KISA 2L3DA 5GAHJ 4OAZA 5LGTA 3B6AA 3HPGA 4PCQA 1G59A 2E5NA 3CCJI 1JT0A 4O6JA 2HOEA 1ZHFA 2L01A 4AWXB 2PI0A 1LKXA 4BAYA 2F2EA 2HPMA 5FLXK 2LVSA 5A2QZ 5EZHA 2F5FA 2VONA 2BYVE 2KIUA 4JX6A 2R7OA 5CYVA 4XQFA 3K7AJ 3J81Z 2VBWA 2GIZA 1Q1HA 1H8AC 1IXRC 3WTYC 4CYCB 2ICWG 5B1AH 1JTYA 3OR1C 2BE5F 1ZTRA 1DP7P 2Z9OA 4Y17A 4BE0A 2Y30A 3ZQGA 3F8NA 2EK5A 4NNJA 2IXSA 4MO7A 4WF2A 1JUPA 3AFHA 2W1OA 3KP4A 4ENKA 1LFUP 4BE1A 4A0ZA 3FM3A 3FXQA 5H2FC 5DUIA 3S32A 3ZQFA 4IXAA 1A5JA 1P7IA 5FKKA 3K2AA 2ETHA 3RZOJ 4Z6YA 1P9QC 3ZMUA 1YJ9I 2R93J 1CGPA 4I0BA 4W97A 2P8TA 3ASNH 4AM3A 4LJZF 3FF5A 3H3ZA 3KLNA 1D0ZA 1TTYA 3QODA 3F9KA 2F5EA 3PM1A 2EILH 2DOAA 5DCMA 2M1BA 4CCJA 4A5NA 3GTGJ 2L7MP 3BG9A 4WCGA 2GXGA 2OBPA 4FQGA 2ZFUA 2XPWA 4LD5A 2K3FA 4JK1X 2Y9ZA 4F55A 1FSHA 3U1DA 1QHHD 2ESNA 3CJNA 1DPRA 4OIPF 2YU9J 3MWMA 2EZKA 2OU2A 1RKTA 4DZPA 1UG0A 2HZDA 2GBYA 5LHIA 4M9ZA 1MDMA 1KYWA 4LGWA 4FE4A 4DZJA 2EFNA 5JLWA 3UKGA 3L9FA 2FX0A 1VZ0A 2EJRA 1O7LA 1XMXA 2A6EF 5FROA 4BEHA 1RZ4A 4OMYA 2RNGA 2DPDA 2CFXA 5CVUA 2TRTA 4W1UA 3JREA 3I4NJ 2GA1A 1APLC 1YE9A 5E3MA 2R7WA 3GW2A 3H3VK 3JRGA 1B9NA 4MEXF 2IGNA 2J5PA 2Y2ZA 2XKOA 4ZDOA 3T0YA 3G3ZA 3EYIA 2PG4A 5LGNA 4UHTA 1LDKB 3FHZA 4L9JA 4L5JA 3L09A 3S2DJ 4LG0B 3R61A 3QYEA 4A3IJ 1JXSA 2LOOA 1U2WA 5BPIA 3WG9A 2O8KA 4RLFA 3F8MA 1V54H 4I7HA 1Z6RA 4KN7X 5E8GA 4A2UA 1XD7A 4XK4A 2QGUA 4EM2A 5E3LA 4A5MA 3G73A 2GXAA 2P5VA 2R7RA 4EM1A 2CUFA 2K3PA 5LRRA 4HQEA 3G1OA 3GO5A 4P9FA 2E7XA 2MA3A 2IJLA 1T08B 3L2WA 1GXQA 1TW2A 2HVSA 3QU3A 5TJJA 4PJNA 1VTNC 5E18F 2X85A 1X1DA 3TBIA 4DYQA 2A6TA 3RIRA 3AL0C 3J7AO 2FQ3A 1YOVB 4BH9A 2ZKZA 2OC6A 2R7FA 5M5XJ 3FK7A 1R36A 1WI9A 1TZLA 1MH3A 4E7SA 2DBBA 3GYHX 1HW1A 1U9NA 2CQQA 2HTSA 4Y3OA 2KPMA 4J19A 4EGYA 4XRMA 3LSJA 3MCZA 3S2WA 3HEFA 2ID6A 2V1NA 3ZN1A 2VQGA 2X48A 3DPTA 2V4JC 2X4HA 1ERDA 2HVQA 1YQAA 2BVLA 4CSWA 5FGMA 3V4GA 5ED4A 2KRFA 4KYWA 2O5RA 3OV8A 4Y15A 2HDCA 1ETVA 4BXUA 1KQ9A 3P5JA 1DUXC 2Y0MA 1FOYA 5KAIC 1T98A 1E2XA 1HBXG 2GZWA 2NNNA 4E6KG 2VC1A 3KX2A 3OYJA 1LDDA 3KEOA 1OCOH 3GXOA 2E2IJ 2ZMEA 1STZA 3IH4A 4DGWB 5FO5A 4IHYA 2IBDA 5JHUA 2QEXI 1HA8A 4A6EA 3LA3A 3ABMH 2FJ1A 1AOYA 5E1XA 2ZNYA 2FNAA 2K9MA 4BE2A 1IN4A 3M1CA 4ESBA 2QCOA 1PUFB 2QKMB 2HZTA 4AU7A 2JN6A 2KL4A 2E34A 1YHQI 4BS9A 4YRVA 3OS0A 3CCMI 2CV0A 1U8RA 1ZG1A 5L3EA 3T8RA 2HQ5A 4HBLA 3WTSC 3HOSA 1M1EB 1KA8A 2E2JJ 1YX5A 1XCBA 2VKVA 2WA0A 5HLIA 1W0UA 4FHTA 4I76A 5DM6F 3RKXA 2DDAA 4RM3A 2R7SA 2O6GE 3ZQHA 1TWFJ 1HDPA 4RAZA 3P9CA 1R71A 3J80Z 1V4RA 2EWNA 3I3LA 2KJBA 1K83J 1REPC 5KK1A 4M3EA 1BR2A 2VB6A 3HM5A 5ICGA 5DUKA 5FFZA 1A6IA 1T33A 2DA6A 3HUGA 1S7EA 1SAUA 2HI3A 3X2QH 1XGOA 2RGVA 1WJBA 3DPLC 5TGTA 2Z5UA 1YJWI 2DTZA 1GVJA 4IHTA 2HPIA 4KDPA 2M4GA 2R5ZB 4BXXJ 3VYUB 1OR7C 4S0HB 1WH7A 5C3EJ 2PJRA 3F8FA 4PFPA 2RC4A 5LRSA 4H0EA 3Q5FA 3Q3SA 3ZQIA 2LY2A 2M4KA 1G3TA 3LSHA 4RMNA 2L7FP 5GP9A 1W4MA 3FK6A 2W24A 3H5AA 4RAFA 3HGYA 3ZMDA 5DTDA 5EF6A 3LA7A 1ZAOA 2KIFA 5IP7J 4QIWN 3L00A 2RNJA 1GVDA 2YSRA 4AUXA 3CC2I 2CO5A 4G9YA 5A2QK 4BUPA 5L3BA 3I59B 3EUHC 5JR3A 3L2RA 3ZMTA 2R0QC 2XUBA 4GYGA 3J81K 3T8TA 2LREA 5J4YA 1K4SA 2EZHA 2DTRA 4XKBA 4ZC3A 1MBEA 3COAC 2RKHA 3W2VA 3EUAA 4ZYEA 1X58A 4LLNA 3IWZA 3SZGA 3K4JA 3FISA 1UHMA 2WV1A 2O03A 2NVQJ 4A3LJ 1DU0A 3BCBA 4LLGF 2O9LA 3BJOA 3CDIA 4RA2A 4PJ0C 1S7OA 2AHQA 4IHSA 4AYBN 2VKDA 5CJ9A 5IPAA 5FLVA 3D0SA 5GPCA 3PIOF 3BC8A 3G4SI 1FEXA 1FSEA 3H0DA 1Y1VJ 1ZGAA 4KT5C 3S17J 2R7UA 5FFXA 2K4BA 4XLEA 4PSXA 1YW9A 3I71A 2DODA 2RN7A 1IN6A 2HWVA 5B3SH 2JMWA 5DS9A 4ABZA 2LC2A 3TDZC 2W84A 4XLPF 3I4PA 4XNFA 1VNDA 4C2UA 3BR2A 4DIQA 3O8GA 3FDYA 3AG4H 2FBIA 1E17A 3M8JA 4A6DA 4G8XA 3ZMVA 3QAHA 1Y0NA 1LVKA 1JHHA 1HCRA 4P1WA 4KJZA 3JSPA 1QO0D 1MSFC 3HC7A 4N9IA 1ETOA 1Y6IA 2XV4S 4RGRA 3EQLF 2K5CA 5L3FA 3L2QA 1BC8C 4Y4RA 5KNLA 5HS9A 4I01A 2OD5A 3HIFA 3HXLA 3OIPA 5HLTA 5J8FA 1XX5A 2B9SA 2LSOA 3A4CA 3S3MA 3CO6C 2YPRA 4XMYA 3K2ZA 4GGGA 3IHUA 1K4TA 3LMMA 5FD5A 2QBYA 4RBOA 2CV2A 5BNGA 2K27A 3VWBA 1XSVA 1HSTA 2EBIA 3CCLI 4L18B 4CCLA 4XLCA 2HFHA 4U88A 1OCCH 1N77A 1XB4A 4L0ZB 2VOPA 3HTSB 3AL0B 1ZG5A 2Q0OA 2QQ9A 2ESHA 2VXDA 5ILVA 4A12A 1A36A 3K1NA 3H9JA 2LLKA 1N75A 3E0JB 4KFCA 3EUKL 1SD5A 3HZJA 2EINH 2DPUA 1KU2A 1UMQA 2VT3A 3GLXA 5K7HA 4BJTA 4E7KA 3FXOA 1WJDA 2ZSIB 4A0YA 4E70A 4BBSJ 4UVCA 2BHZA 3MZ8A 5BOXA 4L0YB 3MKLA 1B9MA 2CW8A 1G2HA 1G3SA 1SFKA 1R5ID 1O57A 2WC2A 3KP2A 1FYKA 1PYVA 5FD6A 1GLNA 3MVPA 3LSRA 5CVIA 3DCFA 5HLHA 4XN0A 3P7NA 2NVUB 1LFBA 3F3XA 1Z21A 5KVRA 1SMYF 2QQBA 2KZVA 1VQLI 3I4MJ 4E7IA 1B8IA 2DW4A 2ELJA 1NG6A 3F8BA 4U0YA 2VBXA 1IRZA 2KDZA 1FIAA 3FHNA 3GWZA 2H94A 3DBLB 3H5NA 2LRDA 2WB1A 3QOEA 3ZCOA 4BYYA 3ONQA 3D5RC 4P9UA 4MGRA 3WGHA 3BTJA 2LY9A 2ISZA 5J1YA 4XOTA 5BS6A 3DP7A 2E35A 9ANTA 4B3XA 5IP9J 1K6OA 2Q2EA 2JZYA 3WTXC 1YRNA 2AS5F 3LSTA 4EMSA 4IOCF 3B6CA 2VI6A 1WJCA 3H9GA 3I5UA 1OYIA 1LEBA 2N8GA 4ZDLA 5J47A 4HPQA 4FT8A 3FXRA 4AIDA 1MNEA 2Y48A 2XIGA 3S1MJ 1V5GA 1QVUA 2E1MC 2BEOA 3I64A 1R9TJ 1P4WA 4XKWA 2L7ZA 4I98B 5D4RA 1POGA 1P92A 1D1AA 4PGGA 1NK2P 4HF2A 4U7BA 4X0GA 3OMYA 4PDKA 1KU7A 2BVMA 3E6CC 1ETYA 3GFLA 1X19A 5LHGA 5HOOA 3RQ4A 3LAPA 1RESA 3GTPJ 5J4VA 2OQRA 3HOXJ 1UAAA 3KP6A 1BA5A 4LLLA 2GXBA 2M3AA 3R0JA 2XSJC 3UR3C 4G7HF 3CESA 1XMAA 2HVRA 3OYLA 1YS7A 3O3KA 1Y0UA 2XHKA 3BR3A 3H1CA 4Y13A 3ZMSA 4IRGA 1RI7A 2EV5A 3O2PE 2JA8J 5JLXA 5B1BH 2LKXA 2KHMA 4KIFA 5LBQA 5FKLA 4QPOA 1TQMA 2LR8A 1YX3A 2F5DA 4E7ZA 1UFMA 2H1LA 2VN2A 4UXNA 2Q8KA 4S04A 5HVQC 3CUQA 1K78B 1J9IA 1T0FC 2XF6A 1TQPA 2JA5J 4A3FJ 5IOZA 2BW3A 1VQ6I 3J80K 3P9KA 1XTAA 1MJAA 2DYSH 1FOWA 1RKWA 2QF7A 2E19A 4RGUA 2HKOA 3LAJA 4XRSG 5IP6A 3BTCA 3V7CA 4NQWA 5L3CA 1CQTA 2IEKA 2R5YB 4GXOA 3DV8A 2VBYA 2VIXA 3HKZA 3OY9A 3LWFA 2FOKA 4HEA2 2A07F 2VJ4A 1K7AA 1TC3C 3U2RA 4PFOA 4BY7J 2BGCA 1EA3A 4ZYAA 3IH3A 2HS5A 1GHCA 4A3KJ 2EFOA 3A02A 1IGNA 1ETXA 3MKZA 1ZGJA 3FBIB 2V9PA 1WJEA 2L9NA 3MD2A 1D3YA 4OU0A 1R1VA 4IRHA 3OYDA 4IF4A 4UV9A 3WTZA 1XSDA 1FP1D 4S05A 4FISA 3H36A 2DO7A 4BHPA 4DYRA 1VQ7I 1QRYA 2W48A 3ZQ7A 2W82A 2X6XA 2YR2A 3E1SA 3GZ5A 3G6EI 1QPIA 2Y75A 3BP8A 1UHWA 3CDLA 1TBXA 1X1PA 3REOA 5BPDA 3BG7A 4RAGA 4I2OA 2MABA 2V1XA 2OQGA 5KCMA 1BN5A 2VPLA 3K69A 3GUDA 4AC0A 5D6FA 1HW5A 3TO9A 5M5YJ 1HSJA 3PNYA 5FLMJ 3IAM2 3QPLA 1T8IA 1R5HA 2ZMEC 2P5LC 1ZELA 4BACA 3OYKA 3DEUA 2CUZA 3HGGA 2MW8A 2XPVA 2E7WA 4XLHA 3PFIA 3ZMZA 5IYBJ 2EFWA 2DOEA 1BIAA 3KZIC 1ZARA 3N05A 2JT1A 2XAQA 5F08A 3LOCA 4B43A 3CZ6A 1V5FA 2DJNA 2R4GA 1LE8A 1D5VA 3CTAA 3SDGA 3UNGC 1FP2A 1G6NA 3IWFA 2W57A 4G94A 2QUFA 1OJLA 4FX4A 1VQ9I 1B6AA 4PSWA 2M30A 4UUTA 4CCKA 5HS8A 4P96A 4IX7A 3ZQCA 1DQUA 5EG0B 2GM4A 2IA0A 5EJCA 1KGSA 2JPCA 5H20A 3FIWA 4A0XA 1A35A 3GTLJ 1NHAA 3SHFA 1ON2A 2MLKA 4CYCA 1DPUA 3FM5A 3ZXSA 3ABKH 3HRSA 2P0WA 3OYEA 1YI2I 2V1DA 3TO6A 3FBNB 4HDUA 3V7SA 2M9HA 3MKYB 3S3NA 4BJ5C 4C2TA 4A3EJ 2EFPA 4V19K 5HODA 3L2VA 4B3AA 3S8PA 3TKYA 1WCMJ 4EJVA 2PN6A 3VEPA 3HYIA 2CV1A 2PQ8A 5GADJ 1JE8A 1F5TA 2MGQA 2ZFWA 1EV7A 2DFFA 2EZIA 3DXJF 1Z0XA 1YITI 1WJ5A 2O8XA 5F04A 2ISYA 4KNYA 3NEUA 3HOZJ 2P6TA 1LNWA 2FOWA 2NS0A 4OIRF 2RV8A 2XC7A 2CUEA 3GBGA 2EV0A 3QP5A 2VBZA 3BLYA 4OINF 1WSUA 4ESFA 3MMYB 1IN7A 3OSFA 4L5IA 3M9AA 1T56A 1Z3XA 5GTIC 4IHWA 3V7RA 4UUSB 3ABLH 3ZQLA 4D5FA 1JI8A 3QYBA 3L7WA 1XSXA 1YS6A 3HPHA 3QPHA 4WXHA 1W36C 4UUVA 5HDNA 3HOVJ 1E3OC 1KU9A 1UHSA 2DMQA 3R4KA 1XDSA 2HQRA 3S15J 4XLAA 5EYRA 3F23A 2E1MB 2ZCWA 4J00A 1FC3A 1D0XA 3LQRA 4MTEA 2LTPA 2R3SA 2P7VB 4OIQF 2CWEA 1H9GA 2IGKA 2KLOA 4M72A 3WU1B 3DPUA 2BY3A 3BJ6A 2LKSA 4Q47A 2H1KA 2VKHA 1WRJA 3PFYA 4HX8A 3KIOA 1FY7A 2CH0A 4XLNF 1RUOA 2Z16A 3I9V2 1U78A 3ZQQA 4BQOA 4BHCA 1U6GA 3KYCB 2VOOA 1IRFA 4F52A 5IY5H 2G7UA 3FXKA 4K2EA 2QKLB 3PUBA 2NYXA 3SDBA 3WGIA 1OCRH 2PLYA 5IT9Z 4RB0A 1A6QA 3Q0WA 4PZJA 2JUCA 1WVRA 2DYRH 4Y7NJ 2YS9A 3BZKA 3IRQA 1MW7A 2HEOA 3DTKA 5F6FA 2DA1A 3QWLA 4MFDA 3PNVA 1CF7B 3HJEA 4EEFG 1FLIA 3PO3J 5E3NA 3DTEA 4MHGA 4XKVA 3DKWA 1ENHA 4LG0A 1F9NA 4ZZLA 1FYLA 3Q0UA 2AO9A 1ZLKA 4G6DA 2PJPA 2HQAA 3OOUA 2DA4A 3RKQA 5ERIA 3CUOA 4Z2YA 2JRMA 5D5XB 2PMZA 1X2MA 1IV6A 5B5EC 1D8KA 2BHYA 2FMLA 2PMZN 3T1BA 1QHGA 3JCUC 1SVLA 4IL6C 1ACIA 2JA2A 4BU2A 4ZYDA 1F1ZA 1PVEA 4UV8A 1VI0A 4D0PA 3GTQJ 5GAEJ 1SD6A 2CJJA 3DU6A 2K9QA 1Y8QB 2LY1A 1LVAA 2ZXWH 5CQGA 5ICCA 2M0MA 3DF8A 2PEXA 3DLAA 3FX3A 4C3HJ 1MGTA 1RNLA 1Z67A 1ZGWA 1TNTA 2K40A 2ZXJA 3R60A 4XLFA 4B48A 2ZJPF 1NH3A 1SD4A 2G7HA 1OCZH 3FXMA 1ULYA 2OZUA 2JSPA 1U0JA 2LBFB 1U9OA 4D1QA 4BY1J 1TWAJ 3TQNA 4CYDA 3FMSA 3CJRB 3NARA 1N25A 2Z33A 3K0LA 4LIVA 2KZGA 4WK8F 2H09A 2QSHX 4O3MA 4C30A 2IS2A 1Z3YA 2V9VA 1PP7U 2IP2A 2K86A 3KFWX 4ZYHA 2HXOA 4JBAA 1FBSA 1FT9A 1J75A 3ZGKA 3TW7A 3WHCA 1Y39A 3PL8A 4Q48A 1BJAA 3QYFA 1WPKA 2ELHA 1QA6A 1I39A 1FMWA 3ROUA 1DDNA 3GVAA 4NC8A 2ZMEB 1AHDP 3BZCA 4KA4A 2D45A 2XROA 1RRJA 1W36D 1WH5A 1HW2A 4DJAA 3K4LA 1BR1A 2BXYA 2JA7J 3BR6A 3IKTA 1MBHA 1BI2A 1BI3A 1XGMA 5HNHA 5LEJA 1O3QA 3HRUA 3LSKA 2H6CA 1PUFA 3MZHA 1OMIA 1PDNC 1H9TA 3GMEA 3OWTA 3GZ6A 1HLVA 2NVYJ 1RETA 3IV5A 5DYMA 4KIBA 2DMTA 4RLQA 5E17F 3G1LA 4RDUA 3HDDA 4JP0A 3BZ6A 2FXAA 4LG3A 4DQ2A 1SANA 3KP5A 2P4WA 3WG7H 2VASA 3W6JB 4YFXF 1FOXA 2B7EA 2GOXB 3QP6A 3S93A 5D4SA 3E5XA 4ESJA 5J6XA 2HOAA 1SMTA 1W7PD 3HTUA 3SXYA 3Q9SA 2UWMA 1RR8C 3HG9A 2GLOA 1HQCA 2VUMJ 3VDXA 2BV6A 3GTOJ 3MN2A 5D5WB 3VSLA 1L0OC 2R5ZA 1Z7LA 2R7XA 2XAJA 4ZTFA 3C18A 1I1SA 3WE3A 3ERED 1SVMA 3KPHA 4UB6C 4LITA 1ZG3A 2XGEA 2MC3A 5EZGA 3JRAA 3BG3A 2XF7A 3G1MA 2DT5A 4CCMA 3F6VA 4NHJA 1BOBA 3E5UA 4HNVA 4KIGA 4I02A 2DN0A 3LA2A 5J1UA 4YEJA 3QOPA 3OIOA 2CMPA 4MLOA 5FRMA 3I59A 1OYWA 2FU4A 4M3BA 2CUJA 3GFJA 3DKYA 2MBFA 2IVMA 2E2HJ 2K9LA 1AKHB 4M9SA 4BQNA 3DKXA 5HDKA 4FTHA 3QRFF 2STTA 2LF8A 3S16J 3SEQA 1DP3A 5F64A 2KMUA 1J09A 1ZK8A 4CHUA 2M5WA 4M6VA 4AYBA 5K5OA 2JRTA 3GTMJ 2IS4A 3OYMA 4MIMA 3IL2A 3PJRA 1I6HJ 1T95A 1SVOA 3HRMA 3RKWA 4HRIA 3EDPA 1S29A 2CFOA 4NC7A 2DU9A 4MEYF 3JTGA 2QA4I 3D1NI 1TT0A 2RQQA 2WV0A 4IHVA 3BROA 1T6SA 2VL8A 3GX4X 3BY6A 3ERMA 1ZYRF 3K1PA 5IYDJ 3FWEA 2L9RA 1BW5A 2QSFX 2MSYA 4QWQA 1S6LA 2K7LA 3F21A 2PFBA 2XRNA 1ZLJA 3AG1H 2MD5A 4XICA 3WTUC 2IPQX 1MKMA 1UB9A 1J5YA 3OIQA 4IRIA 2X6YA 4M9XA 3OOPA 2V6EA 5DV5A 4HV5A 5JFRA 1W7PB 2M87A 4PUSA 3M8EA 3K4BA 2XKPA 2R7QA 1S8NA 1BOAA 2CRGA 2OTJI 1N78A 1YW7A 2WBMA 1TT5B 2YX4A 3BTLA 2ME6A 1TWHJ 2GA2A 3J7AY 3KCCA 1SFEA 2ECCA 5HDGA 1AU7A 3BT9A 3JRDA 4L9VA 3FMRA 2X51A 4GCVA 5CVVA 3S1RJ 1FJLA 2VJJA 2K02A 4HSTA 2YX7A 3I58A 5KAFC 5EEGA 1DGWY 2KIMA 3KEQA 3TDUC 4D9JA 2WAFA 2YU3A 4HZFA 3CMYA 5ICFA 3H5RA 1D1BA 4OMZA 1X1CA 1QQIA 2XAGA 4ENJA 4BL0B 2A69F 1ZN2A 5IT9K 5CKTA 2J5OA 3BR0A 5FB2A 1Z9CA 4PGHA 1Z91A 3SEZA 1HKSA 3L2CA 2CQXA 1TLHB 2QZ8A 2BBYA 4XN3A 4KUMA 5DM7F 2WAQA 1KONA 1O3RA 2ZXHA 2IT0A 2WAQN 2JWTA 3TOBA 3OYGA 1G3YA 2V26A 1JUSA 3LFUA 3LQQA 3FXUA 4I09A 2IA1A 1Y1WJ 3RPUD 4HX4A 1LB2A 4XOPA 2WY7Q 4KT6A 3VB2A 3AKZA 4EJTA 1E3PA 2DFHA 3J7YJ 4JQFA 2EA4A 1Z05A 2DA3A 5FKOA 1X3WB 3IUOA 3K6GA 2QSGX 2JVHA 5LD2C 3RYRA 2NXNB 2HDDA 4EV0A 2KJCA 2OCCH 2OZ6A 1Z77A 2WY8Q 3PUFA 2D2WA 1AWCA 2ADUA 5LGUA 2DA2A 1FTTA 1ZR2A 1G8XA 1QZYA 4ZZDA 2HNHA 1FPQA 3C2BA 3H92A 4YFNF 5CVJA 2Y9YA 4HAMA 4IEJA 2WWYA 1USSA 1EH6A 3I0TA 1XMKA 5AIQA 3B73A 4LMYA 4GRIA 2MFZA 3TP3A 3CLQA 4D5CA 1BC7C 2JSCA 2VC0A 4MQ9F 1P7JA 1I3QJ 3GFMA 3WE2A 4N0BA 4E7JA 2EIMH 2JA6J 1MMNA 5DDGA 3ABTA 2O7OA 3CCYA 3GF2A 4NB5A 1XDUA 3D5LA 3ZR8X 3OYCA 3ZPLA 2Y31A 2PX9A 4B44A 3GFIA 2W25A 1A31A 1QU3A 1GV2A 4U0WA 3SJMA 5F27A 2RREA 5FKMA 1P4XA 1U3EM 1GV5A 1LFPA 1IUFA 2X6WA 1FNNA 1R4MB 2G0EA 4IQJA 3DLLF 3CCRI 1O3SA 4YG2F 1U5TA 2KRHA 4OOIA 4AIHA 3NAUA 3BPVA 5TISC 3F0CA 3QQAA 1WWXA 3ASOH 5D8LB 3PSFA 4JX5A 5J3LA 1FYMA 1TW3A 3R6SA 4B8XA 3BJAA 1R58A 1Q1VA 4N4OB 3E6BA 4ON0A 2BY0A 1K6YA 2Y0SN 2GOMA 1HOMA 1Z1DA 3VFZA 1UG2A 2NS7A 2Z3YA 1P4AA 3N4MA 4EVIA 5JI6A 3A0BC 4ANJA 1ZRCA 1R1UA 3K10A 2Y69H 4LK1F 4AVPA 4GDFA 4P55A 4RGSA 4DW6A 3LSPA 3VSKA 4NUBA 1JT6A 2BOLA 3CQZJ 5H6QA 4ENMA 3A01B 3RYPA 1J7KA 2IAIA 2FUG2 1K78A 2BW3B 2XF5A 4RGXA 3QPSA 1K61A 5FJ8J 4RM2A 3E5QA 1IZ1A 5KHDA 4HOBA 3RSNA 3KEYA 2UXNA 1EJ9A 1IUYA 2A05A 4C9YA 1OQYA 2DA5A 1WFXA 5EGOB 2B0LA 4DYCA 2DDBA 4NQWB 3NRVA 2R92J 3CF5F 3HSEA 3BCAA 3RTRA 3OYHA 1VQNI 4WXCA 4FETA 4CCOA 1BI0A 3A1YA 3PQKA 1J0RA 1BM9A 2LMDA 2KP6A 4RAYA 2X1EA 1AA7A 4HNUA 2KQRA 3F6OA 3MFKA 4FE7A 2I10A 4CA0A 4RB3C 3LFKA 4RB1A 4XRFA 3H0GJ 3CC7I 4QTRA 5CLSA 2EPFA 1A04A 1OCTC 4XRSA 2AQEA 3BTIA 5TRDA 4G6QA 6PAXA 2FBKA 3P9IA 2KIQA 2GWRA 1L3LA 3K1MA 4BXFA 3HOYJ 3KZZA 1O3TA 5HNFA 4A93J 3C7JA 3K4NA 1ZKGA 2OJED 4ZDPA 2HDWA 3EETA 1B1BA 3WU0A 1B72B 4M3DA 2FEZA 1I5ZA 1XN7A 2DAOA 2DK8A 5K1YA 3E7LA 1FBQA 4U0VA 3CCSI 5EEHA 3M8FA 1QPMA 3GTJJ 2NAZA 2W00A 3FZVA 1QZZA 2HXIA 1OYYA 1Z7UA 2LNBA 4CCNA 1IW7F 1YO5C 2XAUA 2ZNZA 2FMYA 2COBA 2UV1A 3ECHA 4RS8A 1IDZA 1X1AA 4BKXA 2JQ7A 3HL2A 4L9TA 2I8DA 3BG6A 4V2GA 1WGXA 3U21A 3CLOA 5JVGF 4KMFA 2BXZA 2L4AA 4BHBA 1F4KA 1RR7A 3FMQA 1SAXA 5E79C 1NTCA 3F22A 3EYYA 4EATA 3CC4I 3V8LA 3CP2A 2LDUA 3FXJA 4QPQA 1SC7A 4M74A 4RB2C 1VQ4I 1ETWA 1LE8B 1I1GA 1USTA 2KT0A 5J1RA 2FQ4A 2ZO4A 4V2FA 4WXDA 1TQIA 4P5OA 1ORKA 1VQ5I 1SD7A 1XC5A 1LUJB 3PSIA 3BR1A 5BMZA 2A68F 2I5UA 4Q4ZF 4C2MJ 2F6CA 1S72I 4HYEA 3DBHB 5HLGA 5EG0A 1XGSA 1ETQA 1W1WE 3M4OJ 5M5WJ 3LNQA 3S3OA 4KITB 2DLLA 4PJLA 3F8CA 3E6MA 3BR5A 5BQTA 2GIVA 3U1KA 1EH7A 1YIJI 1H0MA 3AAFA 1JJ6C 3KE2A 4IHXA 4YELA 2VE8A 5AONA 2CSOA 1ZREA 4O5VA 3MQ0A 1X3UA 2V6CA 3OR2C 1IAWA 3S1QJ 3ULQB 4A3DJ 4C3IJ 1WHUA 2L0KA 4CGZA 1S5LC 1I3AA 3W2AA 2XSDC 4BDZA 5DCMB 2G9WA 2O61A 1R6RA 3HRTA 3CD6I 4UNOA 1LDJA 2XB5A 1FBUA 1D5YA 2M7BA 1SFUA 4YFKF 4JOMA 3DTIA 4AD9A 1HKQA 3E3VA 1E0EA 2DMPA 1IRGA 4M3GA 1UCRA 4CDGA 1PP8F 4EGZA 4BNCA 1MNMC 2HGCA 2VODA 4EJUA 1R23A 2D1HA 2QLZA 1BR4A 1ON1A 3OL3A 3JRIA 4BDYA 1ZQ3P 3WU2C 1MDMB 4XSZF 4GFBA 1IXCA 3U9GA 2X1CA 2PMUA 2EB7A 5J8CA 2VQHA 2GQQA 2JPBA 4XIDA 4UUSA 1LQ1A 2KKOA 3SFZA 4BEHB 3GCMA 1H89C 1J2XA 1I27A 2AXTC 1WQ2A 2L9SA 2ME0A 1MBJA 2D1VA 1ODDA 4CZCA 2R7VA 2FSWA 3RQIA 1T2KA 5ILUA 3IP4B 2NOJB 4DBRA 4IJAA 4IO9F 2DXIA 1UZCA 3VYRB 2VKEA 3IC7A 5EEAA 3JAMZ 4YIFA 1ZRDA 2X1DA 2XB0X 1MNDA 2OPTA 5LFAA 3BWGA 3RDIA 4BJ6C 3I54A 2DFIA 2LYCA 3QPTA 3CJQB 1OKRA 4DBQA 1K79A 4EJOA 5DD8A 3CCVI 4Q5SF 1JTXA 1SEUA 4LB5A 2KDOA 2LKPA 5M3FJ 1ZRFA 3PO2J 3O8HA 4B4CA 3CF2A 2O0YA 1WI3A 4OIOF 2WADA 2STWA 2VJIA 3FKJA 1Y8RB 1CF7A 1KQ0A 3OYNA 2XASA 1I50J 1T0FA 2W85A 3DFGA 1TNSA 4R8HA 3KYLA 1YTYA 3A03A 4IZZA 4UY8I 3G71I 2VT2A 5FKNA 2TCTA 4LK0F 3NWTA 2QVOA 3BDDA 3CMMA 1UJ8A 1D0YA 1KU3A 2TDXA 2XGXA 2L5QA 1W5SA 2NVXJ 3C2GA 1KYZA 2VLAA 4ZYGA 2ZXIA 2JVGA 2O3FA 5M3MJ 2ZJ2A 4HQMA 2C6YA 5B66C 4KISA 5J40A 2V79A 3SZTA 3LSGA 1Z6TA 1YW8A 4HA8A 2CQKA 1BBYA 2QENA 3VYSB 4F93B 2UZKA 3SQNA 3KYDB 2P6SA 3DBRB 4BGDA 2ZJRF 2M7AA 4LFUA 1B59A 4U7DA 3ELKA 1TL8A 2E71A 4GYIA 3BOQA 4Y33A 3JRBA 3CCUI 1BW6A 2B63J 4UVAA 3GTKJ 3GLLA 5K5QA 4LOCA 1NG7A 1E3HA 2P81A 3HB9A 2LBFA 4LB6B 2OAZA 1WJFA 3KZYA 1SFXA 2JUGA 2Z2SB 1MIJA 1R1TA 1P6RA 5GPAA 1FWZA 2CYYA 1X1BA 2DJIA 2FBHA 3JRCA 2COMA 2IGMA 2IGOA 1S7AA 2LK2A 3O6BB 2OCEA 1UELB 1XPXA 2L02A 2DOFA 4MNUA 5F0CA 3W2WA 3F72A 1LJ9A 1BL0A 2DQLA 3K9TA 1ZR4A 2K9SA 3NWSA 2HYJA 4NC6A 5LLQA 3OYIA 3EPZA 1IN5A 3N97A 2HYFA 3K4MA 2IRFG 2Z1DA 1C0WA 2EIJH 4E7LA 1MJ9A 2DMNA 4I99C 4NBQA 4R1HA 3GZNB 3AG2H 1KQ8A 2EV6A 4XBFA 3TP0A 2DK5A 2A61A 4PJJA 5F0FA 3BQZA 1O7FA 3H9QA 1JKRC 3WHBA 1GUUA 1ZH5A 2H8WA 1MH4A 1NK3P 4II3A 3LSMA 2A6HF 2A5WA 3HBLA 1W5CC 3RKYA 3S14J 4HLYA 2CU7A 3LL7A 2JK3A 3ABUA 2HOTA 1YYVA 4B09A 5CQEA 2W4SA 3HUGB 1IO2A 3RCOA 3VOEA 2NOGA 5HS7A 2EFQA 2LG4A 2E36A 4A3GJ 3CMEI 3KP7A 1RC9A 2ECBA 3MAJA 4II2A 1VFCA 1U5TC 2HKXA 2CW0F 3I55I 2CGPA 1R49A 3TOAA 2F4IA 4A69C 4X6AJ 4YIRX 2L9VA 3S2HJ 2XRLA 2XGCA 4IVNA 5DD4A 2PJRB 1HKTA 2WTEA 2FA5A 4BBRJ 1X2NA 2FE3A 3M3YJ 1XCVA 2NS8A 2EQRA 1YG2A 1RIOH 3TL4X 2RQPA 3A2KA 4F91B 1IC8A 1VQMI 1MBGA 1RPWA 4XSXF 3ZOBA 4B1RA 1VQOI 3HHGA 1QVTA 1G3WA 3GEZA 2OUMA 4R79A 2D5VA 4DNCA 3CUQC 3CP8A 1IXSB 2X0LA 3C2HA 1MD0A 2MC4A 3RJPA 2DT6A 3OYFA 4D7NA 2FF4A 5C4XJ 2XGDA 2OF7A 2HU9A 2BZTA 1IG7A 2OV7A 3HOUJ 4HSRA 3R0AA 4H4KC 1JKPC 1Y56A 2BY1A 3JTHA 2GAUA 2QYOA 4BQQA 1H88C 1PJRA 5ICEA 3JRFA 4G7OF 5DEQA 1EKEA 1OFCX 4D7MA 3W6VA 3I56I 1XG1A 2HTJA 1AKHA 2NRAC 3Q0VA 5IYCJ 1V5EA 2M34A 3RI4A 2LFBA 4AIKA 2H27A 5C44J 2ZC2A 1ITYA 4MTDA 3VYTB 2EIKH 2IS6A 1JKQC 2X6OA 3VPRA 3OSGA 2R7ZJ 5D6EA 2EH3A 1R5GA 4M73A 4XONA 1F36A 2QM3A 1RUNA 3H35A 4JX4A 3KETA 1OCPA 1FOKA 1LEAA 5DCFA 2DI3A 3HSFA 3LSIA 5CVRA 1W0TA 1S3JA 3S1NJ 1JGSA 2HYGD 1EH8A 2PMHA 2QQAA 2ELKA 5K5RA 2IS1A 1VQKI 5JVTA 1V55H 4MFEA 4KN4X 4FASD 1B4AA 4HF1A 1U8BA 1MMSA 3HOWJ 3DEWA 5FLXZ 1D1CA 2VJ5A 5JHFA 1X4OA 3CO7C 1JKOC 3HHHA 2MD0A 3KLOA 1ETKA 2UXXA 4U87A 5K7FA 1J59A 2H8RA 1G4DA 4I0AA 1VF9A 4HF0A 3TO7A 5E8IA 1VQ8I 2ZSHB 4FCYA 2JTVA 1W7PA 3JSOA 1MJBA 2DA7A 4XORA 3W6KB 2L4MA 4PK4A 2F5VA 1YJNI 3BG5A 3ISPA 1QZEA 4BQAA 2M2EA 3JW4A 2VE9A 3QU6A 3V8JA 3I53A 4XM3A 5C4JJ 3MZYA 3K4KA 1BIBA 4CICA 4HNTA 3K4CA 1MMDA 4WWCA 3RZDJ 1VQPI 2W7NA 4HX7A 3MKWB 1R7JA 1JHFA 4F92B 3CDHA 1W5TA 3TW6A 1OPCA 2QBYB 4XR6A 2MG4A 2F4MB 3JR9A 1D8JA 1QGPA 4MQVA 3JAMK 1MMGA 5E3OA 4GO1A 2R7TA 1S9HA 2DT7B 5GAGJ 2VQLA 2E60A 5L3DA 4KICA 1QNTA 2CG4A 3OL4A 1P2FA 2FRHA 1MZBA 1FIPA 1IDYA 3AG3H 3OS1A 2MH2A 2IW5A 4HLXA 3WTWC 2QWWA 4YIIA 4G7ZF 1HF0A 1XS9A 1BJZA 2OTLI 3BPXA 4L9NA 1BI1A 2HOSA
chains in the Genus database with same CATH topology
1B72B 2R5ZB 4M3DA 2EZLA 4BXXJ 4S0HB 2NVTJ 1MBFA 1O4XA 3E7LA 1WH7A 5C3EJ 3Q0WA 4A3MJ 3GTJJ 4JYKA 3Q3SA 3ZQIA 2HXIA 1TWGJ 4Y7NJ 2X9DA 2L7FP 5GP9A 2YS9A 3FK6A 5EF6A 1SFOJ 3HGYA 5DTDA 1B8IB 5IP7J 2COBA 4QIWN 1GVDA 2DA1A 4AUXA 4MFDA 1IDZA 4EEFG 4BKXA 3PO3J 5E3NA 1F43A 1ENHA 2R0QC 1E3OC 4V2GA 1TWCJ 1WGXA 3Q0UA 2AO9A 4G12A 2EZHA 3OOUA 1MBEA 2DA4A 2M0CA 1RR7A 3RKQA 1GT0C 1YRNB 1X58A 1NTCA 1X2MA 1IV6A 3FISA 2PMZN 2WV1A 2M8GX 3BQYA 2NVQJ 2WB1N 4A3LJ 1FTZA 1DU0A 2E1OA 2O9LA 4Y52J 1ETWA 1LE8B 1VI0A 2KT0A 5J1RA 2FQ4A 3GTQJ 4M3FA 4V2FA 2XPUA 2CJJA 1ORKA 2AHQA 2K9QA 1XC5A 1MBKA 5IOYA 4AYBN 5K7ZA 3BR1A 5IPAA 4A3JJ 5FLVA 4C3HJ 2ZB9A 1JUMA 4C2MJ 5GPCA 1ZGWA 1FEXA 1Y1VJ 2K40A 5EG0A 3S17J 1ETQA 3M4OJ 1MSEC 5M5WJ 3LNQA 1U9OA 1JGGA 3BR5A 4BY1J 1TWAJ 1JJ6C 3NARA 2JMWA 4IHXA 5DS9A 4ABZA 1HDDC 4NDLA 2LD5A 2FD5A 3SFIA 2HXOA 2RAEA 3S1QJ 1VNDA 3BR2A 4A3DJ 4C3IJ 3TW7A 2K9NA 2L0KA 3WHCA 3O8GA 4QSHA 2XSDC 1WPKA 3IH2A 4A3CJ 3JRHA 1HCRA 1MSFC 2XB5A 4C3JJ 1D5YA 1ETOA 5F0HA 1AHDP 3FKIJ 1EF4A 3A01A 1WH5A 2DMPA 4M3GA 2JA7J 3BR6A 1MNMC 1MBHA 2R5YA 3JRIA 5EGOA 4RBOA 1PUFA 5BNGA 1ZQ3P 3L1PA 2EBIA 4GFBA 4UUSA 1HLVA 4XIDA 2NVYJ 2LP0A 1RETA 3IV5A 2JJ7A 2DMTA 3G1LA 3HKZN 4RDUA 3HDDA 4JP0A 1H89C 1SANA 2LLKA 2ME0A 1MBJA 1UMQA 3RQIA 5K7HA 1GDTA 2HOAA 1JJ8C 2VKEA 4BBSJ 5EEAA 3MKLA 5EDNA 2GLOA 2VUMJ 2XB0X 2OPTA 1B72A 3MN2A 4I6ZA 3GTOJ 2R5ZA 1G2HA 2VPRA 5F1JA 3LSRA 4A3BJ 3MVPA 1IJWC 3TEDA 3DCFA 2XGEA 1JTXA 5EZGA 3JRAA 3BG3A 5M3FJ 2DMUA 1LFBA 3G1MA 3PO2J 3O8HA 4HNVA 4B4CA 3I4MJ 2ID3A 4X1EA 2DN0A 1B8IA 5J1UA 1WI3A 3OIOA 4MLOA 2YUSA 1IRZA 2KDZA 1I50J 1FIAA 4L5EA 4M3BA 2E2HJ 1AKHB 1DU6A 3A03A 4FTHA 3S16J 3BTJA 2LY9A 5FKNA 2TCTA 5J1YA 3B6AA 9ANTA 5IP9J 1ZK8A 1YRNA 2NVXJ 1JT0A 4M6VA 3B6CA 2VI6A 3GTMJ 4MIMA 2N8GA 5M3MJ 2LVSA 1I6HJ 5EZHA 4JX6A 3S1MJ 3K7AJ 3LSGA 1QVUA 1R9TJ 2L7ZA 1NK2P 1POGA 3D1NI 4IHVA 1H8AC 4CYCB 1JTYA 3JRBA 5IYDJ 1ETYA 1BW6A 2B63J 2L9RA 3GTKJ 1BW5A 1ZTRA 1RESA 2MSYA 3GTPJ 2Y30A 3ZQGA 3HOXJ 1BA5A 4LOCA 2P81A 3HB9A 4MO7A 1JUPA 4XICA 1LFUP 3ZQFA 1A5JA 3BR3A 1P7IA 5FKKA 3K2AA 2JA8J 3RZOJ 5GPAA 5JLXA 2LKXA 2R93J 5FKLA 3JRCA 2CRGA 2LR8A 2LK2A 4W97A 2ME6A 3BTLA 5F0CA 1TWHJ 1BL0A 2ECCA 3PM1A 2K9SA 1ZR4A 1AU7A 3BT9A 3JRDA 2HYJA 2JA5J 4A3FJ 5IOZA 3GTGJ 2L7MP 3BG9A 3S1RJ 1FJLA 1RKWA 2QF7A 2DMNA 2XPWA 2E19A 4XRSG 5IP6A 3BTCA 3TP0A 2Y9ZA 1CQTA 2IEKA 5F0FA 3BQZA 2R5YB 2YU9J 1JKRC 2EZKA 3CMYA 3WHBA 1GUUA 1RKTA 1MH4A 4DZPA 1NK3P 1TC3C 2GBYA 3HBLA 3S14J 4BY7J 2CU7A 4FE4A 3IH3A 2JK3A 4DZJA 5JLWA 3BR0A 3UKGA 2FX0A 2HOTA 4A3KJ 2CQXA 3A02A 2NOGA 1IGNA 1ETXA 4A3GJ 2ECBA 2WAQN 1VFCA 2JWTA 1JUSA 2TRTA 4W1UA 4A69C 3JREA 1Y1WJ 4X6AJ 3S2HJ 4FISA 3I4NJ 2XRLA 2XGCA 1APLC 5E3MA 4DYRA 4BBRJ 3H3VK 1X2NA 3JRGA 1QRYA 2W48A 3M3YJ 2DA3A 5FKOA 2NS8A 2EQRA 2Y2ZA 1QPIA 1IC8A 3CDLA 1MBGA 1RPWA 3ZOBA 4B1RA 1QVTA 2D5VA 2HDDA 1Z77A 3S2DJ 2DA2A 1FTTA 1ZR2A 4D7NA 5C4XJ 2XGDA 2OF7A 4A3IJ 3C2BA 1IG7A 2Y9YA 4AC0A 5M5YJ 3HOUJ 4IEJA 1JKPC 2O8KA 5FLMJ 3QPLA 1H88C 3HGGA 4D5CA 2MW8A 3TP3A 4XK4A 2XPVA 3JRFA 5E3LA 1P7JA 1I3QJ 1OFCX 4D7MA 3W6VA 5IYBJ 1XG1A 2JA6J 2CUFA 2O7OA 3CCYA 3Q0VA 1AKHA 3G1OA 5IYCJ 2M34A 2LFBA 5F08A 3LOCA 2Y31A 5C44J 1ITYA 2DJNA 1LE8A 1JKQC 2X6OA 3SDGA 1GV2A 3VPRA 3OSGA 3SJMA 2R7ZJ 2EH3A 1OJLA 5F27A 4DYQA 5FKMA 1GV5A 4UUTA 1F36A 3ZQCA 1IUFA 5EG0B 2GM4A 5M5XJ 4JX4A 3FK7A 1OCPA 2G0EA 3FIWA 3S1NJ 1W0TA 1MH3A 3GTLJ 2ELKA 3NAUA 1U9NA 2CQQA 4J19A 3F0CA 4CYCA 3QQAA 4XRMA 3LSJA 4MFEA 3HEFA 2ID6A 1U8BA 4JX5A 5J3LA 3HOWJ 3DEWA 2X48A 2M9HA 1Q1VA 4A3EJ 1JKOC 2Y0SN 1HOMA 1UG2A 2NS7A 5HODA 1ETVA 1ETKA 4B3AA 2H8RA 5K7FA 1VF9A 1WCMJ 4FCYA 2DA7A 2MGQA 3BG5A 2M2EA 4DW6A 3LSPA 2EZIA 1Z0XA 2E2IJ 1JT6A 5F04A 3CQZJ 3A01B 3HOZJ 5C4JJ 3IH4A 2IAIA 3RZDJ 4IHYA 3QPSA 2IBDA 1K61A 5FJ8J 2CUEA 3GBGA 2FJ1A 2DA5A 2QCOA 3TW6A 5EGOB 3OSFA 1PUFB 2MG4A 2JN6A 4DYCA 1T56A 3JR9A 2R92J 4IHWA 4UUSB 3ZQLA 4D5FA 2HQ5A 5E3OA 2E2JJ 2VKVA 1W0UA 3HOVJ 1UHSA 2DMQA 3S15J 4I76A 4FE7A 2I10A 5EYRA 3ZQHA 1TWFJ 1HDPA 2LTPA 3H0GJ 1K83J 1FIPA 1IDYA 4QTRA 4M3EA 1OCTC 3HM5A 3BTIA 4XRSA 1A6IA 1T33A 2H1KA 2DA6A 3HOYJ 4A93J 1S7EA 2HI3A 1ZKGA 1XS9A 1HF0A 1BJZA 1U78A 2DTZA 2HOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B72 B;  2R5Z B;  4M3D A;  2EZL A;  4BXX J;  4S0H B;  2NVT J;  1MBF A;  1O4X A;  3E7L A;  1WH7 A;  5C3E J;  3Q0W A;  4A3M J;  3GTJ J;  4JYK A;  3Q3S A;  3ZQI A;  2HXI A;  1TWG J;  4Y7N J;  2X9D A;  2L7F P;  5GP9 A;  2YS9 A;  3FK6 A;  5EF6 A;  1SFO J;  3HGY A;  5DTD A;  1B8I B;  5IP7 J;  2COB A;  4QIW N;  1GVD A;  2DA1 A;  4AUX A;  4MFD A;  1IDZ A;  4EEF G;  4BKX A;  3PO3 J;  5E3N A;  1F43 A;  1ENH A;  2R0Q C;  1E3O C;  4V2G A;  1TWC J;  1WGX A;  3Q0U A;  2AO9 A;  4G12 A;  2EZH A;  3OOU A;  1MBE A;  2DA4 A;  2M0C A;  1RR7 A;  3RKQ A;  1GT0 C;  1YRN B;  1X58 A;  1NTC A;  1X2M A;  1IV6 A;  3FIS A;  2PMZ N;  2WV1 A;  2M8G X;  3BQY A;  2NVQ J;  2WB1 N;  4A3L J;  1FTZ A;  1DU0 A;  2E1O A;  2O9L A;  4Y52 J;  1ETW A;  1LE8 B;  1VI0 A;  2KT0 A;  5J1R A;  2FQ4 A;  3GTQ J;  4M3F A;  4V2F A;  2XPU A;  2CJJ A;  1ORK A;  2AHQ A;  2K9Q A;  1XC5 A;  1MBK A;  5IOY A;  4AYB N;  5K7Z A;  3BR1 A;  5IPA A;  4A3J J;  5FLV A;  4C3H J;  2ZB9 A;  1JUM A;  4C2M J;  5GPC A;  1ZGW A;  1FEX A;  1Y1V J;  2K40 A;  5EG0 A;  3S17 J;  1ETQ A;  3M4O J;  1MSE C;  5M5W J;  3LNQ A;  1U9O A;  1JGG A;  3BR5 A;  4BY1 J;  1TWA J;  1JJ6 C;  3NAR A;  2JMW A;  4IHX A;  5DS9 A;  4ABZ A;  1HDD C;  4NDL A;  2LD5 A;  2FD5 A;  3SFI A;  2HXO A;  2RAE A;  3S1Q J;  1VND A;  3BR2 A;  4A3D J;  4C3I J;  3TW7 A;  2K9N A;  2L0K A;  3WHC A;  3O8G A;  4QSH A;  2XSD C;  1WPK A;  3IH2 A;  4A3C J;  3JRH A;  1HCR A;  1MSF C;  2XB5 A;  4C3J J;  1D5Y A;  1ETO A;  5F0H A;  1AHD P;  3FKI J;  1EF4 A;  3A01 A;  1WH5 A;  2DMP A;  4M3G A;  2JA7 J;  3BR6 A;  1MNM C;  1MBH A;  2R5Y A;  3JRI A;  5EGO A;  4RBO A;  1PUF A;  5BNG A;  1ZQ3 P;  3L1P A;  2EBI A;  4GFB A;  4UUS A;  1HLV A;  4XID A;  2NVY J;  2LP0 A;  1RET A;  3IV5 A;  2JJ7 A;  2DMT A;  3G1L A;  3HKZ N;  4RDU A;  3HDD A;  4JP0 A;  1H89 C;  1SAN A;  2LLK A;  2ME0 A;  1MBJ A;  1UMQ A;  3RQI A;  5K7H A;  1GDT A;  2HOA A;  1JJ8 C;  2VKE A;  4BBS J;  5EEA A;  3MKL A;  5EDN A;  2GLO A;  2VUM J;  2XB0 X;  2OPT A;  1B72 A;  3MN2 A;  4I6Z A;  3GTO J;  2R5Z A;  1G2H A;  2VPR A;  5F1J A;  3LSR A;  4A3B J;  3MVP A;  1IJW C;  3TED A;  3DCF A;  2XGE A;  1JTX A;  5EZG A;  3JRA A;  3BG3 A;  5M3F J;  2DMU A;  1LFB A;  3G1M A;  3PO2 J;  3O8H A;  4HNV A;  4B4C A;  3I4M J;  2ID3 A;  4X1E A;  2DN0 A;  1B8I A;  5J1U A;  1WI3 A;  3OIO A;  4MLO A;  2YUS A;  1IRZ A;  2KDZ A;  1I50 J;  1FIA A;  4L5E A;  4M3B A;  2E2H J;  1AKH B;  1DU6 A;  3A03 A;  4FTH A;  3S16 J;  3BTJ A;  2LY9 A;  5FKN A;  2TCT A;  5J1Y A;  3B6A A;  9ANT A;  5IP9 J;  1ZK8 A;  1YRN A;  2NVX J;  1JT0 A;  4M6V A;  3B6C A;  2VI6 A;  3GTM J;  4MIM A;  2N8G A;  5M3M J;  2LVS A;  1I6H J;  5EZH A;  4JX6 A;  3S1M J;  3K7A J;  3LSG A;  1QVU A;  1R9T J;  2L7Z A;  1NK2 P;  1POG A;  3D1N I;  4IHV A;  1H8A C;  4CYC B;  1JTY A;  3JRB A;  5IYD J;  1ETY A;  1BW6 A;  2B63 J;  2L9R A;  3GTK J;  1BW5 A;  1ZTR A;  1RES A;  2MSY A;  3GTP J;  2Y30 A;  3ZQG A;  3HOX J;  1BA5 A;  4LOC A;  2P81 A;  3HB9 A;  4MO7 A;  1JUP A;  4XIC A;  1LFU P;  3ZQF A;  1A5J A;  3BR3 A;  1P7I A;  5FKK A;  3K2A A;  2JA8 J;  3RZO J;  5GPA A;  5JLX A;  2LKX A;  2R93 J;  5FKL A;  3JRC A;  2CRG A;  2LR8 A;  2LK2 A;  4W97 A;  2ME6 A;  3BTL A;  5F0C A;  1TWH J;  1BL0 A;  2ECC A;  3PM1 A;  2K9S A;  1ZR4 A;  1AU7 A;  3BT9 A;  3JRD A;  2HYJ A;  2JA5 J;  4A3F J;  5IOZ A;  3GTG J;  2L7M P;  3BG9 A;  3S1R J;  1FJL A;  1RKW A;  2QF7 A;  2DMN A;  2XPW A;  2E19 A;  4XRS G;  5IP6 A;  3BTC A;  3TP0 A;  2Y9Z A;  1CQT A;  2IEK A;  5F0F A;  3BQZ A;  2R5Y B;  2YU9 J;  1JKR C;  2EZK A;  3CMY A;  3WHB A;  1GUU A;  1RKT A;  1MH4 A;  4DZP A;  1NK3 P;  1TC3 C;  2GBY A;  3HBL A;  3S14 J;  4BY7 J;  2CU7 A;  4FE4 A;  3IH3 A;  2JK3 A;  4DZJ A;  5JLW A;  3BR0 A;  3UKG A;  2FX0 A;  2HOT A;  4A3K J;  2CQX A;  3A02 A;  2NOG A;  1IGN A;  1ETX A;  4A3G J;  2ECB A;  2WAQ N;  1VFC A;  2JWT A;  1JUS A;  2TRT A;  4W1U A;  4A69 C;  3JRE A;  1Y1W J;  4X6A J;  3S2H J;  4FIS A;  3I4N J;  2XRL A;  2XGC A;  1APL C;  5E3M A;  4DYR A;  4BBR J;  3H3V K;  1X2N A;  3JRG A;  1QRY A;  2W48 A;  3M3Y J;  2DA3 A;  5FKO A;  2NS8 A;  2EQR A;  2Y2Z A;  1QPI A;  1IC8 A;  3CDL A;  1MBG A;  1RPW A;  3ZOB A;  4B1R A;  1QVT A;  2D5V A;  2HDD A;  1Z77 A;  3S2D J;  2DA2 A;  1FTT A;  1ZR2 A;  4D7N A;  5C4X J;  2XGD A;  2OF7 A;  4A3I J;  3C2B A;  1IG7 A;  2Y9Y A;  4AC0 A;  5M5Y J;  3HOU J;  4IEJ A;  1JKP C;  2O8K A;  5FLM J;  3QPL A;  1H88 C;  3HGG A;  4D5C A;  2MW8 A;  3TP3 A;  4XK4 A;  2XPV A;  3JRF A;  5E3L A;  1P7J A;  1I3Q J;  1OFC X;  4D7M A;  3W6V A;  5IYB J;  1XG1 A;  2JA6 J;  2CUF A;  2O7O A;  3CCY A;  3Q0V A;  1AKH A;  3G1O A;  5IYC J;  2M34 A;  2LFB A;  5F08 A;  3LOC A;  2Y31 A;  5C44 J;  1ITY A;  2DJN A;  1LE8 A;  1JKQ C;  2X6O A;  3SDG A;  1GV2 A;  3VPR A;  3OSG A;  3SJM A;  2R7Z J;  2EH3 A;  1OJL A;  5F27 A;  4DYQ A;  5FKM A;  1GV5 A;  4UUT A;  1F36 A;  3ZQC A;  1IUF A;  5EG0 B;  2GM4 A;  5M5X J;  4JX4 A;  3FK7 A;  1OCP A;  2G0E A;  3FIW A;  3S1N J;  1W0T A;  1MH3 A;  3GTL J;  2ELK A;  3NAU A;  1U9N A;  2CQQ A;  4J19 A;  3F0C A;  4CYC A;  3QQA A;  4XRM A;  3LSJ A;  4MFE A;  3HEF A;  2ID6 A;  1U8B A;  4JX5 A;  5J3L A;  3HOW J;  3DEW A;  2X48 A;  2M9H A;  1Q1V A;  4A3E J;  1JKO C;  2Y0S N;  1HOM A;  1UG2 A;  2NS7 A;  5HOD A;  1ETV A;  1ETK A;  4B3A A;  2H8R A;  5K7F A;  1VF9 A;  1WCM J;  4FCY A;  2DA7 A;  2MGQ A;  3BG5 A;  2M2E A;  4DW6 A;  3LSP A;  2EZI A;  1Z0X A;  2E2I J;  1JT6 A;  5F04 A;  3CQZ J;  3A01 B;  3HOZ J;  5C4J J;  3IH4 A;  2IAI A;  3RZD J;  4IHY A;  3QPS A;  2IBD A;  1K61 A;  5FJ8 J;  2CUE A;  3GBG A;  2FJ1 A;  2DA5 A;  2QCO A;  3TW6 A;  5EGO B;  3OSF A;  1PUF B;  2MG4 A;  2JN6 A;  4DYC A;  1T56 A;  3JR9 A;  2R92 J;  4IHW A;  4UUS B;  3ZQL A;  4D5F A;  2HQ5 A;  5E3O A;  2E2J J;  2VKV A;  1W0U A;  3HOV J;  1UHS A;  2DMQ A;  3S15 J;  4I76 A;  4FE7 A;  2I10 A;  5EYR A;  3ZQH A;  1TWF J;  1HDP A;  2LTP A;  3H0G J;  1K83 J;  1FIP A;  1IDY A;  4QTR A;  4M3E A;  1OCT C;  3HM5 A;  3BTI A;  4XRS A;  1A6I A;  1T33 A;  2H1K A;  2DA6 A;  3HOY J;  4A93 J;  1S7E A;  2HI3 A;  1ZKG A;  1XS9 A;  1HF0 A;  1BJZ A;  1U78 A;  2DTZ A;  2HOS A; 
#chains in the Genus database with same CATH topology
 2UUZ A;  1R22 A;  2EZL A;  3E6D A;  5E20 A;  4XL9 A;  2NVT J;  4AIJ A;  2HQN A;  3ESW B;  1MBF A;  1O4X A;  2L7K A;  2V1U A;  4A3M J;  1IRX A;  4JYK A;  3CJT B;  1TWG J;  1WKM A;  1YLF A;  2DQR A;  2X9D A;  1SFO J;  3K70 C;  2KRC A;  1B8I B;  2WAE A;  4CXF A;  3C1D A;  4IQ4 A;  3ZN0 A;  2CQ7 A;  3B02 A;  4M71 A;  1YFH A;  4OWR B;  3V8K A;  3Q9V A;  4ZJZ A;  1FMV A;  2BY2 A;  1OLT A;  5D5V B;  4WX9 A;  1F43 A;  2K4J A;  2VXZ A;  3WTV C;  3CCE I;  3OS2 A;  5F1R A;  2FNP A;  1TWC J;  3RPQ A;  2LF7 A;  3CCQ I;  5LEK A;  4G12 A;  4HW0 A;  2RDP A;  4IKF A;  3HOT A;  1PUE E;  2LH9 A;  2M0C A;  1GT0 C;  3ZRG A;  2Q2E B;  1YRN B;  2AXL A;  3OYB A;  3DEE A;  5L3G A;  2M8G X;  3BQY A;  3SZP A;  2WB1 N;  3OYA A;  4EQQ A;  1FTZ A;  1T38 A;  2M45 A;  2E1O A;  4Y52 J;  1T39 A;  1LPQ A;  4CH7 A;  4N4N B;  1ONV A;  2F4O B;  4M3F A;  2XPU A;  2AQF A;  3W3C A;  4ENN A;  3D5S C;  4HDV A;  1MBK A;  1V3F A;  3PNT A;  4UB8 C;  5IOY A;  5K7Z A;  5D8K B;  2IA2 A;  4XKC A;  2MYS A;  4A3J J;  2ZB9 A;  1JUM A;  4M6Y A;  1HC8 A;  2V7F A;  2E5Z A;  2EA2 A;  3DU5 A;  1U5T B;  3ECO A;  1MSE C;  1TP4 A;  3SYT A;  1JGG A;  4ZH4 F;  4E7H A;  1QBJ A;  2Y0S A;  2OA4 A;  5FRN A;  2QQ8 A;  1HXD A;  1OR7 A;  3A0H C;  1HDD C;  4NDL A;  2ACJ A;  2LD5 A;  2Z99 A;  2FD5 A;  3SFI A;  5CPR B;  2RAE A;  4LIU A;  1R00 A;  1I6X A;  3DWL E;  2A3S A;  2K9N A;  2F5C A;  4CUG A;  3HSR A;  1WZ2 A;  2DCE A;  3CUQ B;  4QSH A;  3PQJ A;  3IH2 A;  3RPU A;  1FZP B;  3EUH A;  2A5Y B;  4A3C J;  1FX7 A;  3J7Z I;  1YIO A;  3JRH A;  3M1E A;  1XGN A;  2VQC A;  5E1W A;  4C3J J;  3ZP5 A;  2CW7 A;  5F0H A;  4PJM A;  4ASN A;  2V9K A;  4HV6 A;  2F48 A;  3FKI J;  2MH9 A;  3G2B A;  1EF4 A;  3A01 A;  4IPA A;  2XDV A;  3ML6 A;  3TMO A;  1IV8 A;  1X3Z B;  2L54 A;  4DOZ A;  3M07 A;  4ZTJ A;  3WOD F;  2R5Y A;  3WGG A;  3IKV A;  2RVC A;  5EGO A;  3L1P A;  3V42 A;  2LP0 A;  2XAF A;  4E4H A;  4B47 A;  2JJ7 A;  1DGR M;  5IT3 A;  2PBI A;  3M7G A;  4J01 A;  3HKZ N;  3PIP F;  3H3U A;  1X4P A;  1GXP A;  4QLC U;  2Q1Z B;  1KZH A;  2ZJQ F;  4EJW A;  3T5X A;  3IRR A;  4F3Q A;  1GDT A;  4KMU X;  4CO8 A;  1JJ8 C;  3MEX A;  3K70 D;  3E97 A;  2P7C B;  5EDN A;  4FX0 A;  1B72 A;  4I6Z A;  5E1Z B;  2CS3 A;  3IAS 2;  2VPR A;  5H6R A;  5ILS A;  5F1J A;  5GTH C;  1IF1 A;  4UVB A;  4A3B J;  1IJW C;  2E1C A;  2M8E A;  4HG2 A;  3TED A;  3WTT C;  4ITV A;  3TGN A;  3L2U A;  2NNY A;  2DMU A;  2XAH A;  2R7D A;  1IN8 A;  2E1N A;  2K85 A;  2XVC A;  3FXL A;  2ID3 A;  4X1E A;  4TV7 A;  3CMA I;  4EM0 B;  4ETS A;  4N9H A;  5AIP A;  3DQV C;  5D5U B;  2H6B A;  2L2O A;  4IOA F;  2HR3 A;  4OAY A;  4CZZ A;  5LHH A;  1WJA A;  2ZBK A;  2YUS A;  2MLG A;  2KFD A;  4G6T B;  4L5E A;  4AVZ A;  1MMA A;  1OIS A;  3KP3 A;  3C3W A;  2DFE A;  3VOD A;  1R4N B;  1DU6 A;  4M6X A;  4F7Z A;  2CQN A;  3NQO A;  2P5K A;  2KIS A;  2L3D A;  5GAH J;  4OAZ A;  5LGT A;  3B6A A;  3HPG A;  4PCQ A;  1G59 A;  2E5N A;  3CCJ I;  1JT0 A;  4O6J A;  2HOE A;  1ZHF A;  2L01 A;  4AWX B;  2PI0 A;  1LKX A;  4BAY A;  2F2E A;  2HPM A;  5FLX K;  2LVS A;  5A2Q Z;  5EZH A;  2F5F A;  2VON A;  2BYV E;  2KIU A;  4JX6 A;  2R7O A;  5CYV A;  4XQF A;  3K7A J;  3J81 Z;  2VBW A;  2GIZ A;  1Q1H A;  1H8A C;  1IXR C;  3WTY C;  4CYC B;  2ICW G;  5B1A H;  1JTY A;  3OR1 C;  2BE5 F;  1ZTR A;  1DP7 P;  2Z9O A;  4Y17 A;  4BE0 A;  2Y30 A;  3ZQG A;  3F8N A;  2EK5 A;  4NNJ A;  2IXS A;  4MO7 A;  4WF2 A;  1JUP A;  3AFH A;  2W1O A;  3KP4 A;  4ENK A;  1LFU P;  4BE1 A;  4A0Z A;  3FM3 A;  3FXQ A;  5H2F C;  5DUI A;  3S32 A;  3ZQF A;  4IXA A;  1A5J A;  1P7I A;  5FKK A;  3K2A A;  2ETH A;  3RZO J;  4Z6Y A;  1P9Q C;  3ZMU A;  1YJ9 I;  2R93 J;  1CGP A;  4I0B A;  4W97 A;  2P8T A;  3ASN H;  4AM3 A;  4LJZ F;  3FF5 A;  3H3Z A;  3KLN A;  1D0Z A;  1TTY A;  3QOD A;  3F9K A;  2F5E A;  3PM1 A;  2EIL H;  2DOA A;  5DCM A;  2M1B A;  4CCJ A;  4A5N A;  3GTG J;  2L7M P;  3BG9 A;  4WCG A;  2GXG A;  2OBP A;  4FQG A;  2ZFU A;  2XPW A;  4LD5 A;  2K3F A;  4JK1 X;  2Y9Z A;  4F55 A;  1FSH A;  3U1D A;  1QHH D;  2ESN A;  3CJN A;  1DPR A;  4OIP F;  2YU9 J;  3MWM A;  2EZK A;  2OU2 A;  1RKT A;  4DZP A;  1UG0 A;  2HZD A;  2GBY A;  5LHI A;  4M9Z A;  1MDM A;  1KYW A;  4LGW A;  4FE4 A;  4DZJ A;  2EFN A;  5JLW A;  3UKG A;  3L9F A;  2FX0 A;  1VZ0 A;  2EJR A;  1O7L A;  1XMX A;  2A6E F;  5FRO A;  4BEH A;  1RZ4 A;  4OMY A;  2RNG A;  2DPD A;  2CFX A;  5CVU A;  2TRT A;  4W1U A;  3JRE A;  3I4N J;  2GA1 A;  1APL C;  1YE9 A;  5E3M A;  2R7W A;  3GW2 A;  3H3V K;  3JRG A;  1B9N A;  4MEX F;  2IGN A;  2J5P A;  2Y2Z A;  2XKO A;  4ZDO A;  3T0Y A;  3G3Z A;  3EYI A;  2PG4 A;  5LGN A;  4UHT A;  1LDK B;  3FHZ A;  4L9J A;  4L5J A;  3L09 A;  3S2D J;  4LG0 B;  3R61 A;  3QYE A;  4A3I J;  1JXS A;  2LOO A;  1U2W A;  5BPI A;  3WG9 A;  2O8K A;  4RLF A;  3F8M A;  1V54 H;  4I7H A;  1Z6R A;  4KN7 X;  5E8G A;  4A2U A;  1XD7 A;  4XK4 A;  2QGU A;  4EM2 A;  5E3L A;  4A5M A;  3G73 A;  2GXA A;  2P5V A;  2R7R A;  4EM1 A;  2CUF A;  2K3P A;  5LRR A;  4HQE A;  3G1O A;  3GO5 A;  4P9F A;  2E7X A;  2MA3 A;  2IJL A;  1T08 B;  3L2W A;  1GXQ A;  1TW2 A;  2HVS A;  3QU3 A;  5TJJ A;  4PJN A;  1VTN C;  5E18 F;  2X85 A;  1X1D A;  3TBI A;  4DYQ A;  2A6T A;  3RIR A;  3AL0 C;  3J7A O;  2FQ3 A;  1YOV B;  4BH9 A;  2ZKZ A;  2OC6 A;  2R7F A;  5M5X J;  3FK7 A;  1R36 A;  1WI9 A;  1TZL A;  1MH3 A;  4E7S A;  2DBB A;  3GYH X;  1HW1 A;  1U9N A;  2CQQ A;  2HTS A;  4Y3O A;  2KPM A;  4J19 A;  4EGY A;  4XRM A;  3LSJ A;  3MCZ A;  3S2W A;  3HEF A;  2ID6 A;  2V1N A;  3ZN1 A;  2VQG A;  2X48 A;  3DPT A;  2V4J C;  2X4H A;  1ERD A;  2HVQ A;  1YQA A;  2BVL A;  4CSW A;  5FGM A;  3V4G A;  5ED4 A;  2KRF A;  4KYW A;  2O5R A;  3OV8 A;  4Y15 A;  2HDC A;  1ETV A;  4BXU A;  1KQ9 A;  3P5J A;  1DUX C;  2Y0M A;  1FOY A;  5KAI C;  1T98 A;  1E2X A;  1HBX G;  2GZW A;  2NNN A;  4E6K G;  2VC1 A;  3KX2 A;  3OYJ A;  1LDD A;  3KEO A;  1OCO H;  3GXO A;  2E2I J;  2ZME A;  1STZ A;  3IH4 A;  4DGW B;  5FO5 A;  4IHY A;  2IBD A;  5JHU A;  2QEX I;  1HA8 A;  4A6E A;  3LA3 A;  3ABM H;  2FJ1 A;  1AOY A;  5E1X A;  2ZNY A;  2FNA A;  2K9M A;  4BE2 A;  1IN4 A;  3M1C A;  4ESB A;  2QCO A;  1PUF B;  2QKM B;  2HZT A;  4AU7 A;  2JN6 A;  2KL4 A;  2E34 A;  1YHQ I;  4BS9 A;  4YRV A;  3OS0 A;  3CCM I;  2CV0 A;  1U8R A;  1ZG1 A;  5L3E A;  3T8R A;  2HQ5 A;  4HBL A;  3WTS C;  3HOS A;  1M1E B;  1KA8 A;  2E2J J;  1YX5 A;  1XCB A;  2VKV A;  2WA0 A;  5HLI A;  1W0U A;  4FHT A;  4I76 A;  5DM6 F;  3RKX A;  2DDA A;  4RM3 A;  2R7S A;  2O6G E;  3ZQH A;  1TWF J;  1HDP A;  4RAZ A;  3P9C A;  1R71 A;  3J80 Z;  1V4R A;  2EWN A;  3I3L A;  2KJB A;  1K83 J;  1REP C;  5KK1 A;  4M3E A;  1BR2 A;  2VB6 A;  3HM5 A;  5ICG A;  5DUK A;  5FFZ A;  1A6I A;  1T33 A;  2DA6 A;  3HUG A;  1S7E A;  1SAU A;  2HI3 A;  3X2Q H;  1XGO A;  2RGV A;  1WJB A;  3DPL C;  5TGT A;  2Z5U A;  1YJW I;  2DTZ A;  1GVJ A;  4IHT A;  2HPI A;  4KDP A;  2M4G A;  2R5Z B;  4BXX J;  3VYU B;  1OR7 C;  4S0H B;  1WH7 A;  5C3E J;  2PJR A;  3F8F A;  4PFP A;  2RC4 A;  5LRS A;  4H0E A;  3Q5F A;  3Q3S A;  3ZQI A;  2LY2 A;  2M4K A;  1G3T A;  3LSH A;  4RMN A;  2L7F P;  5GP9 A;  1W4M A;  3FK6 A;  2W24 A;  3H5A A;  4RAF A;  3HGY A;  3ZMD A;  5DTD A;  5EF6 A;  3LA7 A;  1ZAO A;  2KIF A;  5IP7 J;  4QIW N;  3L00 A;  2RNJ A;  1GVD A;  2YSR A;  4AUX A;  3CC2 I;  2CO5 A;  4G9Y A;  5A2Q K;  4BUP A;  5L3B A;  3I59 B;  3EUH C;  5JR3 A;  3L2R A;  3ZMT A;  2R0Q C;  2XUB A;  4GYG A;  3J81 K;  3T8T A;  2LRE A;  5J4Y A;  1K4S A;  2EZH A;  2DTR A;  4XKB A;  4ZC3 A;  1MBE A;  3COA C;  2RKH A;  3W2V A;  3EUA A;  4ZYE A;  1X58 A;  4LLN A;  3IWZ A;  3SZG A;  3K4J A;  3FIS A;  1UHM A;  2WV1 A;  2O03 A;  2NVQ J;  4A3L J;  1DU0 A;  3BCB A;  4LLG F;  2O9L A;  3BJO A;  3CDI A;  4RA2 A;  4PJ0 C;  1S7O A;  2AHQ A;  4IHS A;  4AYB N;  2VKD A;  5CJ9 A;  5IPA A;  5FLV A;  3D0S A;  5GPC A;  3PIO F;  3BC8 A;  3G4S I;  1FEX A;  1FSE A;  3H0D A;  1Y1V J;  1ZGA A;  4KT5 C;  3S17 J;  2R7U A;  5FFX A;  2K4B A;  4XLE A;  4PSX A;  1YW9 A;  3I71 A;  2DOD A;  2RN7 A;  1IN6 A;  2HWV A;  5B3S H;  2JMW A;  5DS9 A;  4ABZ A;  2LC2 A;  3TDZ C;  2W84 A;  4XLP F;  3I4P A;  4XNF A;  1VND A;  4C2U A;  3BR2 A;  4DIQ A;  3O8G A;  3FDY A;  3AG4 H;  2FBI A;  1E17 A;  3M8J A;  4A6D A;  4G8X A;  3ZMV A;  3QAH A;  1Y0N A;  1LVK A;  1JHH A;  1HCR A;  4P1W A;  4KJZ A;  3JSP A;  1QO0 D;  1MSF C;  3HC7 A;  4N9I A;  1ETO A;  1Y6I A;  2XV4 S;  4RGR A;  3EQL F;  2K5C A;  5L3F A;  3L2Q A;  1BC8 C;  4Y4R A;  5KNL A;  5HS9 A;  4I01 A;  2OD5 A;  3HIF A;  3HXL A;  3OIP A;  5HLT A;  5J8F A;  1XX5 A;  2B9S A;  2LSO A;  3A4C A;  3S3M A;  3CO6 C;  2YPR A;  4XMY A;  3K2Z A;  4GGG A;  3IHU A;  1K4T A;  3LMM A;  5FD5 A;  2QBY A;  4RBO A;  2CV2 A;  5BNG A;  2K27 A;  3VWB A;  1XSV A;  1HST A;  2EBI A;  3CCL I;  4L18 B;  4CCL A;  4XLC A;  2HFH A;  4U88 A;  1OCC H;  1N77 A;  1XB4 A;  4L0Z B;  2VOP A;  3HTS B;  3AL0 B;  1ZG5 A;  2Q0O A;  2QQ9 A;  2ESH A;  2VXD A;  5ILV A;  4A12 A;  1A36 A;  3K1N A;  3H9J A;  2LLK A;  1N75 A;  3E0J B;  4KFC A;  3EUK L;  1SD5 A;  3HZJ A;  2EIN H;  2DPU A;  1KU2 A;  1UMQ A;  2VT3 A;  3GLX A;  5K7H A;  4BJT A;  4E7K A;  3FXO A;  1WJD A;  2ZSI B;  4A0Y A;  4E70 A;  4BBS J;  4UVC A;  2BHZ A;  3MZ8 A;  5BOX A;  4L0Y B;  3MKL A;  1B9M A;  2CW8 A;  1G2H A;  1G3S A;  1SFK A;  1R5I D;  1O57 A;  2WC2 A;  3KP2 A;  1FYK A;  1PYV A;  5FD6 A;  1GLN A;  3MVP A;  3LSR A;  5CVI A;  3DCF A;  5HLH A;  4XN0 A;  3P7N A;  2NVU B;  1LFB A;  3F3X A;  1Z21 A;  5KVR A;  1SMY F;  2QQB A;  2KZV A;  1VQL I;  3I4M J;  4E7I A;  1B8I A;  2DW4 A;  2ELJ A;  1NG6 A;  3F8B A;  4U0Y A;  2VBX A;  1IRZ A;  2KDZ A;  1FIA A;  3FHN A;  3GWZ A;  2H94 A;  3DBL B;  3H5N A;  2LRD A;  2WB1 A;  3QOE A;  3ZCO A;  4BYY A;  3ONQ A;  3D5R C;  4P9U A;  4MGR A;  3WGH A;  3BTJ A;  2LY9 A;  2ISZ A;  5J1Y A;  4XOT A;  5BS6 A;  3DP7 A;  2E35 A;  9ANT A;  4B3X A;  5IP9 J;  1K6O A;  2Q2E A;  2JZY A;  3WTX C;  1YRN A;  2AS5 F;  3LST A;  4EMS A;  4IOC F;  3B6C A;  2VI6 A;  1WJC A;  3H9G A;  3I5U A;  1OYI A;  1LEB A;  2N8G A;  4ZDL A;  5J47 A;  4HPQ A;  4FT8 A;  3FXR A;  4AID A;  1MNE A;  2Y48 A;  2XIG A;  3S1M J;  1V5G A;  1QVU A;  2E1M C;  2BEO A;  3I64 A;  1R9T J;  1P4W A;  4XKW A;  2L7Z A;  4I98 B;  5D4R A;  1POG A;  1P92 A;  1D1A A;  4PGG A;  1NK2 P;  4HF2 A;  4U7B A;  4X0G A;  3OMY A;  4PDK A;  1KU7 A;  2BVM A;  3E6C C;  1ETY A;  3GFL A;  1X19 A;  5LHG A;  5HOO A;  3RQ4 A;  3LAP A;  1RES A;  3GTP J;  5J4V A;  2OQR A;  3HOX J;  1UAA A;  3KP6 A;  1BA5 A;  4LLL A;  2GXB A;  2M3A A;  3R0J A;  2XSJ C;  3UR3 C;  4G7H F;  3CES A;  1XMA A;  2HVR A;  3OYL A;  1YS7 A;  3O3K A;  1Y0U A;  2XHK A;  3BR3 A;  3H1C A;  4Y13 A;  3ZMS A;  4IRG A;  1RI7 A;  2EV5 A;  3O2P E;  2JA8 J;  5JLX A;  5B1B H;  2LKX A;  2KHM A;  4KIF A;  5LBQ A;  5FKL A;  4QPO A;  1TQM A;  2LR8 A;  1YX3 A;  2F5D A;  4E7Z A;  1UFM A;  2H1L A;  2VN2 A;  4UXN A;  2Q8K A;  4S04 A;  5HVQ C;  3CUQ A;  1K78 B;  1J9I A;  1T0F C;  2XF6 A;  1TQP A;  2JA5 J;  4A3F J;  5IOZ A;  2BW3 A;  1VQ6 I;  3J80 K;  3P9K A;  1XTA A;  1MJA A;  2DYS H;  1FOW A;  1RKW A;  2QF7 A;  2E19 A;  4RGU A;  2HKO A;  3LAJ A;  4XRS G;  5IP6 A;  3BTC A;  3V7C A;  4NQW A;  5L3C A;  1CQT A;  2IEK A;  2R5Y B;  4GXO A;  3DV8 A;  2VBY A;  2VIX A;  3HKZ A;  3OY9 A;  3LWF A;  2FOK A;  4HEA 2;  2A07 F;  2VJ4 A;  1K7A A;  1TC3 C;  3U2R A;  4PFO A;  4BY7 J;  2BGC A;  1EA3 A;  4ZYA A;  3IH3 A;  2HS5 A;  1GHC A;  4A3K J;  2EFO A;  3A02 A;  1IGN A;  1ETX A;  3MKZ A;  1ZGJ A;  3FBI B;  2V9P A;  1WJE A;  2L9N A;  3MD2 A;  1D3Y A;  4OU0 A;  1R1V A;  4IRH A;  3OYD A;  4IF4 A;  4UV9 A;  3WTZ A;  1XSD A;  1FP1 D;  4S05 A;  4FIS A;  3H36 A;  2DO7 A;  4BHP A;  4DYR A;  1VQ7 I;  1QRY A;  2W48 A;  3ZQ7 A;  2W82 A;  2X6X A;  2YR2 A;  3E1S A;  3GZ5 A;  3G6E I;  1QPI A;  2Y75 A;  3BP8 A;  1UHW A;  3CDL A;  1TBX A;  1X1P A;  3REO A;  5BPD A;  3BG7 A;  4RAG A;  4I2O A;  2MAB A;  2V1X A;  2OQG A;  5KCM A;  1BN5 A;  2VPL A;  3K69 A;  3GUD A;  4AC0 A;  5D6F A;  1HW5 A;  3TO9 A;  5M5Y J;  1HSJ A;  3PNY A;  5FLM J;  3IAM 2;  3QPL A;  1T8I A;  1R5H A;  2ZME C;  2P5L C;  1ZEL A;  4BAC A;  3OYK A;  3DEU A;  2CUZ A;  3HGG A;  2MW8 A;  2XPV A;  2E7W A;  4XLH A;  3PFI A;  3ZMZ A;  5IYB J;  2EFW A;  2DOE A;  1BIA A;  3KZI C;  1ZAR A;  3N05 A;  2JT1 A;  2XAQ A;  5F08 A;  3LOC A;  4B43 A;  3CZ6 A;  1V5F A;  2DJN A;  2R4G A;  1LE8 A;  1D5V A;  3CTA A;  3SDG A;  3UNG C;  1FP2 A;  1G6N A;  3IWF A;  2W57 A;  4G94 A;  2QUF A;  1OJL A;  4FX4 A;  1VQ9 I;  1B6A A;  4PSW A;  2M30 A;  4UUT A;  4CCK A;  5HS8 A;  4P96 A;  4IX7 A;  3ZQC A;  1DQU A;  5EG0 B;  2GM4 A;  2IA0 A;  5EJC A;  1KGS A;  2JPC A;  5H20 A;  3FIW A;  4A0X A;  1A35 A;  3GTL J;  1NHA A;  3SHF A;  1ON2 A;  2MLK A;  4CYC A;  1DPU A;  3FM5 A;  3ZXS A;  3ABK H;  3HRS A;  2P0W A;  3OYE A;  1YI2 I;  2V1D A;  3TO6 A;  3FBN B;  4HDU A;  3V7S A;  2M9H A;  3MKY B;  3S3N A;  4BJ5 C;  4C2T A;  4A3E J;  2EFP A;  4V19 K;  5HOD A;  3L2V A;  4B3A A;  3S8P A;  3TKY A;  1WCM J;  4EJV A;  2PN6 A;  3VEP A;  3HYI A;  2CV1 A;  2PQ8 A;  5GAD J;  1JE8 A;  1F5T A;  2MGQ A;  2ZFW A;  1EV7 A;  2DFF A;  2EZI A;  3DXJ F;  1Z0X A;  1YIT I;  1WJ5 A;  2O8X A;  5F04 A;  2ISY A;  4KNY A;  3NEU A;  3HOZ J;  2P6T A;  1LNW A;  2FOW A;  2NS0 A;  4OIR F;  2RV8 A;  2XC7 A;  2CUE A;  3GBG A;  2EV0 A;  3QP5 A;  2VBZ A;  3BLY A;  4OIN F;  1WSU A;  4ESF A;  3MMY B;  1IN7 A;  3OSF A;  4L5I A;  3M9A A;  1T56 A;  1Z3X A;  5GTI C;  4IHW A;  3V7R A;  4UUS B;  3ABL H;  3ZQL A;  4D5F A;  1JI8 A;  3QYB A;  3L7W A;  1XSX A;  1YS6 A;  3HPH A;  3QPH A;  4WXH A;  1W36 C;  4UUV A;  5HDN A;  3HOV J;  1E3O C;  1KU9 A;  1UHS A;  2DMQ A;  3R4K A;  1XDS A;  2HQR A;  3S15 J;  4XLA A;  5EYR A;  3F23 A;  2E1M B;  2ZCW A;  4J00 A;  1FC3 A;  1D0X A;  3LQR A;  4MTE A;  2LTP A;  2R3S A;  2P7V B;  4OIQ F;  2CWE A;  1H9G A;  2IGK A;  2KLO A;  4M72 A;  3WU1 B;  3DPU A;  2BY3 A;  3BJ6 A;  2LKS A;  4Q47 A;  2H1K A;  2VKH A;  1WRJ A;  3PFY A;  4HX8 A;  3KIO A;  1FY7 A;  2CH0 A;  4XLN F;  1RUO A;  2Z16 A;  3I9V 2;  1U78 A;  3ZQQ A;  4BQO A;  4BHC A;  1U6G A;  3KYC B;  2VOO A;  1IRF A;  4F52 A;  5IY5 H;  2G7U A;  3FXK A;  4K2E A;  2QKL B;  3PUB A;  2NYX A;  3SDB A;  3WGI A;  1OCR H;  2PLY A;  5IT9 Z;  4RB0 A;  1A6Q A;  3Q0W A;  4PZJ A;  2JUC A;  1WVR A;  2DYR H;  4Y7N J;  2YS9 A;  3BZK A;  3IRQ A;  1MW7 A;  2HEO A;  3DTK A;  5F6F A;  2DA1 A;  3QWL A;  4MFD A;  3PNV A;  1CF7 B;  3HJE A;  4EEF G;  1FLI A;  3PO3 J;  5E3N A;  3DTE A;  4MHG A;  4XKV A;  3DKW A;  1ENH A;  4LG0 A;  1F9N A;  4ZZL A;  1FYL A;  3Q0U A;  2AO9 A;  1ZLK A;  4G6D A;  2PJP A;  2HQA A;  3OOU A;  2DA4 A;  3RKQ A;  5ERI A;  3CUO A;  4Z2Y A;  2JRM A;  5D5X B;  2PMZ A;  1X2M A;  1IV6 A;  5B5E C;  1D8K A;  2BHY A;  2FML A;  2PMZ N;  3T1B A;  1QHG A;  3JCU C;  1SVL A;  4IL6 C;  1ACI A;  2JA2 A;  4BU2 A;  4ZYD A;  1F1Z A;  1PVE A;  4UV8 A;  1VI0 A;  4D0P A;  3GTQ J;  5GAE J;  1SD6 A;  2CJJ A;  3DU6 A;  2K9Q A;  1Y8Q B;  2LY1 A;  1LVA A;  2ZXW H;  5CQG A;  5ICC A;  2M0M A;  3DF8 A;  2PEX A;  3DLA A;  3FX3 A;  4C3H J;  1MGT A;  1RNL A;  1Z67 A;  1ZGW A;  1TNT A;  2K40 A;  2ZXJ A;  3R60 A;  4XLF A;  4B48 A;  2ZJP F;  1NH3 A;  1SD4 A;  2G7H A;  1OCZ H;  3FXM A;  1ULY A;  2OZU A;  2JSP A;  1U0J A;  2LBF B;  1U9O A;  4D1Q A;  4BY1 J;  1TWA J;  3TQN A;  4CYD A;  3FMS A;  3CJR B;  3NAR A;  1N25 A;  2Z33 A;  3K0L A;  4LIV A;  2KZG A;  4WK8 F;  2H09 A;  2QSH X;  4O3M A;  4C30 A;  2IS2 A;  1Z3Y A;  2V9V A;  1PP7 U;  2IP2 A;  2K86 A;  3KFW X;  4ZYH A;  2HXO A;  4JBA A;  1FBS A;  1FT9 A;  1J75 A;  3ZGK A;  3TW7 A;  3WHC A;  1Y39 A;  3PL8 A;  4Q48 A;  1BJA A;  3QYF A;  1WPK A;  2ELH A;  1QA6 A;  1I39 A;  1FMW A;  3ROU A;  1DDN A;  3GVA A;  4NC8 A;  2ZME B;  1AHD P;  3BZC A;  4KA4 A;  2D45 A;  2XRO A;  1RRJ A;  1W36 D;  1WH5 A;  1HW2 A;  4DJA A;  3K4L A;  1BR1 A;  2BXY A;  2JA7 J;  3BR6 A;  3IKT A;  1MBH A;  1BI2 A;  1BI3 A;  1XGM A;  5HNH A;  5LEJ A;  1O3Q A;  3HRU A;  3LSK A;  2H6C A;  1PUF A;  3MZH A;  1OMI A;  1PDN C;  1H9T A;  3GME A;  3OWT A;  3GZ6 A;  1HLV A;  2NVY J;  1RET A;  3IV5 A;  5DYM A;  4KIB A;  2DMT A;  4RLQ A;  5E17 F;  3G1L A;  4RDU A;  3HDD A;  4JP0 A;  3BZ6 A;  2FXA A;  4LG3 A;  4DQ2 A;  1SAN A;  3KP5 A;  2P4W A;  3WG7 H;  2VAS A;  3W6J B;  4YFX F;  1FOX A;  2B7E A;  2GOX B;  3QP6 A;  3S93 A;  5D4S A;  3E5X A;  4ESJ A;  5J6X A;  2HOA A;  1SMT A;  1W7P D;  3HTU A;  3SXY A;  3Q9S A;  2UWM A;  1RR8 C;  3HG9 A;  2GLO A;  1HQC A;  2VUM J;  3VDX A;  2BV6 A;  3GTO J;  3MN2 A;  5D5W B;  3VSL A;  1L0O C;  2R5Z A;  1Z7L A;  2R7X A;  2XAJ A;  4ZTF A;  3C18 A;  1I1S A;  3WE3 A;  3ERE D;  1SVM A;  3KPH A;  4UB6 C;  4LIT A;  1ZG3 A;  2XGE A;  2MC3 A;  5EZG A;  3JRA A;  3BG3 A;  2XF7 A;  3G1M A;  2DT5 A;  4CCM A;  3F6V A;  4NHJ A;  1BOB A;  3E5U A;  4HNV A;  4KIG A;  4I02 A;  2DN0 A;  3LA2 A;  5J1U A;  4YEJ A;  3QOP A;  3OIO A;  2CMP A;  4MLO A;  5FRM A;  3I59 A;  1OYW A;  2FU4 A;  4M3B A;  2CUJ A;  3GFJ A;  3DKY A;  2MBF A;  2IVM A;  2E2H J;  2K9L A;  1AKH B;  4M9S A;  4BQN A;  3DKX A;  5HDK A;  4FTH A;  3QRF F;  2STT A;  2LF8 A;  3S16 J;  3SEQ A;  1DP3 A;  5F64 A;  2KMU A;  1J09 A;  1ZK8 A;  4CHU A;  2M5W A;  4M6V A;  4AYB A;  5K5O A;  2JRT A;  3GTM J;  2IS4 A;  3OYM A;  4MIM A;  3IL2 A;  3PJR A;  1I6H J;  1T95 A;  1SVO A;  3HRM A;  3RKW A;  4HRI A;  3EDP A;  1S29 A;  2CFO A;  4NC7 A;  2DU9 A;  4MEY F;  3JTG A;  2QA4 I;  3D1N I;  1TT0 A;  2RQQ A;  2WV0 A;  4IHV A;  3BRO A;  1T6S A;  2VL8 A;  3GX4 X;  3BY6 A;  3ERM A;  1ZYR F;  3K1P A;  5IYD J;  3FWE A;  2L9R A;  1BW5 A;  2QSF X;  2MSY A;  4QWQ A;  1S6L A;  2K7L A;  3F21 A;  2PFB A;  2XRN A;  1ZLJ A;  3AG1 H;  2MD5 A;  4XIC A;  3WTU C;  2IPQ X;  1MKM A;  1UB9 A;  1J5Y A;  3OIQ A;  4IRI A;  2X6Y A;  4M9X A;  3OOP A;  2V6E A;  5DV5 A;  4HV5 A;  5JFR A;  1W7P B;  2M87 A;  4PUS A;  3M8E A;  3K4B A;  2XKP A;  2R7Q A;  1S8N A;  1BOA A;  2CRG A;  2OTJ I;  1N78 A;  1YW7 A;  2WBM A;  1TT5 B;  2YX4 A;  3BTL A;  2ME6 A;  1TWH J;  2GA2 A;  3J7A Y;  3KCC A;  1SFE A;  2ECC A;  5HDG A;  1AU7 A;  3BT9 A;  3JRD A;  4L9V A;  3FMR A;  2X51 A;  4GCV A;  5CVV A;  3S1R J;  1FJL A;  2VJJ A;  2K02 A;  4HST A;  2YX7 A;  3I58 A;  5KAF C;  5EEG A;  1DGW Y;  2KIM A;  3KEQ A;  3TDU C;  4D9J A;  2WAF A;  2YU3 A;  4HZF A;  3CMY A;  5ICF A;  3H5R A;  1D1B A;  4OMZ A;  1X1C A;  1QQI A;  2XAG A;  4ENJ A;  4BL0 B;  2A69 F;  1ZN2 A;  5IT9 K;  5CKT A;  2J5O A;  3BR0 A;  5FB2 A;  1Z9C A;  4PGH A;  1Z91 A;  3SEZ A;  1HKS A;  3L2C A;  2CQX A;  1TLH B;  2QZ8 A;  2BBY A;  4XN3 A;  4KUM A;  5DM7 F;  2WAQ A;  1KON A;  1O3R A;  2ZXH A;  2IT0 A;  2WAQ N;  2JWT A;  3TOB A;  3OYG A;  1G3Y A;  2V26 A;  1JUS A;  3LFU A;  3LQQ A;  3FXU A;  4I09 A;  2IA1 A;  1Y1W J;  3RPU D;  4HX4 A;  1LB2 A;  4XOP A;  2WY7 Q;  4KT6 A;  3VB2 A;  3AKZ A;  4EJT A;  1E3P A;  2DFH A;  3J7Y J;  4JQF A;  2EA4 A;  1Z05 A;  2DA3 A;  5FKO A;  1X3W B;  3IUO A;  3K6G A;  2QSG X;  2JVH A;  5LD2 C;  3RYR A;  2NXN B;  2HDD A;  4EV0 A;  2KJC A;  2OCC H;  2OZ6 A;  1Z77 A;  2WY8 Q;  3PUF A;  2D2W A;  1AWC A;  2ADU A;  5LGU A;  2DA2 A;  1FTT A;  1ZR2 A;  1G8X A;  1QZY A;  4ZZD A;  2HNH A;  1FPQ A;  3C2B A;  3H92 A;  4YFN F;  5CVJ A;  2Y9Y A;  4HAM A;  4IEJ A;  2WWY A;  1USS A;  1EH6 A;  3I0T A;  1XMK A;  5AIQ A;  3B73 A;  4LMY A;  4GRI A;  2MFZ A;  3TP3 A;  3CLQ A;  4D5C A;  1BC7 C;  2JSC A;  2VC0 A;  4MQ9 F;  1P7J A;  1I3Q J;  3GFM A;  3WE2 A;  4N0B A;  4E7J A;  2EIM H;  2JA6 J;  1MMN A;  5DDG A;  3ABT A;  2O7O A;  3CCY A;  3GF2 A;  4NB5 A;  1XDU A;  3D5L A;  3ZR8 X;  3OYC A;  3ZPL A;  2Y31 A;  2PX9 A;  4B44 A;  3GFI A;  2W25 A;  1A31 A;  1QU3 A;  1GV2 A;  4U0W A;  3SJM A;  5F27 A;  2RRE A;  5FKM A;  1P4X A;  1U3E M;  1GV5 A;  1LFP A;  1IUF A;  2X6W A;  1FNN A;  1R4M B;  2G0E A;  4IQJ A;  3DLL F;  3CCR I;  1O3S A;  4YG2 F;  1U5T A;  2KRH A;  4OOI A;  4AIH A;  3NAU A;  3BPV A;  5TIS C;  3F0C A;  3QQA A;  1WWX A;  3ASO H;  5D8L B;  3PSF A;  4JX5 A;  5J3L A;  1FYM A;  1TW3 A;  3R6S A;  4B8X A;  3BJA A;  1R58 A;  1Q1V A;  4N4O B;  3E6B A;  4ON0 A;  2BY0 A;  1K6Y A;  2Y0S N;  2GOM A;  1HOM A;  1Z1D A;  3VFZ A;  1UG2 A;  2NS7 A;  2Z3Y A;  1P4A A;  3N4M A;  4EVI A;  5JI6 A;  3A0B C;  4ANJ A;  1ZRC A;  1R1U A;  3K10 A;  2Y69 H;  4LK1 F;  4AVP A;  4GDF A;  4P55 A;  4RGS A;  4DW6 A;  3LSP A;  3VSK A;  4NUB A;  1JT6 A;  2BOL A;  3CQZ J;  5H6Q A;  4ENM A;  3A01 B;  3RYP A;  1J7K A;  2IAI A;  2FUG 2;  1K78 A;  2BW3 B;  2XF5 A;  4RGX A;  3QPS A;  1K61 A;  5FJ8 J;  4RM2 A;  3E5Q A;  1IZ1 A;  5KHD A;  4HOB A;  3RSN A;  3KEY A;  2UXN A;  1EJ9 A;  1IUY A;  2A05 A;  4C9Y A;  1OQY A;  2DA5 A;  1WFX A;  5EGO B;  2B0L A;  4DYC A;  2DDB A;  4NQW B;  3NRV A;  2R92 J;  3CF5 F;  3HSE A;  3BCA A;  3RTR A;  3OYH A;  1VQN I;  4WXC A;  4FET A;  4CCO A;  1BI0 A;  3A1Y A;  3PQK A;  1J0R A;  1BM9 A;  2LMD A;  2KP6 A;  4RAY A;  2X1E A;  1AA7 A;  4HNU A;  2KQR A;  3F6O A;  3MFK A;  4FE7 A;  2I10 A;  4CA0 A;  4RB3 C;  3LFK A;  4RB1 A;  4XRF A;  3H0G J;  3CC7 I;  4QTR A;  5CLS A;  2EPF A;  1A04 A;  1OCT C;  4XRS A;  2AQE A;  3BTI A;  5TRD A;  4G6Q A;  6PAX A;  2FBK A;  3P9I A;  2KIQ A;  2GWR A;  1L3L A;  3K1M A;  4BXF A;  3HOY J;  3KZZ A;  1O3T A;  5HNF A;  4A93 J;  3C7J A;  3K4N A;  1ZKG A;  2OJE D;  4ZDP A;  2HDW A;  3EET A;  1B1B A;  3WU0 A;  1B72 B;  4M3D A;  2FEZ A;  1I5Z A;  1XN7 A;  2DAO A;  2DK8 A;  5K1Y A;  3E7L A;  1FBQ A;  4U0V A;  3CCS I;  5EEH A;  3M8F A;  1QPM A;  3GTJ J;  2NAZ A;  2W00 A;  3FZV A;  1QZZ A;  2HXI A;  1OYY A;  1Z7U A;  2LNB A;  4CCN A;  1IW7 F;  1YO5 C;  2XAU A;  2ZNZ A;  2FMY A;  2COB A;  2UV1 A;  3ECH A;  4RS8 A;  1IDZ A;  1X1A A;  4BKX A;  2JQ7 A;  3HL2 A;  4L9T A;  2I8D A;  3BG6 A;  4V2G A;  1WGX A;  3U21 A;  3CLO A;  5JVG F;  4KMF A;  2BXZ A;  2L4A A;  4BHB A;  1F4K A;  1RR7 A;  3FMQ A;  1SAX A;  5E79 C;  1NTC A;  3F22 A;  3EYY A;  4EAT A;  3CC4 I;  3V8L A;  3CP2 A;  2LDU A;  3FXJ A;  4QPQ A;  1SC7 A;  4M74 A;  4RB2 C;  1VQ4 I;  1ETW A;  1LE8 B;  1I1G A;  1UST A;  2KT0 A;  5J1R A;  2FQ4 A;  2ZO4 A;  4V2F A;  4WXD A;  1TQI A;  4P5O A;  1ORK A;  1VQ5 I;  1SD7 A;  1XC5 A;  1LUJ B;  3PSI A;  3BR1 A;  5BMZ A;  2A68 F;  2I5U A;  4Q4Z F;  4C2M J;  2F6C A;  1S72 I;  4HYE A;  3DBH B;  5HLG A;  5EG0 A;  1XGS A;  1ETQ A;  1W1W E;  3M4O J;  5M5W J;  3LNQ A;  3S3O A;  4KIT B;  2DLL A;  4PJL A;  3F8C A;  3E6M A;  3BR5 A;  5BQT A;  2GIV A;  3U1K A;  1EH7 A;  1YIJ I;  1H0M A;  3AAF A;  1JJ6 C;  3KE2 A;  4IHX A;  4YEL A;  2VE8 A;  5AON A;  2CSO A;  1ZRE A;  4O5V A;  3MQ0 A;  1X3U A;  2V6C A;  3OR2 C;  1IAW A;  3S1Q J;  3ULQ B;  4A3D J;  4C3I J;  1WHU A;  2L0K A;  4CGZ A;  1S5L C;  1I3A A;  3W2A A;  2XSD C;  4BDZ A;  5DCM B;  2G9W A;  2O61 A;  1R6R A;  3HRT A;  3CD6 I;  4UNO A;  1LDJ A;  2XB5 A;  1FBU A;  1D5Y A;  2M7B A;  1SFU A;  4YFK F;  4JOM A;  3DTI A;  4AD9 A;  1HKQ A;  3E3V A;  1E0E A;  2DMP A;  1IRG A;  4M3G A;  1UCR A;  4CDG A;  1PP8 F;  4EGZ A;  4BNC A;  1MNM C;  2HGC A;  2VOD A;  4EJU A;  1R23 A;  2D1H A;  2QLZ A;  1BR4 A;  1ON1 A;  3OL3 A;  3JRI A;  4BDY A;  1ZQ3 P;  3WU2 C;  1MDM B;  4XSZ F;  4GFB A;  1IXC A;  3U9G A;  2X1C A;  2PMU A;  2EB7 A;  5J8C A;  2VQH A;  2GQQ A;  2JPB A;  4XID A;  4UUS A;  1LQ1 A;  2KKO A;  3SFZ A;  4BEH B;  3GCM A;  1H89 C;  1J2X A;  1I27 A;  2AXT C;  1WQ2 A;  2L9S A;  2ME0 A;  1MBJ A;  2D1V A;  1ODD A;  4CZC A;  2R7V A;  2FSW A;  3RQI A;  1T2K A;  5ILU A;  3IP4 B;  2NOJ B;  4DBR A;  4IJA A;  4IO9 F;  2DXI A;  1UZC A;  3VYR B;  2VKE A;  3IC7 A;  5EEA A;  3JAM Z;  4YIF A;  1ZRD A;  2X1D A;  2XB0 X;  1MND A;  2OPT A;  5LFA A;  3BWG A;  3RDI A;  4BJ6 C;  3I54 A;  2DFI A;  2LYC A;  3QPT A;  3CJQ B;  1OKR A;  4DBQ A;  1K79 A;  4EJO A;  5DD8 A;  3CCV I;  4Q5S F;  1JTX A;  1SEU A;  4LB5 A;  2KDO A;  2LKP A;  5M3F J;  1ZRF A;  3PO2 J;  3O8H A;  4B4C A;  3CF2 A;  2O0Y A;  1WI3 A;  4OIO F;  2WAD A;  2STW A;  2VJI A;  3FKJ A;  1Y8R B;  1CF7 A;  1KQ0 A;  3OYN A;  2XAS A;  1I50 J;  1T0F A;  2W85 A;  3DFG A;  1TNS A;  4R8H A;  3KYL A;  1YTY A;  3A03 A;  4IZZ A;  4UY8 I;  3G71 I;  2VT2 A;  5FKN A;  2TCT A;  4LK0 F;  3NWT A;  2QVO A;  3BDD A;  3CMM A;  1UJ8 A;  1D0Y A;  1KU3 A;  2TDX A;  2XGX A;  2L5Q A;  1W5S A;  2NVX J;  3C2G A;  1KYZ A;  2VLA A;  4ZYG A;  2ZXI A;  2JVG A;  2O3F A;  5M3M J;  2ZJ2 A;  4HQM A;  2C6Y A;  5B66 C;  4KIS A;  5J40 A;  2V79 A;  3SZT A;  3LSG A;  1Z6T A;  1YW8 A;  4HA8 A;  2CQK A;  1BBY A;  2QEN A;  3VYS B;  4F93 B;  2UZK A;  3SQN A;  3KYD B;  2P6S A;  3DBR B;  4BGD A;  2ZJR F;  2M7A A;  4LFU A;  1B59 A;  4U7D A;  3ELK A;  1TL8 A;  2E71 A;  4GYI A;  3BOQ A;  4Y33 A;  3JRB A;  3CCU I;  1BW6 A;  2B63 J;  4UVA A;  3GTK J;  3GLL A;  5K5Q A;  4LOC A;  1NG7 A;  1E3H A;  2P81 A;  3HB9 A;  2LBF A;  4LB6 B;  2OAZ A;  1WJF A;  3KZY A;  1SFX A;  2JUG A;  2Z2S B;  1MIJ A;  1R1T A;  1P6R A;  5GPA A;  1FWZ A;  2CYY A;  1X1B A;  2DJI A;  2FBH A;  3JRC A;  2COM A;  2IGM A;  2IGO A;  1S7A A;  2LK2 A;  3O6B B;  2OCE A;  1UEL B;  1XPX A;  2L02 A;  2DOF A;  4MNU A;  5F0C A;  3W2W A;  3F72 A;  1LJ9 A;  1BL0 A;  2DQL A;  3K9T A;  1ZR4 A;  2K9S A;  3NWS A;  2HYJ A;  4NC6 A;  5LLQ A;  3OYI A;  3EPZ A;  1IN5 A;  3N97 A;  2HYF A;  3K4M A;  2IRF G;  2Z1D A;  1C0W A;  2EIJ H;  4E7L A;  1MJ9 A;  2DMN A;  4I99 C;  4NBQ A;  4R1H A;  3GZN B;  3AG2 H;  1KQ8 A;  2EV6 A;  4XBF A;  3TP0 A;  2DK5 A;  2A61 A;  4PJJ A;  5F0F A;  3BQZ A;  1O7F A;  3H9Q A;  1JKR C;  3WHB A;  1GUU A;  1ZH5 A;  2H8W A;  1MH4 A;  1NK3 P;  4II3 A;  3LSM A;  2A6H F;  2A5W A;  3HBL A;  1W5C C;  3RKY A;  3S14 J;  4HLY A;  2CU7 A;  3LL7 A;  2JK3 A;  3ABU A;  2HOT A;  1YYV A;  4B09 A;  5CQE A;  2W4S A;  3HUG B;  1IO2 A;  3RCO A;  3VOE A;  2NOG A;  5HS7 A;  2EFQ A;  2LG4 A;  2E36 A;  4A3G J;  3CME I;  3KP7 A;  1RC9 A;  2ECB A;  3MAJ A;  4II2 A;  1VFC A;  1U5T C;  2HKX A;  2CW0 F;  3I55 I;  2CGP A;  1R49 A;  3TOA A;  2F4I A;  4A69 C;  4X6A J;  4YIR X;  2L9V A;  3S2H J;  2XRL A;  2XGC A;  4IVN A;  5DD4 A;  2PJR B;  1HKT A;  2WTE A;  2FA5 A;  4BBR J;  1X2N A;  2FE3 A;  3M3Y J;  1XCV A;  2NS8 A;  2EQR A;  1YG2 A;  1RIO H;  3TL4 X;  2RQP A;  3A2K A;  4F91 B;  1IC8 A;  1VQM I;  1MBG A;  1RPW A;  4XSX F;  3ZOB A;  4B1R A;  1VQO I;  3HHG A;  1QVT A;  1G3W A;  3GEZ A;  2OUM A;  4R79 A;  2D5V A;  4DNC A;  3CUQ C;  3CP8 A;  1IXS B;  2X0L A;  3C2H A;  1MD0 A;  2MC4 A;  3RJP A;  2DT6 A;  3OYF A;  4D7N A;  2FF4 A;  5C4X J;  2XGD A;  2OF7 A;  2HU9 A;  2BZT A;  1IG7 A;  2OV7 A;  3HOU J;  4HSR A;  3R0A A;  4H4K C;  1JKP C;  1Y56 A;  2BY1 A;  3JTH A;  2GAU A;  2QYO A;  4BQQ A;  1H88 C;  1PJR A;  5ICE A;  3JRF A;  4G7O F;  5DEQ A;  1EKE A;  1OFC X;  4D7M A;  3W6V A;  3I56 I;  1XG1 A;  2HTJ A;  1AKH A;  2NRA C;  3Q0V A;  5IYC J;  1V5E A;  2M34 A;  3RI4 A;  2LFB A;  4AIK A;  2H27 A;  5C44 J;  2ZC2 A;  1ITY A;  4MTD A;  3VYT B;  2EIK H;  2IS6 A;  1JKQ C;  2X6O A;  3VPR A;  3OSG A;  2R7Z J;  5D6E A;  2EH3 A;  1R5G A;  4M73 A;  4XON A;  1F36 A;  2QM3 A;  1RUN A;  3H35 A;  4JX4 A;  3KET A;  1OCP A;  1FOK A;  1LEA A;  5DCF A;  2DI3 A;  3HSF A;  3LSI A;  5CVR A;  1W0T A;  1S3J A;  3S1N J;  1JGS A;  2HYG D;  1EH8 A;  2PMH A;  2QQA A;  2ELK A;  5K5R A;  2IS1 A;  1VQK I;  5JVT A;  1V55 H;  4MFE A;  4KN4 X;  4FAS D;  1B4A A;  4HF1 A;  1U8B A;  1MMS A;  3HOW J;  3DEW A;  5FLX Z;  1D1C A;  2VJ5 A;  5JHF A;  1X4O A;  3CO7 C;  1JKO C;  3HHH A;  2MD0 A;  3KLO A;  1ETK A;  2UXX A;  4U87 A;  5K7F A;  1J59 A;  2H8R A;  1G4D A;  4I0A A;  1VF9 A;  4HF0 A;  3TO7 A;  5E8I A;  1VQ8 I;  2ZSH B;  4FCY A;  2JTV A;  1W7P A;  3JSO A;  1MJB A;  2DA7 A;  4XOR A;  3W6K B;  2L4M A;  4PK4 A;  2F5V A;  1YJN I;  3BG5 A;  3ISP A;  1QZE A;  4BQA A;  2M2E A;  3JW4 A;  2VE9 A;  3QU6 A;  3V8J A;  3I53 A;  4XM3 A;  5C4J J;  3MZY A;  3K4K A;  1BIB A;  4CIC A;  4HNT A;  3K4C A;  1MMD A;  4WWC A;  3RZD J;  1VQP I;  2W7N A;  4HX7 A;  3MKW B;  1R7J A;  1JHF A;  4F92 B;  3CDH A;  1W5T A;  3TW6 A;  1OPC A;  2QBY B;  4XR6 A;  2MG4 A;  2F4M B;  3JR9 A;  1D8J A;  1QGP A;  4MQV A;  3JAM K;  1MMG A;  5E3O A;  4GO1 A;  2R7T A;  1S9H A;  2DT7 B;  5GAG J;  2VQL A;  2E60 A;  5L3D A;  4KIC A;  1QNT A;  2CG4 A;  3OL4 A;  1P2F A;  2FRH A;  1MZB A;  1FIP A;  1IDY A;  3AG3 H;  3OS1 A;  2MH2 A;  2IW5 A;  4HLX A;  3WTW C;  2QWW A;  4YII A;  4G7Z F;  1HF0 A;  1XS9 A;  1BJZ A;  2OTL I;  3BPX A;  4L9N A;  1BI1 A;  2HOS A; 
#chains in the Genus database with same CATH homology
 1B72 B;  2R5Z B;  4M3D A;  2EZL A;  4BXX J;  4S0H B;  2NVT J;  1MBF A;  1O4X A;  3E7L A;  1WH7 A;  5C3E J;  3Q0W A;  4A3M J;  3GTJ J;  4JYK A;  3Q3S A;  3ZQI A;  2HXI A;  1TWG J;  4Y7N J;  2X9D A;  2L7F P;  5GP9 A;  2YS9 A;  3FK6 A;  5EF6 A;  1SFO J;  3HGY A;  5DTD A;  1B8I B;  5IP7 J;  2COB A;  4QIW N;  1GVD A;  2DA1 A;  4AUX A;  4MFD A;  1IDZ A;  4EEF G;  4BKX A;  3PO3 J;  5E3N A;  1F43 A;  1ENH A;  2R0Q C;  1E3O C;  4V2G A;  1TWC J;  1WGX A;  3Q0U A;  2AO9 A;  4G12 A;  2EZH A;  3OOU A;  1MBE A;  2DA4 A;  2M0C A;  1RR7 A;  3RKQ A;  1GT0 C;  1YRN B;  1X58 A;  1NTC A;  1X2M A;  1IV6 A;  3FIS A;  2PMZ N;  2WV1 A;  2M8G X;  3BQY A;  2NVQ J;  2WB1 N;  4A3L J;  1FTZ A;  1DU0 A;  2E1O A;  2O9L A;  4Y52 J;  1ETW A;  1LE8 B;  1VI0 A;  2KT0 A;  5J1R A;  2FQ4 A;  3GTQ J;  4M3F A;  4V2F A;  2XPU A;  2CJJ A;  1ORK A;  2AHQ A;  2K9Q A;  1XC5 A;  1MBK A;  5IOY A;  4AYB N;  5K7Z A;  3BR1 A;  5IPA A;  4A3J J;  5FLV A;  4C3H J;  2ZB9 A;  1JUM A;  4C2M J;  5GPC A;  1ZGW A;  1FEX A;  1Y1V J;  2K40 A;  5EG0 A;  3S17 J;  1ETQ A;  3M4O J;  1MSE C;  5M5W J;  3LNQ A;  1U9O A;  1JGG A;  3BR5 A;  4BY1 J;  1TWA J;  1JJ6 C;  3NAR A;  2JMW A;  4IHX A;  5DS9 A;  4ABZ A;  1HDD C;  4NDL A;  2LD5 A;  2FD5 A;  3SFI A;  2HXO A;  2RAE A;  3S1Q J;  1VND A;  3BR2 A;  4A3D J;  4C3I J;  3TW7 A;  2K9N A;  2L0K A;  3WHC A;  3O8G A;  4QSH A;  2XSD C;  1WPK A;  3IH2 A;  4A3C J;  3JRH A;  1HCR A;  1MSF C;  2XB5 A;  4C3J J;  1D5Y A;  1ETO A;  5F0H A;  1AHD P;  3FKI J;  1EF4 A;  3A01 A;  1WH5 A;  2DMP A;  4M3G A;  2JA7 J;  3BR6 A;  1MNM C;  1MBH A;  2R5Y A;  3JRI A;  5EGO A;  4RBO A;  1PUF A;  5BNG A;  1ZQ3 P;  3L1P A;  2EBI A;  4GFB A;  4UUS A;  1HLV A;  4XID A;  2NVY J;  2LP0 A;  1RET A;  3IV5 A;  2JJ7 A;  2DMT A;  3G1L A;  3HKZ N;  4RDU A;  3HDD A;  4JP0 A;  1H89 C;  1SAN A;  2LLK A;  2ME0 A;  1MBJ A;  1UMQ A;  3RQI A;  5K7H A;  1GDT A;  2HOA A;  1JJ8 C;  2VKE A;  4BBS J;  5EEA A;  3MKL A;  5EDN A;  2GLO A;  2VUM J;  2XB0 X;  2OPT A;  1B72 A;  3MN2 A;  4I6Z A;  3GTO J;  2R5Z A;  1G2H A;  2VPR A;  5F1J A;  3LSR A;  4A3B J;  3MVP A;  1IJW C;  3TED A;  3DCF A;  2XGE A;  1JTX A;  5EZG A;  3JRA A;  3BG3 A;  5M3F J;  2DMU A;  1LFB A;  3G1M A;  3PO2 J;  3O8H A;  4HNV A;  4B4C A;  3I4M J;  2ID3 A;  4X1E A;  2DN0 A;  1B8I A;  5J1U A;  1WI3 A;  3OIO A;  4MLO A;  2YUS A;  1IRZ A;  2KDZ A;  1I50 J;  1FIA A;  4L5E A;  4M3B A;  2E2H J;  1AKH B;  1DU6 A;  3A03 A;  4FTH A;  3S16 J;  3BTJ A;  2LY9 A;  5FKN A;  2TCT A;  5J1Y A;  3B6A A;  9ANT A;  5IP9 J;  1ZK8 A;  1YRN A;  2NVX J;  1JT0 A;  4M6V A;  3B6C A;  2VI6 A;  3GTM J;  4MIM A;  2N8G A;  5M3M J;  2LVS A;  1I6H J;  5EZH A;  4JX6 A;  3S1M J;  3K7A J;  3LSG A;  1QVU A;  1R9T J;  2L7Z A;  1NK2 P;  1POG A;  3D1N I;  4IHV A;  1H8A C;  4CYC B;  1JTY A;  3JRB A;  5IYD J;  1ETY A;  1BW6 A;  2B63 J;  2L9R A;  3GTK J;  1BW5 A;  1ZTR A;  1RES A;  2MSY A;  3GTP J;  2Y30 A;  3ZQG A;  3HOX J;  1BA5 A;  4LOC A;  2P81 A;  3HB9 A;  4MO7 A;  1JUP A;  4XIC A;  1LFU P;  3ZQF A;  1A5J A;  3BR3 A;  1P7I A;  5FKK A;  3K2A A;  2JA8 J;  3RZO J;  5GPA A;  5JLX A;  2LKX A;  2R93 J;  5FKL A;  3JRC A;  2CRG A;  2LR8 A;  2LK2 A;  4W97 A;  2ME6 A;  3BTL A;  5F0C A;  1TWH J;  1BL0 A;  2ECC A;  3PM1 A;  2K9S A;  1ZR4 A;  1AU7 A;  3BT9 A;  3JRD A;  2HYJ A;  2JA5 J;  4A3F J;  5IOZ A;  3GTG J;  2L7M P;  3BG9 A;  3S1R J;  1FJL A;  1RKW A;  2QF7 A;  2DMN A;  2XPW A;  2E19 A;  4XRS G;  5IP6 A;  3BTC A;  3TP0 A;  2Y9Z A;  1CQT A;  2IEK A;  5F0F A;  3BQZ A;  2R5Y B;  2YU9 J;  1JKR C;  2EZK A;  3CMY A;  3WHB A;  1GUU A;  1RKT A;  1MH4 A;  4DZP A;  1NK3 P;  1TC3 C;  2GBY A;  3HBL A;  3S14 J;  4BY7 J;  2CU7 A;  4FE4 A;  3IH3 A;  2JK3 A;  4DZJ A;  5JLW A;  3BR0 A;  3UKG A;  2FX0 A;  2HOT A;  4A3K J;  2CQX A;  3A02 A;  2NOG A;  1IGN A;  1ETX A;  4A3G J;  2ECB A;  2WAQ N;  1VFC A;  2JWT A;  1JUS A;  2TRT A;  4W1U A;  4A69 C;  3JRE A;  1Y1W J;  4X6A J;  3S2H J;  4FIS A;  3I4N J;  2XRL A;  2XGC A;  1APL C;  5E3M A;  4DYR A;  4BBR J;  3H3V K;  1X2N A;  3JRG A;  1QRY A;  2W48 A;  3M3Y J;  2DA3 A;  5FKO A;  2NS8 A;  2EQR A;  2Y2Z A;  1QPI A;  1IC8 A;  3CDL A;  1MBG A;  1RPW A;  3ZOB A;  4B1R A;  1QVT A;  2D5V A;  2HDD A;  1Z77 A;  3S2D J;  2DA2 A;  1FTT A;  1ZR2 A;  4D7N A;  5C4X J;  2XGD A;  2OF7 A;  4A3I J;  3C2B A;  1IG7 A;  2Y9Y A;  4AC0 A;  5M5Y J;  3HOU J;  4IEJ A;  1JKP C;  2O8K A;  5FLM J;  3QPL A;  1H88 C;  3HGG A;  4D5C A;  2MW8 A;  3TP3 A;  4XK4 A;  2XPV A;  3JRF A;  5E3L A;  1P7J A;  1I3Q J;  1OFC X;  4D7M A;  3W6V A;  5IYB J;  1XG1 A;  2JA6 J;  2CUF A;  2O7O A;  3CCY A;  3Q0V A;  1AKH A;  3G1O A;  5IYC J;  2M34 A;  2LFB A;  5F08 A;  3LOC A;  2Y31 A;  5C44 J;  1ITY A;  2DJN A;  1LE8 A;  1JKQ C;  2X6O A;  3SDG A;  1GV2 A;  3VPR A;  3OSG A;  3SJM A;  2R7Z J;  2EH3 A;  1OJL A;  5F27 A;  4DYQ A;  5FKM A;  1GV5 A;  4UUT A;  1F36 A;  3ZQC A;  1IUF A;  5EG0 B;  2GM4 A;  5M5X J;  4JX4 A;  3FK7 A;  1OCP A;  2G0E A;  3FIW A;  3S1N J;  1W0T A;  1MH3 A;  3GTL J;  2ELK A;  3NAU A;  1U9N A;  2CQQ A;  4J19 A;  3F0C A;  4CYC A;  3QQA A;  4XRM A;  3LSJ A;  4MFE A;  3HEF A;  2ID6 A;  1U8B A;  4JX5 A;  5J3L A;  3HOW J;  3DEW A;  2X48 A;  2M9H A;  1Q1V A;  4A3E J;  1JKO C;  2Y0S N;  1HOM A;  1UG2 A;  2NS7 A;  5HOD A;  1ETV A;  1ETK A;  4B3A A;  2H8R A;  5K7F A;  1VF9 A;  1WCM J;  4FCY A;  2DA7 A;  2MGQ A;  3BG5 A;  2M2E A;  4DW6 A;  3LSP A;  2EZI A;  1Z0X A;  2E2I J;  1JT6 A;  5F04 A;  3CQZ J;  3A01 B;  3HOZ J;  5C4J J;  3IH4 A;  2IAI A;  3RZD J;  4IHY A;  3QPS A;  2IBD A;  1K61 A;  5FJ8 J;  2CUE A;  3GBG A;  2FJ1 A;  2DA5 A;  2QCO A;  3TW6 A;  5EGO B;  3OSF A;  1PUF B;  2MG4 A;  2JN6 A;  4DYC A;  1T56 A;  3JR9 A;  2R92 J;  4IHW A;  4UUS B;  3ZQL A;  4D5F A;  2HQ5 A;  5E3O A;  2E2J J;  2VKV A;  1W0U A;  3HOV J;  1UHS A;  2DMQ A;  3S15 J;  4I76 A;  4FE7 A;  2I10 A;  5EYR A;  3ZQH A;  1TWF J;  1HDP A;  2LTP A;  3H0G J;  1K83 J;  1FIP A;  1IDY A;  4QTR A;  4M3E A;  1OCT C;  3HM5 A;  3BTI A;  4XRS A;  1A6I A;  1T33 A;  2H1K A;  2DA6 A;  3HOY J;  4A93 J;  1S7E A;  2HI3 A;  1ZKG A;  1XS9 A;  1HF0 A;  1BJZ A;  1U78 A;  2DTZ A;  2HOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...