2DAEA

Solution structure of the n-terminal cue domain in the human mitogen-activated protein kinase kinase kinase 7 interacting protein 2 (map3k7ip2)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
b'GSSGSSGQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0733 protein
publication title Solution Structure of the N-terminal CUE Domain in the Human Mitogen-activated Protein Kinase Kinase Kinase 7 Interacting Protein 2 (MAP3K7IP2)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2daeA00
2WZJA 2DI0A 4F1IA 2CWBA 1TR8A 2DAEA 1IM2A 1WGNA 3FE3A 1OTRA 1Y8GA 4R71A 3GLFE 1ZV1A 3FRHA 3F92A 2LTUA 2O25A 1HT1E 1G3IA 2B3TA 2MGWA 1BVSA 1NV8A 2DKLA 2DAIA 2JP7A 1ZMWA 2JZ1A 1QZEA 2JY6B 1OAIA 2KHHA 4Q7JA 2KNAA 1G41A 1Q02A 2MR9A 2LVPC 1XB2B 2LVAA 5JI2E 1DV0A 3IHPA 4GEWA 2OOBA 1V92A 1YLAA 1OQYA 2LVOC 1ZMUA 1HJPA 1IXSA 1WGLA 1VQ1A 1CUKA 1SG9A 3K9PA 4UN2B 1HQYE 3FRIA 3GLGE 2K0BX 1TTEA 1EFUB 2KNVA 1DO0A 3LCVB 2DAMA 2QSFX 3E46A 1A5TA 5DFLA 1VEKA 3H4JA 3MMPA 1C7YA 1G4AE 1WJ7A 2ZTDA 2H5XA 2DAGA 2EKKA 1MN3A 1HT2E 2L4FA 2ZTCA 2JUJA 2L4EA 2LBCA 2K9DA 2R0IA 4HEOA 2CP8A 2HWJA 3E21A 3IECA 1R4GA 1JR3E 2DHYA 1WHCA 2JNHA 1VDLA 2KNZA 3LCUA 1WR1B 2DAKA 4G3OA 4DBGB 3B89A 1VEJA 2EJSA 1UFZA 1GO5A 2OO9A 2JY7A 4WP2A 1DO2A 1XXHE 1ZMVA 2EKFA 3K9OA 2DZLA 3T6PA 1AIPC 1E94E 4F2LA 2JY8A 2MROB 1KYIA 1VG5A 3BBZA 1VEGA 3GLIE 1WIVA 2HAKA 1F4IA 1P3QQ 2L2DA 2JZ0A 2LVQD 3GLHE 2QNJA 1PGYA 2RRUA 2G3QA 2JY5A 2BWEA 2LVNC 1OKSA 2DENA 1IFYA 2MJ5B 2OOAA 2BWBA 1T6OA 2QHOB 1T43A 1NV9A 2DNAA
chains in the Genus database with same CATH superfamily
3PXGA 2F5SA 1TR8A 3U6QA 2DAEA 1WGNA 5BR8M 1OTRA 1Q3BA 4CJ6A 8CATA 2R62A 2EO2A 2R6FA 4R71A 2HKJA 3GLFE 2HHHM 4LJAA 5DNYA 1IQPA 2KDLA 2QP9X 2XEPA 1OIZA 2LTUA 4KT0F 1GL6A 3QAUA 4IBEA 4WW0A 3WHLA 3LVVA 1NV8A 1QUSA 2H1RA 3H4MA 4I81A 1QVRA 2F5NA 4G4OA 4MGHA 3UGJA 3KSXA 1QAMA 1QZEA 4GC5A 1HR0M 2JY6B 4IBCA 4DV6M 3UMMA 3D8BA 4LRSA 4B7GA 2XF3A 3DOAA 1OAIA 2KHHA 2LWXA 4Q7JA 7CATA 1RU3A 4X62M 4IBIA 5JI2E 2LVAA 1DV0A 1N36M 5FTNA 1SXJB 2OOBA 4GRIA 1E9SA 2UUCM 1LTMA 3KOXE 5FLXS 3KDSE 1YLAA 2J7NA 3VLFB 3QWLA 4QNRA 3Q8XA 2J7OA 1HJPA 1IXSA 1VQ1A 1CUKA 1QAQA 4IJEA 3K9PA 3J81S 3EIHA 2CEAA 1L8QA 2K0BX 3DA1A 4FWHA 3BXWA 1DO0A 4FWGA 2C99A 2VIIA 2DWNA 3HJSA 3KOZE 3U60A 2DAMA 4NXNM 3E46A 1A5TA 4AG6A 4DR6M 3MMPA 1C7YA 1N75A 2H5XA 1TH4A 1E32A 4X66M 3Q8GA 3VDPA 2V1UA 3U6SA 1HT2E 3V76A 2KW0A 3CF6E 3FYCA 2G8LA 2KZSA 1PRBA 2R0IA 3E21A 3GPXA 3VK7A 5FTJA 3RGPA 2V1CA 3NWLA 1Z6TA 1I4WA 1XXHB 4HLQA 3SBJA 5A2QS 2KNZA 4TUWA 4YY3M 2Y0TA 2GQFA 3SHGB 2Z4SA 4DBGB 2DAKA 2KA6B 4OX9M 3LMMA 4QNMA 1E9RA 4LF7M 4WP2A 4FWDA 3GPUA 4LZJA 5EP4A 4LJ7A 2UU9M 2EKFA 4R7GA 4NL4H 1D0MA 4AG5A 1E94E 4QOZC 1XHBA 2KZUA 2D7HA 4PD2A 4RF1A 4F2LA 4LRTA 3L26A 3NBIA 2F5OA 3AV0A 1TH2A 1VG5A 2BJVA 3BBZA 4XBOA 4M0WA 2CHVA 3I4YA 4RNAA 4LFCM 1WIVA 2JXNA 4B7FA 3GRRA 2VQFM 3JR5A 1UM8A 4WURA 4JV5M 2L2DA 4GKKM 4G4NA 4RKUF 4S12A 5FTLA 3ZC7B 1J7KA 2FH0A 4DR2M 5IT9S 2Q2EB 3GLHE 2QNJA 3TL4X 1PGYA 3B9PA 2G3QA 1YUBA 3RE8A 1FNNA 3W67A 4AKHA 2LVNC 2DENA 1IFYA 2OOAA 3M6AA 1QDRA 1IN8A 1DGFA 3AOEA 2BWBA 2G5GX 2FOIC 2XSZD 3KP1E 4G6ZA 3UZUA 5KQ8A 3AKZA 4DUZM 1I94M 1T43A 2NQ8C 3KS4A 1SXJC 2M60A 2WZJA 4G3OA 5FSWA 3GO8A 2CWBA 3PFIA 4MH0E 2F5PA 1G8PA 1G71A 1IXSB 4MM3B 1IBLM 4G4RA 3T15A 3RFWA 1JR3D 1LV7A 4CGYB 2FFJA 1L1ZA 4JI7M 1ZV1A 2YFQA 2YQZA 2K6BA 3KS8A 2R18A 1QAOA 1HT1E 1N32M 1G3IA 1NJGA 4CIZA 3U60B 5EXXA 1W5SA 2MGWA 1BVSA 1XNQM 3CF0A 5IWAM 1GABA 2JZ1A 3J27B 4IBBA 2L7IA 1IN4A 1IN5A 3TWMA 1IY2A 4PCZA 1G41A 4B08A 3IG5A 4B3MM 3K1JA 3GLGB 3ILKA 4IBFA 4PT5A 4XK8F 4JI0M 3W0LB 2UXCM 5KQDA 2CHGA 3GRVA 2HL7A 1ORYB 2RKOA 4BBAA 1Z59A 3SYLA 1WGLA 3DFZA 1FJGM 1IBMM 3GRUA 5C1BA 4FCVA 1HQYE 2DZNB 2R45A 3FRIA 4DV4M 3AFHA 1SXJE 3J7BA 3HU3A 1L2BA 3CF2A 4II7A 4X64M 4DR3M 2QSFX 2VDBB 1TGUA 1VEKA 3H4JA 2ZTDA 2DZOB 2F5QA 1TH3A 1IBKM 4JI8M 2EKKA 1V33A 4L78A 3W68A 1PJSA 2KRUA 1ZQ9A 2L4FA 1GJTA 4LJ4A 3HX3A 4GHAA 2V6ZM 4QHTA 4A3VB 4B3RM 3BOSA 5H37D 2K9DA 3VKGA 3I01M 3IECA 2XFTA 3L27A 1R4GA 1MJGM 2DWMA 3PNVA 2M5ZA 1WHCA 4L4UA 5JI3E 4LF9M 1DGBA 3QYEA 2RGOA 3KOWE 1KSFX 2CRUA 1NO1A 1WR1B 2XSZA 4LJ6A 5EP3A 3B89A 2HCBA 1UFZA 3J7AS 2JY7A 5DYIA 1HNWM 1XXHE 2K47A 1ZMVA 3E9SA 3T38A 3T1YM 2CV2A 1JR3A 1AIPC 3GQ3A 2QZ4A 3GP1A 3VK8A 3HJQA 2ZAOA 1NY5A 2JY8A 2MROB 4JYAM 1KYIA 2FS1A 3NBXX 1PJIA 4Z6YA 2VQEM 4M9SA 2XFSA 3UJNA 1L2CA 3D8LA 1OAOC 1NHWC 1OFHA 1GVNA 2KRKA 3HU1A 1L2DA 4DR7M 4Y28F 4MGZE 1HNZM 2LVQD 1Z5AA 1MX0A 4LF4M 1DGHB 2ERCA 2R46A 3CTWB 3TQSA 4LG2A 2E5LM 3U61A 3GLIA 1VDDA 2BWEA 2LXEA 4PDIA 1N77A 1OKSA 4L16A 4K0KM 1D0KA 4NXMM 4IBGA 2Z8YM 3B7QA 4QOSA 3TWLA 4W5WA 4REZA 4EIWA 5L8RF 2UUBM 1K3WA 5GKNA 3FYDA 4XGIA 3MHVC 4F1IA 1XNRM 3KOYE 1EE8A 3FD9A 3SMSA 1Y8GA 5ITXA 3JAMS 3AOGA 4KHPM 3FTCA 3WHKA 3FRHA 3F92A 4AZFA 4DR5M 2O25A 1X37A 3RGSA 3GRYA 3HZJA 3C9PA 1IY1A 3ZCBB 4AW4A 2DWZB 3JR4A 2YNMD 3FUTA 2CV1A 4B7HA 1XMQM 3FTEA 3FTFA 1Q39A 2DAIA 2JP7A 3HHWA 1ZMWA 2R4EA 4LJ8A 3GPPA 2R65A 2O5RA 3HY5A 2F4VM 4PDGA 3R9XB 2QQ8A 4FD2A 2DXIA 1Q02A 1W5TA 2BNKA 3AL0C 2LVPC 1XB2B 2JWSA 4MGKE 3GLFA 4GKJM 3IHPA 1IN6A 1V92A 3CGWA 1IXZA 2J5YA 3HHZA 4JXJA 2QPAA 5EP1A 4JI3M 4B3TM 3KXEC 4OW0A 1NNUC 2CHQA 4OU7A 5ITRA 1OJLA 1SG9A 4NRWA 4D80A 3GLGE 1IXRC 1OIPA 2KXEA 4KO8A 5EP2A 1NJFA 1EFUB 2KNVA 1G59A 2RGHA 3U6OA 4CISA 1NSFA 4ZPXA 3SHFA 5DFLA 3K2LA 3LQQA 1WJ7A 3HKPA 2DAGA 4NOOB 4P17A 2C9OA 3FUUA 4AI6A 1C1KA 4DV1M 2A5YB 2DHRA 2APLA 4L15A 1MN3A 2W82A 2ZTCA 2JUJA 2L4EA 4LFAM 3SC3A 2C9CA 1NY6A 2CUZA 4GIPA 3A42A 4HEOA 4IBJA 4M9XA 4NSOB 1R6BX 3KVWA 4I5SA 1Z5CA 5ITYA 2DHYA 4FW9A 1TDHA 1VDLA 4IBKA 4GMQA 2XGNA 1PM5A 5EJCA 1IY0A 2WSCF 4I4LA 3K8ZA 1NHGC 3LCUA 3SMPA 4DUYM 3U5ZA 1R2ZA 1KFVA 1MU5A 4LY6A 4DV2M 1QZMA 1VEJA 2EJSA 3GQ5A 2OO9A 3U61B 3GLIB 2CE7A 3B74A 2C98A 3I04M 4M9ZA 5BPVA 1N33M 3EIEA 3IG8A 1J09A 3K9OA 3K92A 2DZLA 4QHSA 5ITQA 1Q3CA 3C3EA 3J2PB 3HJ8A 5ITTA 1PJJA 1VEGA 4D82A 1GLNA 2ZANA 4FVMA 4JI4M 2MH8A 2XZUA 3FUXA 3KSJA 3L29A 3ZQJA 2Z3XA 2UXDM 3M0EA 3PNYA 4AKGA 3C58A 4DV5M 1K3XA 1JB0F 5E26A 2I7NA 3SARA 2KEBA 2JZ0A 3OTOM 1HQCA 1SXJD 4B3SM 1QUTA 2RRUA 4NC6A 3L2AA 2Z7JA 4R3DA 2JY5A 2LHGA 4MGYE 1YE9A 4LGYA 2GNOA 2VF8A 3A46A 4AKIA 5F3WA 4I8OA 1GL7A 3SAUA 1R7RA 3GLFB 2UXBM 4NSRA 2QCUA 3HU2A 2X8AA 2QBYA 4LF5M 2DI0A 3B7NA 3GLHA 3U6PA 1NNJA 1IM2A 4LJ5A 3SATA 1S3SA 1PJTA 2CFOA 3FE3A 5KO3A 2C5RA 4DV7M 5IREB 4AQYM 1XC8A 5FTKA 3HWSA 1D0LA 4OVZA 3U6CA 3MK6A 3DZDA 4BB9A 2OPFA 1K82A 2B3TA 3GPYA 1J5EM 4L6V6 1T3TA 4FCWA 5EQTA 2VF7A 2DKLA 1R2YA 3I51A 3L25A 2O01F 5LMNM 2D7EA 2BJWA 1JQJC 3KP0E 3M7GA 3VDUA 3SASA 2R4JA 2KNAA 1OFIA 1R5LA 2MR9A 3GLGA 4JI6M 1PJQA 2Y20A 3LVWA 4GEWA 2WSFF 4LJ9A 3FKEA 2UUAM 2DVWB 1IN7A 1QANA 2QENA 4LF6M 4GC9A 3SYKA 2XH9A 1OQYA 2LVOC 2ZAMA 3FUVA 1ZMUA 2WSEF 5E6JA 4UN2B 1XMOM 4X65M 1TTEA 3U5ZB 4MGIE 5ITUA 4ANRA 2DWLA 1EIJA 2R44A 3LCVB 4DV0M 1DGGA 2D7GA 3LQRA 4LCBA 4DR1M 2FNAA 3A45A 1G4AE 1D2NA 4HL4A 5KPRA 3TE6A 2EA0A 3VFDA 1L1TA 2P5TA 3R8FA 4Z8XA 4FCTA 5EXPA 3U6LA 4LF8M 2Z4RA 4L8RC 5C18A 2X49A 4M0DA 4LGMA 1SXJA 1ZAEA 1AUAA 3U6MA 3E4RA 2LBCA 3QYBA 4MB7A 2ZBKB 2CP8A 2HWJA 5EXSA 2OQ4A 3TWKA 1JR3E 3A98B 4JI1M 4LFBM 2LHCA 4D81A 4YHHM 2JNHA 5EXTA 3UK6A 3GQ4A 3FUWA 4GHLA 4P16A 5FTMA 2L09A 3U6DA 3T1HM 3C3DA 2YR0A 1GO5A 3TPZA 4JN6A 4CHTB 1YSYA 4JI5M 1DO2A 4G4QA 1N34M 3B7ZA 3HHXA 3T6PA 5KPTA 1HNXM 1QQWA 2C96A 1GJSA 3HHYA 4GH9A 4DR4M 2L6OA 3AOEC 2LH0A 5IZ7D 2CV0A 1GKIA 2QBYB 3THGA 3GLHB 5DYGA 2EUCA 1H6UA 4DV3M 3GLIE 3ZH9B 1WXQA 2AHMA 2JA2A 3PVSA 2N35A 2HAKA 3I4VA 4GITA 2XLJA 1QYRA 1F4IA 1P3QQ 2LNHC 4NRVA 1XWIA 3FTDA 2I7PA 1NVMA 4KODA 1XXHA 2X4AA 2Y0QA 4OVZB 3VKHA 2ZM6M 2L7HA 1N78A 3HGIA 1DGHA 1QDTA 2FE8A 4IIWA 2XZFA 1TDZA 3KFUG 4RF0A 4BLCA 4JI2M 3L28A 3SFZA 4ITQA 3W0FA 5ITXE 2Y21A 4IBDA 3LW5F 4LZZA 2MJ5B 1TF0B 3MJ5A 5KPZA 3AJIB 1V34A 1Z5BA 4IJFA 5LMUM 3J80S 3U6EA 3SAVA 1T6OA 2QHOB 3KW6A 4KLNA 1NV9A 3SAWA 2DNAA
chains in the Genus database with same CATH topology
2WZJA 2DI0A 4F1IA 2CWBA 1TR8A 2DAEA 1IM2A 1WGNA 3FE3A 1OTRA 1Y8GA 4R71A 3GLFE 1ZV1A 3FRHA 3F92A 2LTUA 2O25A 1HT1E 1G3IA 2B3TA 2MGWA 1BVSA 1NV8A 2DKLA 2DAIA 2JP7A 1ZMWA 2JZ1A 1QZEA 2JY6B 1OAIA 2KHHA 4Q7JA 2KNAA 1G41A 1Q02A 2MR9A 2LVPC 1XB2B 2LVAA 5JI2E 1DV0A 3IHPA 4GEWA 2OOBA 1V92A 1YLAA 1OQYA 2LVOC 1ZMUA 1HJPA 1IXSA 1WGLA 1VQ1A 1CUKA 1SG9A 3K9PA 4UN2B 1HQYE 3FRIA 3GLGE 2K0BX 1TTEA 1EFUB 2KNVA 1DO0A 3LCVB 2DAMA 2QSFX 3E46A 1A5TA 5DFLA 1VEKA 3H4JA 3MMPA 1C7YA 1G4AE 1WJ7A 2ZTDA 2H5XA 2DAGA 2EKKA 1MN3A 1HT2E 2L4FA 2ZTCA 2JUJA 2L4EA 2LBCA 2K9DA 2R0IA 4HEOA 2CP8A 2HWJA 3E21A 3IECA 1R4GA 1JR3E 2DHYA 1WHCA 2JNHA 1VDLA 2KNZA 3LCUA 1WR1B 2DAKA 4G3OA 4DBGB 3B89A 1VEJA 2EJSA 1UFZA 1GO5A 2OO9A 2JY7A 4WP2A 1DO2A 1XXHE 1ZMVA 2EKFA 3K9OA 2DZLA 3T6PA 1AIPC 1E94E 4F2LA 2JY8A 2MROB 1KYIA 1VG5A 3BBZA 1VEGA 3GLIE 1WIVA 2HAKA 1F4IA 1P3QQ 2L2DA 2JZ0A 2LVQD 3GLHE 2QNJA 1PGYA 2RRUA 2G3QA 2JY5A 2BWEA 2LVNC 1OKSA 2DENA 1IFYA 2MJ5B 2OOAA 2BWBA 1T6OA 2QHOB 1T43A 1NV9A 2DNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZJ A;  2DI0 A;  4F1I A;  2CWB A;  1TR8 A;  2DAE A;  1IM2 A;  1WGN A;  3FE3 A;  1OTR A;  1Y8G A;  4R71 A;  3GLF E;  1ZV1 A;  3FRH A;  3F92 A;  2LTU A;  2O25 A;  1HT1 E;  1G3I A;  2B3T A;  2MGW A;  1BVS A;  1NV8 A;  2DKL A;  2DAI A;  2JP7 A;  1ZMW A;  2JZ1 A;  1QZE A;  2JY6 B;  1OAI A;  2KHH A;  4Q7J A;  2KNA A;  1G41 A;  1Q02 A;  2MR9 A;  2LVP C;  1XB2 B;  2LVA A;  5JI2 E;  1DV0 A;  3IHP A;  4GEW A;  2OOB A;  1V92 A;  1YLA A;  1OQY A;  2LVO C;  1ZMU A;  1HJP A;  1IXS A;  1WGL A;  1VQ1 A;  1CUK A;  1SG9 A;  3K9P A;  4UN2 B;  1HQY E;  3FRI A;  3GLG E;  2K0B X;  1TTE A;  1EFU B;  2KNV A;  1DO0 A;  3LCV B;  2DAM A;  2QSF X;  3E46 A;  1A5T A;  5DFL A;  1VEK A;  3H4J A;  3MMP A;  1C7Y A;  1G4A E;  1WJ7 A;  2ZTD A;  2H5X A;  2DAG A;  2EKK A;  1MN3 A;  1HT2 E;  2L4F A;  2ZTC A;  2JUJ A;  2L4E A;  2LBC A;  2K9D A;  2R0I A;  4HEO A;  2CP8 A;  2HWJ A;  3E21 A;  3IEC A;  1R4G A;  1JR3 E;  2DHY A;  1WHC A;  2JNH A;  1VDL A;  2KNZ A;  3LCU A;  1WR1 B;  2DAK A;  4G3O A;  4DBG B;  3B89 A;  1VEJ A;  2EJS A;  1UFZ A;  1GO5 A;  2OO9 A;  2JY7 A;  4WP2 A;  1DO2 A;  1XXH E;  1ZMV A;  2EKF A;  3K9O A;  2DZL A;  3T6P A;  1AIP C;  1E94 E;  4F2L A;  2JY8 A;  2MRO B;  1KYI A;  1VG5 A;  3BBZ A;  1VEG A;  3GLI E;  1WIV A;  2HAK A;  1F4I A;  1P3Q Q;  2L2D A;  2JZ0 A;  2LVQ D;  3GLH E;  2QNJ A;  1PGY A;  2RRU A;  2G3Q A;  2JY5 A;  2BWE A;  2LVN C;  1OKS A;  2DEN A;  1IFY A;  2MJ5 B;  2OOA A;  2BWB A;  1T6O A;  2QHO B;  1T43 A;  1NV9 A;  2DNA A; 
#chains in the Genus database with same CATH topology
 3PXG A;  2F5S A;  1TR8 A;  3U6Q A;  2DAE A;  1WGN A;  5BR8 M;  1OTR A;  1Q3B A;  4CJ6 A;  8CAT A;  2R62 A;  2EO2 A;  2R6F A;  4R71 A;  2HKJ A;  3GLF E;  2HHH M;  4LJA A;  5DNY A;  1IQP A;  2KDL A;  2QP9 X;  2XEP A;  1OIZ A;  2LTU A;  4KT0 F;  1GL6 A;  3QAU A;  4IBE A;  4WW0 A;  3WHL A;  3LVV A;  1NV8 A;  1QUS A;  2H1R A;  3H4M A;  4I81 A;  1QVR A;  2F5N A;  4G4O A;  4MGH A;  3UGJ A;  3KSX A;  1QAM A;  1QZE A;  4GC5 A;  1HR0 M;  2JY6 B;  4IBC A;  4DV6 M;  3UMM A;  3D8B A;  4LRS A;  4B7G A;  2XF3 A;  3DOA A;  1OAI A;  2KHH A;  2LWX A;  4Q7J A;  7CAT A;  1RU3 A;  4X62 M;  4IBI A;  5JI2 E;  2LVA A;  1DV0 A;  1N36 M;  5FTN A;  1SXJ B;  2OOB A;  4GRI A;  1E9S A;  2UUC M;  1LTM A;  3KOX E;  5FLX S;  3KDS E;  1YLA A;  2J7N A;  3VLF B;  3QWL A;  4QNR A;  3Q8X A;  2J7O A;  1HJP A;  1IXS A;  1VQ1 A;  1CUK A;  1QAQ A;  4IJE A;  3K9P A;  3J81 S;  3EIH A;  2CEA A;  1L8Q A;  2K0B X;  3DA1 A;  4FWH A;  3BXW A;  1DO0 A;  4FWG A;  2C99 A;  2VII A;  2DWN A;  3HJS A;  3KOZ E;  3U60 A;  2DAM A;  4NXN M;  3E46 A;  1A5T A;  4AG6 A;  4DR6 M;  3MMP A;  1C7Y A;  1N75 A;  2H5X A;  1TH4 A;  1E32 A;  4X66 M;  3Q8G A;  3VDP A;  2V1U A;  3U6S A;  1HT2 E;  3V76 A;  2KW0 A;  3CF6 E;  3FYC A;  2G8L A;  2KZS A;  1PRB A;  2R0I A;  3E21 A;  3GPX A;  3VK7 A;  5FTJ A;  3RGP A;  2V1C A;  3NWL A;  1Z6T A;  1I4W A;  1XXH B;  4HLQ A;  3SBJ A;  5A2Q S;  2KNZ A;  4TUW A;  4YY3 M;  2Y0T A;  2GQF A;  3SHG B;  2Z4S A;  4DBG B;  2DAK A;  2KA6 B;  4OX9 M;  3LMM A;  4QNM A;  1E9R A;  4LF7 M;  4WP2 A;  4FWD A;  3GPU A;  4LZJ A;  5EP4 A;  4LJ7 A;  2UU9 M;  2EKF A;  4R7G A;  4NL4 H;  1D0M A;  4AG5 A;  1E94 E;  4QOZ C;  1XHB A;  2KZU A;  2D7H A;  4PD2 A;  4RF1 A;  4F2L A;  4LRT A;  3L26 A;  3NBI A;  2F5O A;  3AV0 A;  1TH2 A;  1VG5 A;  2BJV A;  3BBZ A;  4XBO A;  4M0W A;  2CHV A;  3I4Y A;  4RNA A;  4LFC M;  1WIV A;  2JXN A;  4B7F A;  3GRR A;  2VQF M;  3JR5 A;  1UM8 A;  4WUR A;  4JV5 M;  2L2D A;  4GKK M;  4G4N A;  4RKU F;  4S12 A;  5FTL A;  3ZC7 B;  1J7K A;  2FH0 A;  4DR2 M;  5IT9 S;  2Q2E B;  3GLH E;  2QNJ A;  3TL4 X;  1PGY A;  3B9P A;  2G3Q A;  1YUB A;  3RE8 A;  1FNN A;  3W67 A;  4AKH A;  2LVN C;  2DEN A;  1IFY A;  2OOA A;  3M6A A;  1QDR A;  1IN8 A;  1DGF A;  3AOE A;  2BWB A;  2G5G X;  2FOI C;  2XSZ D;  3KP1 E;  4G6Z A;  3UZU A;  5KQ8 A;  3AKZ A;  4DUZ M;  1I94 M;  1T43 A;  2NQ8 C;  3KS4 A;  1SXJ C;  2M60 A;  2WZJ A;  4G3O A;  5FSW A;  3GO8 A;  2CWB A;  3PFI A;  4MH0 E;  2F5P A;  1G8P A;  1G71 A;  1IXS B;  4MM3 B;  1IBL M;  4G4R A;  3T15 A;  3RFW A;  1JR3 D;  1LV7 A;  4CGY B;  2FFJ A;  1L1Z A;  4JI7 M;  1ZV1 A;  2YFQ A;  2YQZ A;  2K6B A;  3KS8 A;  2R18 A;  1QAO A;  1HT1 E;  1N32 M;  1G3I A;  1NJG A;  4CIZ A;  3U60 B;  5EXX A;  1W5S A;  2MGW A;  1BVS A;  1XNQ M;  3CF0 A;  5IWA M;  1GAB A;  2JZ1 A;  3J27 B;  4IBB A;  2L7I A;  1IN4 A;  1IN5 A;  3TWM A;  1IY2 A;  4PCZ A;  1G41 A;  4B08 A;  3IG5 A;  4B3M M;  3K1J A;  3GLG B;  3ILK A;  4IBF A;  4PT5 A;  4XK8 F;  4JI0 M;  3W0L B;  2UXC M;  5KQD A;  2CHG A;  3GRV A;  2HL7 A;  1ORY B;  2RKO A;  4BBA A;  1Z59 A;  3SYL A;  1WGL A;  3DFZ A;  1FJG M;  1IBM M;  3GRU A;  5C1B A;  4FCV A;  1HQY E;  2DZN B;  2R45 A;  3FRI A;  4DV4 M;  3AFH A;  1SXJ E;  3J7B A;  3HU3 A;  1L2B A;  3CF2 A;  4II7 A;  4X64 M;  4DR3 M;  2QSF X;  2VDB B;  1TGU A;  1VEK A;  3H4J A;  2ZTD A;  2DZO B;  2F5Q A;  1TH3 A;  1IBK M;  4JI8 M;  2EKK A;  1V33 A;  4L78 A;  3W68 A;  1PJS A;  2KRU A;  1ZQ9 A;  2L4F A;  1GJT A;  4LJ4 A;  3HX3 A;  4GHA A;  2V6Z M;  4QHT A;  4A3V B;  4B3R M;  3BOS A;  5H37 D;  2K9D A;  3VKG A;  3I01 M;  3IEC A;  2XFT A;  3L27 A;  1R4G A;  1MJG M;  2DWM A;  3PNV A;  2M5Z A;  1WHC A;  4L4U A;  5JI3 E;  4LF9 M;  1DGB A;  3QYE A;  2RGO A;  3KOW E;  1KSF X;  2CRU A;  1NO1 A;  1WR1 B;  2XSZ A;  4LJ6 A;  5EP3 A;  3B89 A;  2HCB A;  1UFZ A;  3J7A S;  2JY7 A;  5DYI A;  1HNW M;  1XXH E;  2K47 A;  1ZMV A;  3E9S A;  3T38 A;  3T1Y M;  2CV2 A;  1JR3 A;  1AIP C;  3GQ3 A;  2QZ4 A;  3GP1 A;  3VK8 A;  3HJQ A;  2ZAO A;  1NY5 A;  2JY8 A;  2MRO B;  4JYA M;  1KYI A;  2FS1 A;  3NBX X;  1PJI A;  4Z6Y A;  2VQE M;  4M9S A;  2XFS A;  3UJN A;  1L2C A;  3D8L A;  1OAO C;  1NHW C;  1OFH A;  1GVN A;  2KRK A;  3HU1 A;  1L2D A;  4DR7 M;  4Y28 F;  4MGZ E;  1HNZ M;  2LVQ D;  1Z5A A;  1MX0 A;  4LF4 M;  1DGH B;  2ERC A;  2R46 A;  3CTW B;  3TQS A;  4LG2 A;  2E5L M;  3U61 A;  3GLI A;  1VDD A;  2BWE A;  2LXE A;  4PDI A;  1N77 A;  1OKS A;  4L16 A;  4K0K M;  1D0K A;  4NXM M;  4IBG A;  2Z8Y M;  3B7Q A;  4QOS A;  3TWL A;  4W5W A;  4REZ A;  4EIW A;  5L8R F;  2UUB M;  1K3W A;  5GKN A;  3FYD A;  4XGI A;  3MHV C;  4F1I A;  1XNR M;  3KOY E;  1EE8 A;  3FD9 A;  3SMS A;  1Y8G A;  5ITX A;  3JAM S;  3AOG A;  4KHP M;  3FTC A;  3WHK A;  3FRH A;  3F92 A;  4AZF A;  4DR5 M;  2O25 A;  1X37 A;  3RGS A;  3GRY A;  3HZJ A;  3C9P A;  1IY1 A;  3ZCB B;  4AW4 A;  2DWZ B;  3JR4 A;  2YNM D;  3FUT A;  2CV1 A;  4B7H A;  1XMQ M;  3FTE A;  3FTF A;  1Q39 A;  2DAI A;  2JP7 A;  3HHW A;  1ZMW A;  2R4E A;  4LJ8 A;  3GPP A;  2R65 A;  2O5R A;  3HY5 A;  2F4V M;  4PDG A;  3R9X B;  2QQ8 A;  4FD2 A;  2DXI A;  1Q02 A;  1W5T A;  2BNK A;  3AL0 C;  2LVP C;  1XB2 B;  2JWS A;  4MGK E;  3GLF A;  4GKJ M;  3IHP A;  1IN6 A;  1V92 A;  3CGW A;  1IXZ A;  2J5Y A;  3HHZ A;  4JXJ A;  2QPA A;  5EP1 A;  4JI3 M;  4B3T M;  3KXE C;  4OW0 A;  1NNU C;  2CHQ A;  4OU7 A;  5ITR A;  1OJL A;  1SG9 A;  4NRW A;  4D80 A;  3GLG E;  1IXR C;  1OIP A;  2KXE A;  4KO8 A;  5EP2 A;  1NJF A;  1EFU B;  2KNV A;  1G59 A;  2RGH A;  3U6O A;  4CIS A;  1NSF A;  4ZPX A;  3SHF A;  5DFL A;  3K2L A;  3LQQ A;  1WJ7 A;  3HKP A;  2DAG A;  4NOO B;  4P17 A;  2C9O A;  3FUU A;  4AI6 A;  1C1K A;  4DV1 M;  2A5Y B;  2DHR A;  2APL A;  4L15 A;  1MN3 A;  2W82 A;  2ZTC A;  2JUJ A;  2L4E A;  4LFA M;  3SC3 A;  2C9C A;  1NY6 A;  2CUZ A;  4GIP A;  3A42 A;  4HEO A;  4IBJ A;  4M9X A;  4NSO B;  1R6B X;  3KVW A;  4I5S A;  1Z5C A;  5ITY A;  2DHY A;  4FW9 A;  1TDH A;  1VDL A;  4IBK A;  4GMQ A;  2XGN A;  1PM5 A;  5EJC A;  1IY0 A;  2WSC F;  4I4L A;  3K8Z A;  1NHG C;  3LCU A;  3SMP A;  4DUY M;  3U5Z A;  1R2Z A;  1KFV A;  1MU5 A;  4LY6 A;  4DV2 M;  1QZM A;  1VEJ A;  2EJS A;  3GQ5 A;  2OO9 A;  3U61 B;  3GLI B;  2CE7 A;  3B74 A;  2C98 A;  3I04 M;  4M9Z A;  5BPV A;  1N33 M;  3EIE A;  3IG8 A;  1J09 A;  3K9O A;  3K92 A;  2DZL A;  4QHS A;  5ITQ A;  1Q3C A;  3C3E A;  3J2P B;  3HJ8 A;  5ITT A;  1PJJ A;  1VEG A;  4D82 A;  1GLN A;  2ZAN A;  4FVM A;  4JI4 M;  2MH8 A;  2XZU A;  3FUX A;  3KSJ A;  3L29 A;  3ZQJ A;  2Z3X A;  2UXD M;  3M0E A;  3PNY A;  4AKG A;  3C58 A;  4DV5 M;  1K3X A;  1JB0 F;  5E26 A;  2I7N A;  3SAR A;  2KEB A;  2JZ0 A;  3OTO M;  1HQC A;  1SXJ D;  4B3S M;  1QUT A;  2RRU A;  4NC6 A;  3L2A A;  2Z7J A;  4R3D A;  2JY5 A;  2LHG A;  4MGY E;  1YE9 A;  4LGY A;  2GNO A;  2VF8 A;  3A46 A;  4AKI A;  5F3W A;  4I8O A;  1GL7 A;  3SAU A;  1R7R A;  3GLF B;  2UXB M;  4NSR A;  2QCU A;  3HU2 A;  2X8A A;  2QBY A;  4LF5 M;  2DI0 A;  3B7N A;  3GLH A;  3U6P A;  1NNJ A;  1IM2 A;  4LJ5 A;  3SAT A;  1S3S A;  1PJT A;  2CFO A;  3FE3 A;  5KO3 A;  2C5R A;  4DV7 M;  5IRE B;  4AQY M;  1XC8 A;  5FTK A;  3HWS A;  1D0L A;  4OVZ A;  3U6C A;  3MK6 A;  3DZD A;  4BB9 A;  2OPF A;  1K82 A;  2B3T A;  3GPY A;  1J5E M;  4L6V 6;  1T3T A;  4FCW A;  5EQT A;  2VF7 A;  2DKL A;  1R2Y A;  3I51 A;  3L25 A;  2O01 F;  5LMN M;  2D7E A;  2BJW A;  1JQJ C;  3KP0 E;  3M7G A;  3VDU A;  3SAS A;  2R4J A;  2KNA A;  1OFI A;  1R5L A;  2MR9 A;  3GLG A;  4JI6 M;  1PJQ A;  2Y20 A;  3LVW A;  4GEW A;  2WSF F;  4LJ9 A;  3FKE A;  2UUA M;  2DVW B;  1IN7 A;  1QAN A;  2QEN A;  4LF6 M;  4GC9 A;  3SYK A;  2XH9 A;  1OQY A;  2LVO C;  2ZAM A;  3FUV A;  1ZMU A;  2WSE F;  5E6J A;  4UN2 B;  1XMO M;  4X65 M;  1TTE A;  3U5Z B;  4MGI E;  5ITU A;  4ANR A;  2DWL A;  1EIJ A;  2R44 A;  3LCV B;  4DV0 M;  1DGG A;  2D7G A;  3LQR A;  4LCB A;  4DR1 M;  2FNA A;  3A45 A;  1G4A E;  1D2N A;  4HL4 A;  5KPR A;  3TE6 A;  2EA0 A;  3VFD A;  1L1T A;  2P5T A;  3R8F A;  4Z8X A;  4FCT A;  5EXP A;  3U6L A;  4LF8 M;  2Z4R A;  4L8R C;  5C18 A;  2X49 A;  4M0D A;  4LGM A;  1SXJ A;  1ZAE A;  1AUA A;  3U6M A;  3E4R A;  2LBC A;  3QYB A;  4MB7 A;  2ZBK B;  2CP8 A;  2HWJ A;  5EXS A;  2OQ4 A;  3TWK A;  1JR3 E;  3A98 B;  4JI1 M;  4LFB M;  2LHC A;  4D81 A;  4YHH M;  2JNH A;  5EXT A;  3UK6 A;  3GQ4 A;  3FUW A;  4GHL A;  4P16 A;  5FTM A;  2L09 A;  3U6D A;  3T1H M;  3C3D A;  2YR0 A;  1GO5 A;  3TPZ A;  4JN6 A;  4CHT B;  1YSY A;  4JI5 M;  1DO2 A;  4G4Q A;  1N34 M;  3B7Z A;  3HHX A;  3T6P A;  5KPT A;  1HNX M;  1QQW A;  2C96 A;  1GJS A;  3HHY A;  4GH9 A;  4DR4 M;  2L6O A;  3AOE C;  2LH0 A;  5IZ7 D;  2CV0 A;  1GKI A;  2QBY B;  3THG A;  3GLH B;  5DYG A;  2EUC A;  1H6U A;  4DV3 M;  3GLI E;  3ZH9 B;  1WXQ A;  2AHM A;  2JA2 A;  3PVS A;  2N35 A;  2HAK A;  3I4V A;  4GIT A;  2XLJ A;  1QYR A;  1F4I A;  1P3Q Q;  2LNH C;  4NRV A;  1XWI A;  3FTD A;  2I7P A;  1NVM A;  4KOD A;  1XXH A;  2X4A A;  2Y0Q A;  4OVZ B;  3VKH A;  2ZM6 M;  2L7H A;  1N78 A;  3HGI A;  1DGH A;  1QDT A;  2FE8 A;  4IIW A;  2XZF A;  1TDZ A;  3KFU G;  4RF0 A;  4BLC A;  4JI2 M;  3L28 A;  3SFZ A;  4ITQ A;  3W0F A;  5ITX E;  2Y21 A;  4IBD A;  3LW5 F;  4LZZ A;  2MJ5 B;  1TF0 B;  3MJ5 A;  5KPZ A;  3AJI B;  1V34 A;  1Z5B A;  4IJF A;  5LMU M;  3J80 S;  3U6E A;  3SAV A;  1T6O A;  2QHO B;  3KW6 A;  4KLN A;  1NV9 A;  3SAW A;  2DNA A; 
#chains in the Genus database with same CATH homology
 2WZJ A;  2DI0 A;  4F1I A;  2CWB A;  1TR8 A;  2DAE A;  1IM2 A;  1WGN A;  3FE3 A;  1OTR A;  1Y8G A;  4R71 A;  3GLF E;  1ZV1 A;  3FRH A;  3F92 A;  2LTU A;  2O25 A;  1HT1 E;  1G3I A;  2B3T A;  2MGW A;  1BVS A;  1NV8 A;  2DKL A;  2DAI A;  2JP7 A;  1ZMW A;  2JZ1 A;  1QZE A;  2JY6 B;  1OAI A;  2KHH A;  4Q7J A;  2KNA A;  1G41 A;  1Q02 A;  2MR9 A;  2LVP C;  1XB2 B;  2LVA A;  5JI2 E;  1DV0 A;  3IHP A;  4GEW A;  2OOB A;  1V92 A;  1YLA A;  1OQY A;  2LVO C;  1ZMU A;  1HJP A;  1IXS A;  1WGL A;  1VQ1 A;  1CUK A;  1SG9 A;  3K9P A;  4UN2 B;  1HQY E;  3FRI A;  3GLG E;  2K0B X;  1TTE A;  1EFU B;  2KNV A;  1DO0 A;  3LCV B;  2DAM A;  2QSF X;  3E46 A;  1A5T A;  5DFL A;  1VEK A;  3H4J A;  3MMP A;  1C7Y A;  1G4A E;  1WJ7 A;  2ZTD A;  2H5X A;  2DAG A;  2EKK A;  1MN3 A;  1HT2 E;  2L4F A;  2ZTC A;  2JUJ A;  2L4E A;  2LBC A;  2K9D A;  2R0I A;  4HEO A;  2CP8 A;  2HWJ A;  3E21 A;  3IEC A;  1R4G A;  1JR3 E;  2DHY A;  1WHC A;  2JNH A;  1VDL A;  2KNZ A;  3LCU A;  1WR1 B;  2DAK A;  4G3O A;  4DBG B;  3B89 A;  1VEJ A;  2EJS A;  1UFZ A;  1GO5 A;  2OO9 A;  2JY7 A;  4WP2 A;  1DO2 A;  1XXH E;  1ZMV A;  2EKF A;  3K9O A;  2DZL A;  3T6P A;  1AIP C;  1E94 E;  4F2L A;  2JY8 A;  2MRO B;  1KYI A;  1VG5 A;  3BBZ A;  1VEG A;  3GLI E;  1WIV A;  2HAK A;  1F4I A;  1P3Q Q;  2L2D A;  2JZ0 A;  2LVQ D;  3GLH E;  2QNJ A;  1PGY A;  2RRU A;  2G3Q A;  2JY5 A;  2BWE A;  2LVN C;  1OKS A;  2DEN A;  1IFY A;  2MJ5 B;  2OOA A;  2BWB A;  1T6O A;  2QHO B;  1T43 A;  1NV9 A;  2DNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...