2DAEA

Solution structure of the n-terminal cue domain in the human mitogen-activated protein kinase kinase kinase 7 interacting protein 2 (map3k7ip2)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GSSGSSGQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal CUE Domain in the Human Mitogen-activated Protein Kinase Kinase Kinase 7 Interacting Protein 2 (MAP3K7IP2)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA0733 protein
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2daeA00
3IHPA 1XXHE 2O25A 1G3IA 1DO0A 1WJ7A 2DAMA 1VQ1A 2EKKA 3T6PA 1IM2A 1DO2A 1ZMVA 3GLGE 1DV0A 1G41A 2MROB 2ZTDA 2DNAA 2MGWA 2DAKA 1A5TA 2LVNC 2ZTCA 2JY8A 1YLAA 2DKLA 1HJPA 1NV8A 1VEJA 1CUKA 1UFZA 3BBZA 2BWEA 2LTUA 1VEGA 1TR8A 1MN3A 2H5XA 2JY5A 2DAIA 2L4EA 2LBCA 2K9DA 1ZMUA 2EKFA 1JR3E 2G3QA 1QZEA 2JNHA 2KHHA 2KNAA 2CP8A 3LCVB 1HT1E 3F92A 4DBGB 1VDLA 1OKSA 4R71A 2BWBA 2KNVA 2OOAA 2QHOB 2L4FA 1WHCA 1WGLA 4G3OA 2WZJA 2QNJA 4HEOA 2RRUA 3K9PA 2DHYA 4WP2A 5DFLA 1WIVA 1HQYE 1V92A 2QSFX 3E46A 2B3TA 1KYIA 1WGNA 2MJ5B 2JP7A 1NV9A 1TTEA 3K9OA 1IFYA 4GEWA 2HAKA 1ZV1A 3LCUA 4F1IA 3FRHA 4Q7JA 2LVOC 2OO9A 4UN2B 2EJSA 1SG9A 2R0IA 2LVAA 2HWJA 1E94E 1R4GA 1T43A 1VG5A 1XB2B 1WR1B 2L2DA 3GLFE 2JZ1A 3E21A 2K0BX 4F2LA 3FE3A 2MR9A 3H4JA 2JY7A 3GLIE 3FRIA 1Q02A 1AIPC 3B89A 1OAIA 2JZ0A 5JI2E 1T6OA 1PGYA 1F4IA 2DZLA 2JUJA 3MMPA 2DI0A 1G4AE 1IXSA 1OQYA 2OOBA 1HT2E 1GO5A 3IECA 2LVPC 2LVQD 2DAGA 1EFUB 2JY6B 2KNZA 1ZMWA 2DAEA 1VEKA 1Y8GA 1OTRA 1C7YA 2CWBA 1BVSA 3GLHE 2DENA 1P3QQ
chains in the Genus database with same CATH superfamily
4DV6M 2V6ZM 4FVMA 4OW0A 1MU5A 2O25A 4LZZA 3TL4X 2J7OA 1PM5A 4JYAM 4CGYB 5BR8M 1YUBA 2WSCF 3UGJA 2M5ZA 1VQ1A 2G8LA 3HJ8A 4PDGA 1GKIA 1J7KA 1ZMVA 1V33A 3HY5A 4DV1M 3GRRA 2KRKA 2H1RA 4XBOA 2Z3XA 2VF8A 4GRIA 5C18A 4DUZM 2UUAM 2R46A 4DR5M 3RGSA 1YLAA 2JXNA 1NV8A 3LVVA 1VEJA 1CUKA 1UFZA 3RE8A 1J09A 4DUYM 2C5RA 1TR8A 1MN3A 2Z8YM 3C9PA 5BPVA 3ZH9B 1YSYA 3A42A 3GLGA 4WURA 1ZMUA 2XF3A 1G8PA 3LQQA 3K2LA 3PNVA 3AL0C 1OIPA 1DGGA 2VQEM 3HGIA 1QZEA 1KFVA 4X66M 4LRSA 4BB9A 4NL4H 2KNAA 3LCVB 3F92A 4GH9A 2O5RA 4DBGB 4LJ7A 5FLXS 2QENA 2KNVA 3A98B 2QHOB 4CHTB 5KPRA 5KQ8A 3SARA 1JR3A 4G3OA 1NY6A 1R6BX 3GRVA 4HLQA 1IBLM 2GNOA 4HEOA 2KRUA 3KP1E 1IBMM 3K9PA 3KP0E 1N33M 2DHYA 2XFSA 3PVSA 3VK7A 1HQYE 1SXJC 2HL7A 2MH8A 4OU7A 4G4RA 3E46A 1L1ZA 4L8RC 3MK6A 1QDTA 3UZUA 3OTOM 3U6EA 2LWXA 1N34M 1EIJA 2RKOA 3FD9A 5ITXA 1L2BA 4DV0M 3HHYA 2MJ5B 3ILKA 3U6LA 1GL6A 3QWLA 5JI3E 1NHGC 1TTEA 2L09A 3K9OA 4L78A 4A3VB 1IFYA 3SFZA 3T1YM 4NSOB 4G4OA 4G6ZA 1TGUA 4IIWA 3CGWA 2OO9A 2ZAOA 4UN2B 5EXXA 5IREB 4LG2A 2EJSA 4ITQA 3KFUG 2HKJA 2LVAA 4PT5A 1NVMA 5ITXE 3M0EA 1TDHA 4TUWA 2KA6B 3MJ5A 1E94E 3GP1A 2LH0A 2G5GX 3C3DA 3ZC7B 2K47A 2GQFA 4JN6A 5DNYA 1DGHA 2P5TA 4QNMA 2MR9A 2XZUA 1GVNA 4FW9A 2JY7A 3ZCBB 3FRIA 3I01M 4GITA 3GQ3A 1QUSA 1H6UA 3FKEA 3Q8XA 1J5EM 3W0FA 2CFOA 3H4MA 3HKPA 3B89A 3VKGA 3B7NA 1OAIA 3A46A 1C1KA 4LGMA 3VDPA 3TWMA 2XLJA 3SAWA 1SXJD 4D82A 5KPZA 2V1CA 1T6OA 3EIHA 3AOEA 5F3WA 2JUJA 3QYBA 4MGKE 4LGYA 4NXNM 2OOBA 3FTCA 3GRYA 4QHTA 2QBYB 3IECA 3NBIA 7CATA 1G59A 4KHPM 4FCVA 2VF7A 2KW0A 1Z5CA 2LVPC 3GQ5A 2V1UA 3KSXA 4AG6A 4CJ6A 3IG8A 2KNZA 4I4LA 2DAEA 4BBAA 1R2ZA 3V76A 3FTFA 2YNMD 3I04M 2XH9A 1JB0F 2C9CA 4DV4M 4L15A 1PRBA 2C9OA 1QYRA 4JI8M 3M7GA 4NC6A 4G4NA 2R62A 4MB7A 4IBKA 3HHXA 4LF8M 4LJ8A 2NQ8C 2DENA 2I7NA 2F5SA 3WHKA 3J81S 1XWIA 3KW6A 3KOZE 3GPYA 1DGHB 5E26A 5EQTA 1WJ7A 2DAMA 5FTKA 2QBYA 4Z6YA 3GPPA 2Q2EB 3T6PA 1PJIA 3U61B 4B3MM 3GLGE 4ANRA 1DV0A 3D8BA 3DFZA 2MROB 3BOSA 1XXHB 2DAKA 3HWSA 1XHBA 2R4JA 4FWGA 4QOSA 2LVNC 2ZTCA 2JY8A 1D2NA 1QAMA 4HL4A 1D0LA 4JI4M 2L6OA 4LJ6A 3BBZA 4G4QA 4JI5M 1SXJE 2JY5A 2BJVA 2O01F 3FUWA 2L4EA 3CTWB 4M0WA 2CHGA 2FE8A 5FTLA 1N78A 1L1TA 5IT9S 2D7GA 2EKFA 1JR3E 3TWKA 1Z5AA 2N35A 1NNUC 3HX3A 1QANA 1K3WA 2JNHA 2KHHA 3KVWA 1SXJA 2K6BA 1HT1E 4I8OA 4WW0A 3T38A 1OKSA 1ZAEA 4JXJA 4YY3M 2BWBA 2ZAMA 2CV0A 3SASA 3UK6A 3J7AS 2R65A 1WHCA 2UUCM 1NJGA 5KO3A 2RRUA 3FYDA 3SHGB 3VLFB 4S12A 4WP2A 2DHRA 1WIVA 4MGYE 1HR0M 3FUVA 3J2PB 2AHMA 4FD2A 2RGHA 1NJFA 1WGNA 2XGNA 2Z4RA 1TH4A 3UJNA 5ITTA 5EXPA 3SYLA 2FNAA 4GEWA 1Z59A 2A5YB 4RKUF 4OX9M 1IY0A 3E4RA 2LNHC 5EXTA 4M9XA 2QZ4A 4AZFA 5ITRA 2HCBA 1L2DA 3FRHA 3W67A 1YE9A 2JA2A 1EE8A 4PDIA 1SXJB 1KSFX 2R0IA 2YFQA 4GIPA 4DR7M 2F5PA 3LMMA 1E32A 2L2DA 2J5YA 3SC3A 4W5WA 4GHLA 1IXSB 1NY5A 3TQSA 1TH3A 4F2LA 2DXIA 3NWLA 3H4JA 5ITYA 1TH2A 3L2AA 4YHHM 1FNNA 3GLIE 1X37A 4AKIA 2L7IA 1Q02A 1OFHA 4LZJA 1MJGM 4NOOB 1DGBA 2WSEF 4L16A 3W0LB 1T3TA 1L2CA 4LF4M 3I4VA 1XNQM 1QVRA 3RFWA 2XEPA 3QYEA 3L28A 4R7GA 4Z8XA 3MMPA 1G4AE 1OQYA 4IJEA 3VKHA 1QDRA 1DGFA 2D7EA 1HT2E 1XMOM 1HNWM 2DVWB 1GO5A 1W5TA 3DZDA 1R7RA 2JWSA 2KZSA 3K8ZA 2F5NA 2CUZA 1NSFA 1E9SA 4NSRA 3I51A 5EP4A 1C7YA 1OIZA 2ERCA 2EA0A 2M60A 5LMUM 1Z6TA 3GLHB 3SBJA 5ITQA 3GRUA 1P3QQ 2R45A 3U6OA 5EP3A 3IHPA 5IWAM 1OFIA 1XXHE 4MM3B 3CF2A 3B7QA 2OPFA 4B3RM 1QAOA 3KDSE 4DV7M 1G3IA 3U5ZB 2CV2A 4LFBM 3RGPA 3AJIB 3HU3A 4IBJA 2QCUA 3PNYA 2EKKA 4AKHA 2W82A 1DO2A 2C99A 4X64M 3FUUA 2VQFM 2HHHM 1Q3BA 3IG5A 2D7HA 3ZQJA 4JI1M 1G41A 2ZTDA 1MX0A 2DNAA 3U6MA 4L6V6 1A5TA 3TWLA 1HJPA 3B9PA 4II7A 5FTMA 2LTUA 1VEGA 2Y21A 3C3EA 2LBCA 1R2YA 2CE7A 2XSZA 4REZA 1S3SA 2R4EA 4MGIE 3GPUA 4D80A 4DV3M 2I7PA 5H37D 2DZNB 2G3QA 3FTEA 3GLIB 3I4YA 4OVZB 1LV7A 4LJAA 1TF0B 3GLFB 4R71A 1GJSA 3HHWA 2OOAA 3MHVC 5EXSA 3L25A 1I4WA 5FTNA 2QQ8A 3KOXE 1HQCA 2WZJA 4IBCA 1K82A 4QHSA 4IBDA 3U61A 3NBXX 4B7FA 5DFLA 4KLNA 5EJCA 3KXEC 4LF5M 3J80S 1IN5A 4QNRA 3L29A 1KYIA 2QPAA 3QAUA 4M9SA 2Y0TA 1N36M 1NO1A 3BXWA 4AI6A 2JP7A 4B7GA 1NV9A 2R18A 2FS1A 2FOIC 4XGIA 2HAKA 2R44A 2X4AA 4OVZA 1ZV1A 1ZQ9A 3LCUA 3JR4A 4GKJM 2APLA 4B3TM 5GKNA 4KT0F 2LVOC 2Z4SA 3U6DA 3GLIA 1IBKM 3AFHA 3FUXA 8CATA 1SG9A 4DR1M 2HWJA 3TE6A 4AQYM 1QZMA 3U6SA 2DWZB 4KODA 1R4GA 1VG5A 1XB2B 3GLFE 1WR1B 3VK8A 4I81A 1PJJA 2JZ1A 3E21A 2K0BX 3PFIA 4JI6M 1HNZM 3SAUA 1IY2A 3HU1A 4LJ5A 4PCZA 4PD2A 4GC9A 1UM8A 3R8FA 4RF0A 1XC8A 4JV5M 3M6AA 2Z7JA 1AIPC 5EP1A 4LRTA 2UUBM 1FJGM 1OAOC 4K0KM 4IBEA 1IN8A 3FTDA 5JI2E 3AOEC 1PGYA 4IBBA 1F4IA 2X8AA 2ZM6M 3HU2A 1V34A 2DI0A 4FCWA 1IXSA 4MGZE 4AKGA 2LXEA 4MH0E 4RNAA 5C1BA 3FUTA 3K92A 1HNXM 3GLHA 2WSFF 1LTMA 1Q39A 2ZBKB 4IBGA 2LVQD 3U6QA 2DAGA 1NHWC 1XXHA 2L7HA 2JY6B 2LHCA 4FWHA 4FWDA 4AW4A 3GLGB 3SYKA 3L26A 3R9XB 4DV2M 1VEKA 1Y8GA 3CF6E 1OTRA 4Y28F 4DV5M 3SMSA 4LJ4A 4B7HA 1IXZA 4CIZA 2FFJA 5KPTA 3KS8A 4GC5A 1BVSA 4D81A 4IJFA 3UMMA 1Z5BA 3GLHE 4NRVA 3K1JA 4XK8F 4JI2M 3E9SA 1N75A 2DZOB 2DWMA 1DO0A 3GO8A 3J27B 2CV1A 3SATA 3GPXA 1IM2A 1L8QA 3SMPA 3L27A 1IN6A 4EIWA 3GQ4A 3KSJA 4LFCM 2RGOA 3HJQA 4JI3M 1D0MA 2E5LM 2MGWA 4LY6A 1TDZA 2XSZD 3B74A 4B3SM 1N32M 4RF1A 4DR2M 2DKLA 3THGA 5FSWA 5FTJA 1R5LA 3LVWA 1IY1A 2BWEA 2CHQA 4AG5A 1D0KA 2H5XA 2DAIA 4M0DA 2FH0A 3U5ZA 2UXBM 2K9DA 2DWNA 1PJTA 3KOWE 4IBFA 5ITUA 3B7ZA 2EUCA 3HZJA 2CEAA 3SAVA 1QAQA 4I5SA 4JI0M 2UU9M 5DYIA 1JR3D 3T1HM 4ZPXA 2ZANA 3FYCA 1Q3CA 4X62M 3HJSA 2CP8A 3D8LA 4L4UA 5IZ7D 1VDLA 1K3XA 3HHZA 2XZFA 1IXRC 2L4FA 4LF9M 4DR6M 5KQDA 4GKKM 1WGLA 2YR0A 4M9ZA 3PXGA 4LF7M 1N77A 2EO2A 2QNJA 3VFDA 1WXQA 3A45A 3U6PA 3AOGA 5L8RF 2Y0QA 2KZUA 2YQZA 3U60B 3T15A 1V92A 2QSFX 2BJWA 2B3TA 1AUAA 2KXEA 3SHFA 4KO8A 2C98A 2OQ4A 3DOAA 4MGHA 3GLFA 4NXMM 4LFAM 3EIEA 1ORYB 1OJLA 2Y20A 3LQRA 4F1IA 4LF6M 4LJ9A 2XFTA 1QUTA 3VDUA 4DR4M 1NNJA 3KOYE 4Q7JA 1I94M 4LCBA 4X65M 2X49A 2QP9X 4BLCA 1T43A 5EP2A 2CRUA 3U60A 1W5SA 1E9RA 3FE3A 3AV0A 2VIIA 1QQWA 2BNKA 5DYGA 4CISA 1GLNA 5A2QS 4FCTA 3LW5F 3W68A 3TPZA 3WHLA 2F5OA 4IBIA 2F5QA 2LHGA 5E6JA 4P16A 1IN7A 1VDDA 1JQJC 1GL7A 2JZ0A 1GABA 2VDBB 1PJSA 2C96A 4GMQA 2DZLA 3J7BA 4NRWA 2DWLA 4B08A 1G71A 4P17A 4QOZC 1XNRM 4DR3M 2CHVA 1IQPA 4R3DA 1PJQA 3U6CA 2KEBA 5LMNM 2UXDM 3KS4A 2R6FA 3CF0A 1EFUB 1ZMWA 3AKZA 3DA1A 1GJTA 4GHAA 4JI7M 2UXCM 3JAMS 1IN4A 2CWBA 2J7NA 3JR5A 3C58A 1XMQM 2F4VM 1RU3A 3Q8GA 2KDLA
chains in the Genus database with same CATH topology
3IHPA 1XXHE 2O25A 1G3IA 1DO0A 1WJ7A 2DAMA 1VQ1A 2EKKA 3T6PA 1IM2A 1DO2A 1ZMVA 3GLGE 1DV0A 1G41A 2MROB 2ZTDA 2DNAA 2MGWA 2DAKA 1A5TA 2LVNC 2ZTCA 2JY8A 1YLAA 2DKLA 1HJPA 1NV8A 1VEJA 1CUKA 1UFZA 3BBZA 2BWEA 2LTUA 1VEGA 1TR8A 1MN3A 2H5XA 2JY5A 2DAIA 2L4EA 2LBCA 2K9DA 1ZMUA 2EKFA 1JR3E 2G3QA 1QZEA 2JNHA 2KHHA 2KNAA 2CP8A 3LCVB 1HT1E 3F92A 4DBGB 1VDLA 1OKSA 4R71A 2BWBA 2KNVA 2OOAA 2QHOB 2L4FA 1WHCA 1WGLA 4G3OA 2WZJA 2QNJA 4HEOA 2RRUA 3K9PA 2DHYA 4WP2A 5DFLA 1WIVA 1HQYE 1V92A 2QSFX 3E46A 2B3TA 1KYIA 1WGNA 2MJ5B 2JP7A 1NV9A 1TTEA 3K9OA 1IFYA 4GEWA 2HAKA 1ZV1A 3LCUA 4F1IA 3FRHA 4Q7JA 2LVOC 2OO9A 4UN2B 2EJSA 1SG9A 2R0IA 2LVAA 2HWJA 1E94E 1R4GA 1T43A 1VG5A 1XB2B 1WR1B 2L2DA 3GLFE 2JZ1A 3E21A 2K0BX 4F2LA 3FE3A 2MR9A 3H4JA 2JY7A 3GLIE 3FRIA 1Q02A 1AIPC 3B89A 1OAIA 2JZ0A 5JI2E 1T6OA 1PGYA 1F4IA 2DZLA 2JUJA 3MMPA 2DI0A 1G4AE 1IXSA 1OQYA 2OOBA 1HT2E 1GO5A 3IECA 2LVPC 2LVQD 2DAGA 1EFUB 2JY6B 2KNZA 1ZMWA 2DAEA 1VEKA 1Y8GA 1OTRA 1C7YA 2CWBA 1BVSA 3GLHE 2DENA 1P3QQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHP A;  1XXH E;  2O25 A;  1G3I A;  1DO0 A;  1WJ7 A;  2DAM A;  1VQ1 A;  2EKK A;  3T6P A;  1IM2 A;  1DO2 A;  1ZMV A;  3GLG E;  1DV0 A;  1G41 A;  2MRO B;  2ZTD A;  2DNA A;  2MGW A;  2DAK A;  1A5T A;  2LVN C;  2ZTC A;  2JY8 A;  1YLA A;  2DKL A;  1HJP A;  1NV8 A;  1VEJ A;  1CUK A;  1UFZ A;  3BBZ A;  2BWE A;  2LTU A;  1VEG A;  1TR8 A;  1MN3 A;  2H5X A;  2JY5 A;  2DAI A;  2L4E A;  2LBC A;  2K9D A;  1ZMU A;  2EKF A;  1JR3 E;  2G3Q A;  1QZE A;  2JNH A;  2KHH A;  2KNA A;  2CP8 A;  3LCV B;  1HT1 E;  3F92 A;  4DBG B;  1VDL A;  1OKS A;  4R71 A;  2BWB A;  2KNV A;  2OOA A;  2QHO B;  2L4F A;  1WHC A;  1WGL A;  4G3O A;  2WZJ A;  2QNJ A;  4HEO A;  2RRU A;  3K9P A;  2DHY A;  4WP2 A;  5DFL A;  1WIV A;  1HQY E;  1V92 A;  2QSF X;  3E46 A;  2B3T A;  1KYI A;  1WGN A;  2MJ5 B;  2JP7 A;  1NV9 A;  1TTE A;  3K9O A;  1IFY A;  4GEW A;  2HAK A;  1ZV1 A;  3LCU A;  4F1I A;  3FRH A;  4Q7J A;  2LVO C;  2OO9 A;  4UN2 B;  2EJS A;  1SG9 A;  2R0I A;  2LVA A;  2HWJ A;  1E94 E;  1R4G A;  1T43 A;  1VG5 A;  1XB2 B;  1WR1 B;  2L2D A;  3GLF E;  2JZ1 A;  3E21 A;  2K0B X;  4F2L A;  3FE3 A;  2MR9 A;  3H4J A;  2JY7 A;  3GLI E;  3FRI A;  1Q02 A;  1AIP C;  3B89 A;  1OAI A;  2JZ0 A;  5JI2 E;  1T6O A;  1PGY A;  1F4I A;  2DZL A;  2JUJ A;  3MMP A;  2DI0 A;  1G4A E;  1IXS A;  1OQY A;  2OOB A;  1HT2 E;  1GO5 A;  3IEC A;  2LVP C;  2LVQ D;  2DAG A;  1EFU B;  2JY6 B;  2KNZ A;  1ZMW A;  2DAE A;  1VEK A;  1Y8G A;  1OTR A;  1C7Y A;  2CWB A;  1BVS A;  3GLH E;  2DEN A;  1P3Q Q; 
#chains in the Genus database with same CATH topology
 4DV6 M;  2V6Z M;  4FVM A;  4OW0 A;  1MU5 A;  2O25 A;  4LZZ A;  3TL4 X;  2J7O A;  1PM5 A;  4JYA M;  4CGY B;  5BR8 M;  1YUB A;  2WSC F;  3UGJ A;  2M5Z A;  1VQ1 A;  2G8L A;  3HJ8 A;  4PDG A;  1GKI A;  1J7K A;  1ZMV A;  1V33 A;  3HY5 A;  4DV1 M;  3GRR A;  2KRK A;  2H1R A;  4XBO A;  2Z3X A;  2VF8 A;  4GRI A;  5C18 A;  4DUZ M;  2UUA M;  2R46 A;  4DR5 M;  3RGS A;  1YLA A;  2JXN A;  1NV8 A;  3LVV A;  1VEJ A;  1CUK A;  1UFZ A;  3RE8 A;  1J09 A;  4DUY M;  2C5R A;  1TR8 A;  1MN3 A;  2Z8Y M;  3C9P A;  5BPV A;  3ZH9 B;  1YSY A;  3A42 A;  3GLG A;  4WUR A;  1ZMU A;  2XF3 A;  1G8P A;  3LQQ A;  3K2L A;  3PNV A;  3AL0 C;  1OIP A;  1DGG A;  2VQE M;  3HGI A;  1QZE A;  1KFV A;  4X66 M;  4LRS A;  4BB9 A;  4NL4 H;  2KNA A;  3LCV B;  3F92 A;  4GH9 A;  2O5R A;  4DBG B;  4LJ7 A;  5FLX S;  2QEN A;  2KNV A;  3A98 B;  2QHO B;  4CHT B;  5KPR A;  5KQ8 A;  3SAR A;  1JR3 A;  4G3O A;  1NY6 A;  1R6B X;  3GRV A;  4HLQ A;  1IBL M;  2GNO A;  4HEO A;  2KRU A;  3KP1 E;  1IBM M;  3K9P A;  3KP0 E;  1N33 M;  2DHY A;  2XFS A;  3PVS A;  3VK7 A;  1HQY E;  1SXJ C;  2HL7 A;  2MH8 A;  4OU7 A;  4G4R A;  3E46 A;  1L1Z A;  4L8R C;  3MK6 A;  1QDT A;  3UZU A;  3OTO M;  3U6E A;  2LWX A;  1N34 M;  1EIJ A;  2RKO A;  3FD9 A;  5ITX A;  1L2B A;  4DV0 M;  3HHY A;  2MJ5 B;  3ILK A;  3U6L A;  1GL6 A;  3QWL A;  5JI3 E;  1NHG C;  1TTE A;  2L09 A;  3K9O A;  4L78 A;  4A3V B;  1IFY A;  3SFZ A;  3T1Y M;  4NSO B;  4G4O A;  4G6Z A;  1TGU A;  4IIW A;  3CGW A;  2OO9 A;  2ZAO A;  4UN2 B;  5EXX A;  5IRE B;  4LG2 A;  2EJS A;  4ITQ A;  3KFU G;  2HKJ A;  2LVA A;  4PT5 A;  1NVM A;  5ITX E;  3M0E A;  1TDH A;  4TUW A;  2KA6 B;  3MJ5 A;  1E94 E;  3GP1 A;  2LH0 A;  2G5G X;  3C3D A;  3ZC7 B;  2K47 A;  2GQF A;  4JN6 A;  5DNY A;  1DGH A;  2P5T A;  4QNM A;  2MR9 A;  2XZU A;  1GVN A;  4FW9 A;  2JY7 A;  3ZCB B;  3FRI A;  3I01 M;  4GIT A;  3GQ3 A;  1QUS A;  1H6U A;  3FKE A;  3Q8X A;  1J5E M;  3W0F A;  2CFO A;  3H4M A;  3HKP A;  3B89 A;  3VKG A;  3B7N A;  1OAI A;  3A46 A;  1C1K A;  4LGM A;  3VDP A;  3TWM A;  2XLJ A;  3SAW A;  1SXJ D;  4D82 A;  5KPZ A;  2V1C A;  1T6O A;  3EIH A;  3AOE A;  5F3W A;  2JUJ A;  3QYB A;  4MGK E;  4LGY A;  4NXN M;  2OOB A;  3FTC A;  3GRY A;  4QHT A;  2QBY B;  3IEC A;  3NBI A;  7CAT A;  1G59 A;  4KHP M;  4FCV A;  2VF7 A;  2KW0 A;  1Z5C A;  2LVP C;  3GQ5 A;  2V1U A;  3KSX A;  4AG6 A;  4CJ6 A;  3IG8 A;  2KNZ A;  4I4L A;  2DAE A;  4BBA A;  1R2Z A;  3V76 A;  3FTF A;  2YNM D;  3I04 M;  2XH9 A;  1JB0 F;  2C9C A;  4DV4 M;  4L15 A;  1PRB A;  2C9O A;  1QYR A;  4JI8 M;  3M7G A;  4NC6 A;  4G4N A;  2R62 A;  4MB7 A;  4IBK A;  3HHX A;  4LF8 M;  4LJ8 A;  2NQ8 C;  2DEN A;  2I7N A;  2F5S A;  3WHK A;  3J81 S;  1XWI A;  3KW6 A;  3KOZ E;  3GPY A;  1DGH B;  5E26 A;  5EQT A;  1WJ7 A;  2DAM A;  5FTK A;  2QBY A;  4Z6Y A;  3GPP A;  2Q2E B;  3T6P A;  1PJI A;  3U61 B;  4B3M M;  3GLG E;  4ANR A;  1DV0 A;  3D8B A;  3DFZ A;  2MRO B;  3BOS A;  1XXH B;  2DAK A;  3HWS A;  1XHB A;  2R4J A;  4FWG A;  4QOS A;  2LVN C;  2ZTC A;  2JY8 A;  1D2N A;  1QAM A;  4HL4 A;  1D0L A;  4JI4 M;  2L6O A;  4LJ6 A;  3BBZ A;  4G4Q A;  4JI5 M;  1SXJ E;  2JY5 A;  2BJV A;  2O01 F;  3FUW A;  2L4E A;  3CTW B;  4M0W A;  2CHG A;  2FE8 A;  5FTL A;  1N78 A;  1L1T A;  5IT9 S;  2D7G A;  2EKF A;  1JR3 E;  3TWK A;  1Z5A A;  2N35 A;  1NNU C;  3HX3 A;  1QAN A;  1K3W A;  2JNH A;  2KHH A;  3KVW A;  1SXJ A;  2K6B A;  1HT1 E;  4I8O A;  4WW0 A;  3T38 A;  1OKS A;  1ZAE A;  4JXJ A;  4YY3 M;  2BWB A;  2ZAM A;  2CV0 A;  3SAS A;  3UK6 A;  3J7A S;  2R65 A;  1WHC A;  2UUC M;  1NJG A;  5KO3 A;  2RRU A;  3FYD A;  3SHG B;  3VLF B;  4S12 A;  4WP2 A;  2DHR A;  1WIV A;  4MGY E;  1HR0 M;  3FUV A;  3J2P B;  2AHM A;  4FD2 A;  2RGH A;  1NJF A;  1WGN A;  2XGN A;  2Z4R A;  1TH4 A;  3UJN A;  5ITT A;  5EXP A;  3SYL A;  2FNA A;  4GEW A;  1Z59 A;  2A5Y B;  4RKU F;  4OX9 M;  1IY0 A;  3E4R A;  2LNH C;  5EXT A;  4M9X A;  2QZ4 A;  4AZF A;  5ITR A;  2HCB A;  1L2D A;  3FRH A;  3W67 A;  1YE9 A;  2JA2 A;  1EE8 A;  4PDI A;  1SXJ B;  1KSF X;  2R0I A;  2YFQ A;  4GIP A;  4DR7 M;  2F5P A;  3LMM A;  1E32 A;  2L2D A;  2J5Y A;  3SC3 A;  4W5W A;  4GHL A;  1IXS B;  1NY5 A;  3TQS A;  1TH3 A;  4F2L A;  2DXI A;  3NWL A;  3H4J A;  5ITY A;  1TH2 A;  3L2A A;  4YHH M;  1FNN A;  3GLI E;  1X37 A;  4AKI A;  2L7I A;  1Q02 A;  1OFH A;  4LZJ A;  1MJG M;  4NOO B;  1DGB A;  2WSE F;  4L16 A;  3W0L B;  1T3T A;  1L2C A;  4LF4 M;  3I4V A;  1XNQ M;  1QVR A;  3RFW A;  2XEP A;  3QYE A;  3L28 A;  4R7G A;  4Z8X A;  3MMP A;  1G4A E;  1OQY A;  4IJE A;  3VKH A;  1QDR A;  1DGF A;  2D7E A;  1HT2 E;  1XMO M;  1HNW M;  2DVW B;  1GO5 A;  1W5T A;  3DZD A;  1R7R A;  2JWS A;  2KZS A;  3K8Z A;  2F5N A;  2CUZ A;  1NSF A;  1E9S A;  4NSR A;  3I51 A;  5EP4 A;  1C7Y A;  1OIZ A;  2ERC A;  2EA0 A;  2M60 A;  5LMU M;  1Z6T A;  3GLH B;  3SBJ A;  5ITQ A;  3GRU A;  1P3Q Q;  2R45 A;  3U6O A;  5EP3 A;  3IHP A;  5IWA M;  1OFI A;  1XXH E;  4MM3 B;  3CF2 A;  3B7Q A;  2OPF A;  4B3R M;  1QAO A;  3KDS E;  4DV7 M;  1G3I A;  3U5Z B;  2CV2 A;  4LFB M;  3RGP A;  3AJI B;  3HU3 A;  4IBJ A;  2QCU A;  3PNY A;  2EKK A;  4AKH A;  2W82 A;  1DO2 A;  2C99 A;  4X64 M;  3FUU A;  2VQF M;  2HHH M;  1Q3B A;  3IG5 A;  2D7H A;  3ZQJ A;  4JI1 M;  1G41 A;  2ZTD A;  1MX0 A;  2DNA A;  3U6M A;  4L6V 6;  1A5T A;  3TWL A;  1HJP A;  3B9P A;  4II7 A;  5FTM A;  2LTU A;  1VEG A;  2Y21 A;  3C3E A;  2LBC A;  1R2Y A;  2CE7 A;  2XSZ A;  4REZ A;  1S3S A;  2R4E A;  4MGI E;  3GPU A;  4D80 A;  4DV3 M;  2I7P A;  5H37 D;  2DZN B;  2G3Q A;  3FTE A;  3GLI B;  3I4Y A;  4OVZ B;  1LV7 A;  4LJA A;  1TF0 B;  3GLF B;  4R71 A;  1GJS A;  3HHW A;  2OOA A;  3MHV C;  5EXS A;  3L25 A;  1I4W A;  5FTN A;  2QQ8 A;  3KOX E;  1HQC A;  2WZJ A;  4IBC A;  1K82 A;  4QHS A;  4IBD A;  3U61 A;  3NBX X;  4B7F A;  5DFL A;  4KLN A;  5EJC A;  3KXE C;  4LF5 M;  3J80 S;  1IN5 A;  4QNR A;  3L29 A;  1KYI A;  2QPA A;  3QAU A;  4M9S A;  2Y0T A;  1N36 M;  1NO1 A;  3BXW A;  4AI6 A;  2JP7 A;  4B7G A;  1NV9 A;  2R18 A;  2FS1 A;  2FOI C;  4XGI A;  2HAK A;  2R44 A;  2X4A A;  4OVZ A;  1ZV1 A;  1ZQ9 A;  3LCU A;  3JR4 A;  4GKJ M;  2APL A;  4B3T M;  5GKN A;  4KT0 F;  2LVO C;  2Z4S A;  3U6D A;  3GLI A;  1IBK M;  3AFH A;  3FUX A;  8CAT A;  1SG9 A;  4DR1 M;  2HWJ A;  3TE6 A;  4AQY M;  1QZM A;  3U6S A;  2DWZ B;  4KOD A;  1R4G A;  1VG5 A;  1XB2 B;  3GLF E;  1WR1 B;  3VK8 A;  4I81 A;  1PJJ A;  2JZ1 A;  3E21 A;  2K0B X;  3PFI A;  4JI6 M;  1HNZ M;  3SAU A;  1IY2 A;  3HU1 A;  4LJ5 A;  4PCZ A;  4PD2 A;  4GC9 A;  1UM8 A;  3R8F A;  4RF0 A;  1XC8 A;  4JV5 M;  3M6A A;  2Z7J A;  1AIP C;  5EP1 A;  4LRT A;  2UUB M;  1FJG M;  1OAO C;  4K0K M;  4IBE A;  1IN8 A;  3FTD A;  5JI2 E;  3AOE C;  1PGY A;  4IBB A;  1F4I A;  2X8A A;  2ZM6 M;  3HU2 A;  1V34 A;  2DI0 A;  4FCW A;  1IXS A;  4MGZ E;  4AKG A;  2LXE A;  4MH0 E;  4RNA A;  5C1B A;  3FUT A;  3K92 A;  1HNX M;  3GLH A;  2WSF F;  1LTM A;  1Q39 A;  2ZBK B;  4IBG A;  2LVQ D;  3U6Q A;  2DAG A;  1NHW C;  1XXH A;  2L7H A;  2JY6 B;  2LHC A;  4FWH A;  4FWD A;  4AW4 A;  3GLG B;  3SYK A;  3L26 A;  3R9X B;  4DV2 M;  1VEK A;  1Y8G A;  3CF6 E;  1OTR A;  4Y28 F;  4DV5 M;  3SMS A;  4LJ4 A;  4B7H A;  1IXZ A;  4CIZ A;  2FFJ A;  5KPT A;  3KS8 A;  4GC5 A;  1BVS A;  4D81 A;  4IJF A;  3UMM A;  1Z5B A;  3GLH E;  4NRV A;  3K1J A;  4XK8 F;  4JI2 M;  3E9S A;  1N75 A;  2DZO B;  2DWM A;  1DO0 A;  3GO8 A;  3J27 B;  2CV1 A;  3SAT A;  3GPX A;  1IM2 A;  1L8Q A;  3SMP A;  3L27 A;  1IN6 A;  4EIW A;  3GQ4 A;  3KSJ A;  4LFC M;  2RGO A;  3HJQ A;  4JI3 M;  1D0M A;  2E5L M;  2MGW A;  4LY6 A;  1TDZ A;  2XSZ D;  3B74 A;  4B3S M;  1N32 M;  4RF1 A;  4DR2 M;  2DKL A;  3THG A;  5FSW A;  5FTJ A;  1R5L A;  3LVW A;  1IY1 A;  2BWE A;  2CHQ A;  4AG5 A;  1D0K A;  2H5X A;  2DAI A;  4M0D A;  2FH0 A;  3U5Z A;  2UXB M;  2K9D A;  2DWN A;  1PJT A;  3KOW E;  4IBF A;  5ITU A;  3B7Z A;  2EUC A;  3HZJ A;  2CEA A;  3SAV A;  1QAQ A;  4I5S A;  4JI0 M;  2UU9 M;  5DYI A;  1JR3 D;  3T1H M;  4ZPX A;  2ZAN A;  3FYC A;  1Q3C A;  4X62 M;  3HJS A;  2CP8 A;  3D8L A;  4L4U A;  5IZ7 D;  1VDL A;  1K3X A;  3HHZ A;  2XZF A;  1IXR C;  2L4F A;  4LF9 M;  4DR6 M;  5KQD A;  4GKK M;  1WGL A;  2YR0 A;  4M9Z A;  3PXG A;  4LF7 M;  1N77 A;  2EO2 A;  2QNJ A;  3VFD A;  1WXQ A;  3A45 A;  3U6P A;  3AOG A;  5L8R F;  2Y0Q A;  2KZU A;  2YQZ A;  3U60 B;  3T15 A;  1V92 A;  2QSF X;  2BJW A;  2B3T A;  1AUA A;  2KXE A;  3SHF A;  4KO8 A;  2C98 A;  2OQ4 A;  3DOA A;  4MGH A;  3GLF A;  4NXM M;  4LFA M;  3EIE A;  1ORY B;  1OJL A;  2Y20 A;  3LQR A;  4F1I A;  4LF6 M;  4LJ9 A;  2XFT A;  1QUT A;  3VDU A;  4DR4 M;  1NNJ A;  3KOY E;  4Q7J A;  1I94 M;  4LCB A;  4X65 M;  2X49 A;  2QP9 X;  4BLC A;  1T43 A;  5EP2 A;  2CRU A;  3U60 A;  1W5S A;  1E9R A;  3FE3 A;  3AV0 A;  2VII A;  1QQW A;  2BNK A;  5DYG A;  4CIS A;  1GLN A;  5A2Q S;  4FCT A;  3LW5 F;  3W68 A;  3TPZ A;  3WHL A;  2F5O A;  4IBI A;  2F5Q A;  2LHG A;  5E6J A;  4P16 A;  1IN7 A;  1VDD A;  1JQJ C;  1GL7 A;  2JZ0 A;  1GAB A;  2VDB B;  1PJS A;  2C96 A;  4GMQ A;  2DZL A;  3J7B A;  4NRW A;  2DWL A;  4B08 A;  1G71 A;  4P17 A;  4QOZ C;  1XNR M;  4DR3 M;  2CHV A;  1IQP A;  4R3D A;  1PJQ A;  3U6C A;  2KEB A;  5LMN M;  2UXD M;  3KS4 A;  2R6F A;  3CF0 A;  1EFU B;  1ZMW A;  3AKZ A;  3DA1 A;  1GJT A;  4GHA A;  4JI7 M;  2UXC M;  3JAM S;  1IN4 A;  2CWB A;  2J7N A;  3JR5 A;  3C58 A;  1XMQ M;  2F4V M;  1RU3 A;  3Q8G A;  2KDL A; 
#chains in the Genus database with same CATH homology
 3IHP A;  1XXH E;  2O25 A;  1G3I A;  1DO0 A;  1WJ7 A;  2DAM A;  1VQ1 A;  2EKK A;  3T6P A;  1IM2 A;  1DO2 A;  1ZMV A;  3GLG E;  1DV0 A;  1G41 A;  2MRO B;  2ZTD A;  2DNA A;  2MGW A;  2DAK A;  1A5T A;  2LVN C;  2ZTC A;  2JY8 A;  1YLA A;  2DKL A;  1HJP A;  1NV8 A;  1VEJ A;  1CUK A;  1UFZ A;  3BBZ A;  2BWE A;  2LTU A;  1VEG A;  1TR8 A;  1MN3 A;  2H5X A;  2JY5 A;  2DAI A;  2L4E A;  2LBC A;  2K9D A;  1ZMU A;  2EKF A;  1JR3 E;  2G3Q A;  1QZE A;  2JNH A;  2KHH A;  2KNA A;  2CP8 A;  3LCV B;  1HT1 E;  3F92 A;  4DBG B;  1VDL A;  1OKS A;  4R71 A;  2BWB A;  2KNV A;  2OOA A;  2QHO B;  2L4F A;  1WHC A;  1WGL A;  4G3O A;  2WZJ A;  2QNJ A;  4HEO A;  2RRU A;  3K9P A;  2DHY A;  4WP2 A;  5DFL A;  1WIV A;  1HQY E;  1V92 A;  2QSF X;  3E46 A;  2B3T A;  1KYI A;  1WGN A;  2MJ5 B;  2JP7 A;  1NV9 A;  1TTE A;  3K9O A;  1IFY A;  4GEW A;  2HAK A;  1ZV1 A;  3LCU A;  4F1I A;  3FRH A;  4Q7J A;  2LVO C;  2OO9 A;  4UN2 B;  2EJS A;  1SG9 A;  2R0I A;  2LVA A;  2HWJ A;  1E94 E;  1R4G A;  1T43 A;  1VG5 A;  1XB2 B;  1WR1 B;  2L2D A;  3GLF E;  2JZ1 A;  3E21 A;  2K0B X;  4F2L A;  3FE3 A;  2MR9 A;  3H4J A;  2JY7 A;  3GLI E;  3FRI A;  1Q02 A;  1AIP C;  3B89 A;  1OAI A;  2JZ0 A;  5JI2 E;  1T6O A;  1PGY A;  1F4I A;  2DZL A;  2JUJ A;  3MMP A;  2DI0 A;  1G4A E;  1IXS A;  1OQY A;  2OOB A;  1HT2 E;  1GO5 A;  3IEC A;  2LVP C;  2LVQ D;  2DAG A;  1EFU B;  2JY6 B;  2KNZ A;  1ZMW A;  2DAE A;  1VEK A;  1Y8G A;  1OTR A;  1C7Y A;  2CWB A;  1BVS A;  3GLH E;  2DEN A;  1P3Q Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...