2DAEA

Solution structure of the n-terminal cue domain in the human mitogen-activated protein kinase kinase kinase 7 interacting protein 2 (map3k7ip2)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GSSGSSGQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0733 protein
publication title Solution Structure of the N-terminal CUE Domain in the Human Mitogen-activated Protein Kinase Kinase Kinase 7 Interacting Protein 2 (MAP3K7IP2)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2daeA00
1WGNA 3H4JA 2KHHA 3B89A 3IHPA 5JI2E 3E21A 3MMPA 2QSFX 2LVNC 1HT1E 1OTRA 2EKKA 1MN3A 1HJPA 2MGWA 1VEJA 1UFZA 1E94E 1OKSA 2CWBA 1IXSA 2DAKA 1JR3E 2QHOB 2ZTDA 1C7YA 1G3IA 2JZ0A 1DO2A 2LVOC 2R0IA 1OAIA 2DAIA 2DHYA 2MROB 1TR8A 2K0BX 2JP7A 1V92A 1F4IA 2L2DA 2DENA 2DZLA 2KNZA 3FRHA 2JY6B 1VG5A 2LTUA 2EKFA 2LBCA 1AIPC 2RRUA 1WGLA 1OQYA 2L4FA 3FE3A 1ZMUA 2WZJA 3FRIA 5DFLA 1PGYA 1VEGA 1NV9A 2HAKA 3K9OA 1CUKA 1QZEA 3BBZA 2JY8A 2LVAA 3GLFE 2K9DA 1ZMVA 2DNAA 1KYIA 4UN2B 1IM2A 2BWBA 3E46A 1XXHE 1WJ7A 1GO5A 2HWJA 1VEKA 4R71A 2DAEA 2G3QA 1T43A 2DAGA 1G4AE 2MR9A 1R4GA 3LCVB 1IFYA 1WHCA 4DBGB 3LCUA 4Q7JA 1HT2E 4F1IA 2KNAA 2OOAA 1YLAA 2MJ5B 3GLHE 2EJSA 3GLGE 1SG9A 1ZV1A 2DAMA 2L4EA 2LVQD 2JUJA 4GEWA 1P3QQ 1DV0A 3K9PA 4HEOA 1BVSA 2BWEA 2JNHA 2DI0A 3T6PA 1EFUB 3GLIE 1G41A 1TTEA 2ZTCA 2H5XA 1Y8GA 1VDLA 1ZMWA 1Q02A 1NV8A 2JY7A 1A5TA 1VQ1A 1HQYE 4WP2A 1DO0A 2QNJA 1WIVA 2OOBA 2B3TA 1WR1B 2OO9A 3IECA 2LVPC 2JY5A 2KNVA 2O25A 2DKLA 4G3OA 4F2LA 3F92A 1T6OA 2CP8A 1XB2B 2JZ1A
chains in the Genus database with same CATH superfamily
3QYEA 4DV5M 1K3WA 3B89A 3GLHA 1R7RA 2LVNC 3LQQA 2KA6B 5GKNA 3SAUA 2BNKA 2MGWA 3FUVA 2FS1A 2CWBA 3VDPA 2G8LA 5FLXS 4DR5M 1JR3E 2QHOB 1FJGM 3TE6A 4JI8M 1G3IA 3HU3A 4LG2A 2QENA 2LVOC 2R0IA 2LHCA 1R2YA 4CIZA 3LQRA 3HHYA 5KPTA 1IY0A 1KSFX 3RGPA 3NBIA 2JP7A 3AFHA 4Z8XA 2VDBB 4CISA 1V92A 4DV4M 4Y28F 3U60B 2DENA 1OIZA 5EP4A 2J5YA 3KS4A 4GMQA 4D80A 3T1YM 4LRTA 1OIPA 2KNZA 3GQ3A 1Z5AA 5ITRA 2R44A 3HHXA 2LBCA 3U60A 1AIPC 2X8AA 1E9RA 4R7GA 1WGLA 5C1BA 4DR3M 1OFHA 2CE7A 1E9SA 1OQYA 2XEPA 1L2DA 4L15A 3FE3A 4AKHA 2FOIC 4M9SA 2LWXA 3KP1E 3T15A 3RFWA 2APLA 4KT0F 4PT5A 3U61A 4PD2A 1HR0M 2RKOA 1CUKA 1LTMA 3HGIA 2L7HA 1JB0F 3BBZA 5DYGA 3UZUA 2K47A 2C9CA 3CF0A 4QNMA 2DNAA 1G8PA 5DNYA 4GKJM 2FH0A 2Y20A 3J80S 2KRUA 3R8FA 3V76A 1XXHB 2DAGA 2XFSA 3U6OA 1NNJA 1K82A 1G4AE 4OW0A 1W5TA 1IN6A 3H4MA 2FFJA 1TDHA 4DBGB 1PJJA 2ZAMA 2A5YB 2VF7A 2D7GA 2KNAA 4X64M 1N34M 2R45A 3EIHA 3FD9A 1RU3A 1ZQ9A 4GC5A 4PCZA 2VIIA 1PJIA 4IBFA 1EE8A 4WW0A 2MJ5B 2D7EA 1JR3D 1NSFA 3GLHE 4OU7A 3GLGE 3TL4X 5A2QS 1DGGA 1P3QQ 1TH2A 3K9PA 4LFBM 3HX3A 1NY5A 1NJGA 2JWSA 2Z7JA 1IQPA 1QAQA 4FCTA 1HNXM 4R3DA 2CV0A 4II7A 2BWEA 3SASA 1L2CA 3WHKA 3EIEA 2DI0A 3KSXA 1IY1A 1IBMM 2F5PA 1TTEA 5ITXA 1R5LA 5IWAM 3FTFA 4RNAA 5E6JA 2CV2A 3GLIB 3PNYA 1NV8A 1OFIA 3VFDA 1GKIA 3Q8GA 5ITYA 2VQFM 4DV7M 4IJEA 4JI3M 4NC6A 1HQYE 4BBAA 4HL4A 2QNJA 1WIVA 2NQ8C 4LJAA 3RGSA 5KQ8A 4G4RA 1KFVA 2M5ZA 1L8QA 3NBXX 4LF7M 4JI2M 4XGIA 1YE9A 2QZ4A 3IECA 3LW5F 3HU2A 4DUZM 4L8RC 2O25A 1L1ZA 2L09A 5LMUM 4DR2M 2DKLA 3FYCA 4G3OA 5FTNA 4B7FA 1Z5CA 3B9PA 4CGYB 2UXCM 4LRSA 4PDIA 1WXQA 3HU1A 1WGNA 3K8ZA 3HZJA 4A3VB 4IBEA 1IXSB 3KOWE 4L78A 3UGJA 4JI6M 1HNWM 2QQ8A 5EP1A 2EKKA 2I7PA 3QWLA 1TH3A 3BXWA 3CTWB 1HJPA 3KW6A 3HHZA 1VEJA 2RGOA 3U6MA 1OKSA 4FD2A 3ZQJA 1IXSA 5JI3E 2DAKA 1OJLA 3JR4A 2F5NA 3GQ4A 3KSJA 2KZSA 2VF8A 1XNQM 2R46A 1PM5A 3UJNA 1YUBA 2Z8YM 5FTKA 3HJQA 4NRWA 4NRVA 3LMMA 1X37A 1TR8A 2UXDM 2FE8A 4MGYE 3C58A 4HLQA 7CATA 1IXRC 2DZLA 5C18A 4GHAA 2DZOB 4MM3B 4AKGA 3JAMS 3GO8A 2JY6B 2WSCF 3SC3A 3VLFB 4L16A 1VG5A 2JXNA 3SFZA 4QHTA 2LTUA 3W0LB 3W67A 3U6LA 2RRUA 3K2LA 2C96A 4LY6A 1J7KA 2WSEF 2J7OA 2L4FA 1GJTA 3CF6E 5DFLA 1GLNA 2W82A 2J7NA 4JI5M 3E9SA 4P17A 1QZEA 4LF6M 1NNUC 3I4VA 1QUTA 4DR4M 2ERCA 1KYIA 4AG6A 4DV2M 2QCUA 4M0WA 1R6BX 1VEKA 3AOGA 2Q2EB 2GQFA 3RE8A 1XC8A 4MH0E 4I8OA 2DAEA 2G3QA 2XSZA 3U6DA 4TUWA 3W0FA 3SBJA 1R4GA 2R4EA 2Y21A 3LCUA 1HT2E 3AOEA 4F1IA 3T38A 3K92A 3FTCA 4NSOB 1YLAA 4OX9M 4YY3M 1IN5A 1QZMA 3TQSA 3U6QA 3TPZA 2L7IA 1GABA 2C5RA 4LF5M 3R9XB 2EJSA 4CHTB 4AKIA 1D0KA 1QYRA 4JN6A 3FUTA 3OTOM 2LVQD 2R18A 2XFTA 3I01M 3HWSA 1TF0B 2C99A 2KW0A 4QHSA 3KOZE 3U6EA 2V1CA 2O01F 2YNMD 1BVSA 3SATA 4BB9A 2CUZA 3KS8A 3K1JA 3CF2A 3GLFB 2LXEA 2KRKA 1Z6TA 3C3DA 3FTDA 2CHVA 4QOSA 3T6PA 3ZCBB 5KQDA 2BJVA 4M9ZA 3U6CA 4XK8F 1UM8A 1R2ZA 2Z3XA 4JI1M 2Y0QA 1SXJB 4I81A 4DUYM 1YSYA 3GLFA 4MGIE 1A5TA 4LJ8A 5EXTA 1XHBA 1XXHA 1Z59A 4LF8M 3DOAA 3PFIA 1FNNA 1VQ1A 3HKPA 1L2BA 1NVMA 1SXJA 1DO0A 2QPAA 2OOBA 3FUWA 3NWLA 4DV1M 4GRIA 3GRRA 3A46A 4WURA 4ITQA 4IIWA 2OPFA 2KNVA 4G4OA 1N36M 3VDUA 5EXPA 2YFQA 4F2LA 1I94M 4GH9A 5H37D 2LNHC 2CP8A 2FNAA 3B7NA 5DYIA 2Z4SA 1GJSA 5EXSA 4M0DA 3SMPA 2Z4RA 3H4JA 2KHHA 3IHPA 2ZBKB 4XBOA 5KO3A 4AG5A 3J7AS 1HT1E 3AV0A 1OTRA 1NHGC 5FTLA 3J2PB 3PXGA 3JR5A 3AOEC 1UFZA 2HL7A 1E32A 1N33M 4IBCA 3KDSE 3KXEC 1GL7A 2ZTDA 4IBKA 4QNRA 3TWKA 2DWMA 2JZ0A 1DO2A 3M6AA 1DGFA 2Y0TA 4B7HA 3GLIA 5FSWA 4G4NA 3KVWA 3FKEA 1OAIA 2L6OA 2R6FA 3SHGB 2XZFA 1TH4A 2P5TA 3UK6A 5IT9S 2DHYA 1PRBA 2K0BX 1QVRA 4FCWA 2R62A 4LJ5A 2XLJA 3GPXA 1F4IA 2L2DA 4GITA 2CFOA 4G6ZA 4JXJA 3J27B 2F5QA 4LJ4A 1LV7A 1OAOC 3ILKA 3FYDA 4L4UA 4W5WA 1ORYB 1V33A 2EKFA 3VKHA 2JA2A 5BR8M 4GC9A 4DV3M 4QOZC 1IN7A 2WZJA 3GP1A 1NO1A 2G5GX 1PGYA 1SXJC 1VEGA 3FUUA 4OVZB 2HAKA 4FW9A 3TWMA 4I4LA 3Q8XA 2UUCM 2HKJA 4GIPA 2LVAA 3GLFE 3M7GA 4B3RM 3SYLA 2DVWB 1IN4A 3IG8A 4UN2B 1DGHB 2BWBA 1ZAEA 1XXHE 1WJ7A 2YQZA 1GL6A 3AJIB 3E46A 2HWJA 1GO5A 4IBBA 2KZUA 1T43A 3GRVA 1J09A 1DGHA 4LCBA 3LCVB 4EIWA 1IFYA 1WHCA 3L2AA 3U6SA 1VDDA 2OOAA 3HJ8A 2CV1A 3VKGA 4KODA 3U6PA 2EUCA 1NHWC 4DR1M 4LJ6A 2XGNA 2BJWA 4S12A 4LF9M 3SAVA 4LJ7A 4JYAM 1H6UA 4MGKE 3U5ZB 2XSZD 4GEWA 5ITXE 1TGUA 2JUJA 3GLGB 4LGMA 2QP9X 4KHPM 2HHHM 4HEOA 2AHMA 3GRYA 2DWLA 2E5LM 2DXIA 2D7HA 2LHGA 3THGA 2JNHA 3MK6A 4MGHA 2H1RA 4IJFA 1MX0A 3UMMA 3GLGA 2CHQA 3U5ZA 4JV5M 1D0MA 3GLIE 3E4RA 1IN8A 4JI0M 2ZTCA 3J7BA 2H5XA 1N77A 1Q3CA 1Y8GA 1XMOM 4JI7M 1QAMA 2V6ZM 1Q02A 1NY6A 2JY7A 1NJFA 4LZJA 2CEAA 1S3SA 2WSFF 3SYKA 2F5OA 4NXNM 3PVSA 2CHGA 4B08A 4IBDA 3GQ5A 1K3XA 5E26A 4DV6M 2B3TA 1EIJA 3KOYE 3D8LA 2C98A 4AQYM 1WR1B 2OO9A 2UXBM 2CRUA 2LVPC 2RGHA 3MHVC 1QANA 3A45A 4FVMA 4X66M 4Z6YA 2DWNA 4IBGA 4B3TM 2N35A 1T6OA 2I7NA 1XB2B 2JZ1A 1HQCA 4FWGA 3W68A 5JI2E 3E21A 1QAOA 3MMPA 2QSFX 2C9OA 3KOXE 1JQJC 3KP0E 3FUXA 1SXJD 2K6BA 3SMSA 1TDZA 4G4QA 3QYBA 2V1UA 4LF4M 4NXMM 4GHLA 3DA1A 4MGZE 1MN3A 3U61B 1DGBA 5IZ7D 2ZM6M 1I4WA 5KPRA 1E94E 3D8BA 3IG5A 3GPUA 1C7YA 4IBJA 3M0EA 3L25A 2O5RA 2M60A 3AL0C 4D81A 3DZDA 2KEBA 2KDLA 3HY5A 5EJCA 5EXXA 4P16A 3SHFA 2DAIA 2KXEA 3GPYA 2MROB 1XMQM 4NSRA 1N78A 4D82A 1HNZM 3GPPA 3B74A 2DZNB 2ZAOA 3L29A 1W5SA 4LZZA 2HCBA 3B7QA 3I04M 3DFZA 5ITQA 1AUAA 8CATA 3FRHA 5IREB 3A98B 4LFAM 3LVWA 4NOOB 3A42A 1Q39A 4NL4H 5F3WA 5L8RF 1C1KA 4X65M 1ZMUA 5FTMA 3SAWA 3FRIA 2MH8A 2UUBM 4RKUF 1NV9A 3C3EA 5FTJA 1J5EM 2R4JA 3K9OA 5LMNM 4M9XA 3L28A 1G71A 4JI4M 4FWHA 3AKZA 2ZANA 4AZFA 4DV0M 2JY8A 1IBLM 2K9DA 1N75A 1ZMVA 4RF1A 3L27A 2VQEM 3FTEA 1JR3A 1IM2A 3QAUA 1PJTA 5BPVA 3J81S 3LVVA 5EP3A 4GKKM 5EQTA 4R71A 4FCVA 4B3MM 2MR9A 5KPZA 4B3SM 2XZUA 4RF0A 2XF3A 4I5SA 2OQ4A 2F5SA 4Q7JA 3MJ5A 4IBIA 3VK7A 4CJ6A 1V34A 4ANRA 1MU5A 4KLNA 1D2NA 1GVNA 1IY2A 1XWIA 2GNOA 1QDRA 4AW4A 4MB7A 1T3TA 1SG9A 4FWDA 4BLCA 5EP2A 1Z5BA 1ZV1A 2DAMA 2L4EA 4REZA 5ITUA 1DV0A 4LGYA 1IBKM 3SARA 1PJQA 1N32M 4LFCM 4OVZA 2EO2A 3L26A 2UU9M 3CGWA 1MJGM 2YR0A 3KFUG 3HHWA 1L1TA 4YHHM 1IXZA 1D0LA 1EFUB 1QDTA 1SXJE 1G41A 2XH9A 1QUSA 1QQWA 3I4YA 4DR7M 2DHRA 2R65A 4ZPXA 4B7GA 4DR6M 4AI6A 1VDLA 1ZMWA 2EA0A 2UUAM 3I51A 3WHLA 2QBYB 4K0KM 1XNRM 3GRUA 1PJSA 4LJ9A 3BOSA 4WP2A 3T1HM 4KO8A 2X4AA 3ZC7B 2DWZB 3ZH9B 3C9PA 2QBYA 4X62M 1Q3BA 2JY5A 3HJSA 4L6V6 2X49A 5ITTA 3GLHB 3VK8A 3B7ZA 4PDGA 2LH0A 3F92A 3PNVA 3TWLA 1G59A 2F4VM
chains in the Genus database with same CATH topology
1WGNA 3H4JA 2KHHA 3B89A 3IHPA 5JI2E 3E21A 3MMPA 2QSFX 2LVNC 1HT1E 1OTRA 2EKKA 1MN3A 1HJPA 2MGWA 1VEJA 1UFZA 1E94E 1OKSA 2CWBA 1IXSA 2DAKA 1JR3E 2QHOB 2ZTDA 1C7YA 1G3IA 2JZ0A 1DO2A 2LVOC 2R0IA 1OAIA 2DAIA 2DHYA 2MROB 1TR8A 2K0BX 2JP7A 1V92A 1F4IA 2L2DA 2DENA 2DZLA 2KNZA 3FRHA 2JY6B 1VG5A 2LTUA 2EKFA 2LBCA 1AIPC 2RRUA 1WGLA 1OQYA 2L4FA 3FE3A 1ZMUA 2WZJA 3FRIA 5DFLA 1PGYA 1VEGA 1NV9A 2HAKA 3K9OA 1CUKA 1QZEA 3BBZA 2JY8A 2LVAA 3GLFE 2K9DA 1ZMVA 2DNAA 1KYIA 4UN2B 1IM2A 2BWBA 3E46A 1XXHE 1WJ7A 1GO5A 2HWJA 1VEKA 4R71A 2DAEA 2G3QA 1T43A 2DAGA 1G4AE 2MR9A 1R4GA 3LCVB 1IFYA 1WHCA 4DBGB 3LCUA 4Q7JA 1HT2E 4F1IA 2KNAA 2OOAA 1YLAA 2MJ5B 3GLHE 2EJSA 3GLGE 1SG9A 1ZV1A 2DAMA 2L4EA 2LVQD 2JUJA 4GEWA 1P3QQ 1DV0A 3K9PA 4HEOA 1BVSA 2BWEA 2JNHA 2DI0A 3T6PA 1EFUB 3GLIE 1G41A 1TTEA 2ZTCA 2H5XA 1Y8GA 1VDLA 1ZMWA 1Q02A 1NV8A 2JY7A 1A5TA 1VQ1A 1HQYE 4WP2A 1DO0A 2QNJA 1WIVA 2OOBA 2B3TA 1WR1B 2OO9A 3IECA 2LVPC 2JY5A 2KNVA 2O25A 2DKLA 4G3OA 4F2LA 3F92A 1T6OA 2CP8A 1XB2B 2JZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGN A;  3H4J A;  2KHH A;  3B89 A;  3IHP A;  5JI2 E;  3E21 A;  3MMP A;  2QSF X;  2LVN C;  1HT1 E;  1OTR A;  2EKK A;  1MN3 A;  1HJP A;  2MGW A;  1VEJ A;  1UFZ A;  1E94 E;  1OKS A;  2CWB A;  1IXS A;  2DAK A;  1JR3 E;  2QHO B;  2ZTD A;  1C7Y A;  1G3I A;  2JZ0 A;  1DO2 A;  2LVO C;  2R0I A;  1OAI A;  2DAI A;  2DHY A;  2MRO B;  1TR8 A;  2K0B X;  2JP7 A;  1V92 A;  1F4I A;  2L2D A;  2DEN A;  2DZL A;  2KNZ A;  3FRH A;  2JY6 B;  1VG5 A;  2LTU A;  2EKF A;  2LBC A;  1AIP C;  2RRU A;  1WGL A;  1OQY A;  2L4F A;  3FE3 A;  1ZMU A;  2WZJ A;  3FRI A;  5DFL A;  1PGY A;  1VEG A;  1NV9 A;  2HAK A;  3K9O A;  1CUK A;  1QZE A;  3BBZ A;  2JY8 A;  2LVA A;  3GLF E;  2K9D A;  1ZMV A;  2DNA A;  1KYI A;  4UN2 B;  1IM2 A;  2BWB A;  3E46 A;  1XXH E;  1WJ7 A;  1GO5 A;  2HWJ A;  1VEK A;  4R71 A;  2DAE A;  2G3Q A;  1T43 A;  2DAG A;  1G4A E;  2MR9 A;  1R4G A;  3LCV B;  1IFY A;  1WHC A;  4DBG B;  3LCU A;  4Q7J A;  1HT2 E;  4F1I A;  2KNA A;  2OOA A;  1YLA A;  2MJ5 B;  3GLH E;  2EJS A;  3GLG E;  1SG9 A;  1ZV1 A;  2DAM A;  2L4E A;  2LVQ D;  2JUJ A;  4GEW A;  1P3Q Q;  1DV0 A;  3K9P A;  4HEO A;  1BVS A;  2BWE A;  2JNH A;  2DI0 A;  3T6P A;  1EFU B;  3GLI E;  1G41 A;  1TTE A;  2ZTC A;  2H5X A;  1Y8G A;  1VDL A;  1ZMW A;  1Q02 A;  1NV8 A;  2JY7 A;  1A5T A;  1VQ1 A;  1HQY E;  4WP2 A;  1DO0 A;  2QNJ A;  1WIV A;  2OOB A;  2B3T A;  1WR1 B;  2OO9 A;  3IEC A;  2LVP C;  2JY5 A;  2KNV A;  2O25 A;  2DKL A;  4G3O A;  4F2L A;  3F92 A;  1T6O A;  2CP8 A;  1XB2 B;  2JZ1 A; 
#chains in the Genus database with same CATH topology
 3QYE A;  4DV5 M;  1K3W A;  3B89 A;  3GLH A;  1R7R A;  2LVN C;  3LQQ A;  2KA6 B;  5GKN A;  3SAU A;  2BNK A;  2MGW A;  3FUV A;  2FS1 A;  2CWB A;  3VDP A;  2G8L A;  5FLX S;  4DR5 M;  1JR3 E;  2QHO B;  1FJG M;  3TE6 A;  4JI8 M;  1G3I A;  3HU3 A;  4LG2 A;  2QEN A;  2LVO C;  2R0I A;  2LHC A;  1R2Y A;  4CIZ A;  3LQR A;  3HHY A;  5KPT A;  1IY0 A;  1KSF X;  3RGP A;  3NBI A;  2JP7 A;  3AFH A;  4Z8X A;  2VDB B;  4CIS A;  1V92 A;  4DV4 M;  4Y28 F;  3U60 B;  2DEN A;  1OIZ A;  5EP4 A;  2J5Y A;  3KS4 A;  4GMQ A;  4D80 A;  3T1Y M;  4LRT A;  1OIP A;  2KNZ A;  3GQ3 A;  1Z5A A;  5ITR A;  2R44 A;  3HHX A;  2LBC A;  3U60 A;  1AIP C;  2X8A A;  1E9R A;  4R7G A;  1WGL A;  5C1B A;  4DR3 M;  1OFH A;  2CE7 A;  1E9S A;  1OQY A;  2XEP A;  1L2D A;  4L15 A;  3FE3 A;  4AKH A;  2FOI C;  4M9S A;  2LWX A;  3KP1 E;  3T15 A;  3RFW A;  2APL A;  4KT0 F;  4PT5 A;  3U61 A;  4PD2 A;  1HR0 M;  2RKO A;  1CUK A;  1LTM A;  3HGI A;  2L7H A;  1JB0 F;  3BBZ A;  5DYG A;  3UZU A;  2K47 A;  2C9C A;  3CF0 A;  4QNM A;  2DNA A;  1G8P A;  5DNY A;  4GKJ M;  2FH0 A;  2Y20 A;  3J80 S;  2KRU A;  3R8F A;  3V76 A;  1XXH B;  2DAG A;  2XFS A;  3U6O A;  1NNJ A;  1K82 A;  1G4A E;  4OW0 A;  1W5T A;  1IN6 A;  3H4M A;  2FFJ A;  1TDH A;  4DBG B;  1PJJ A;  2ZAM A;  2A5Y B;  2VF7 A;  2D7G A;  2KNA A;  4X64 M;  1N34 M;  2R45 A;  3EIH A;  3FD9 A;  1RU3 A;  1ZQ9 A;  4GC5 A;  4PCZ A;  2VII A;  1PJI A;  4IBF A;  1EE8 A;  4WW0 A;  2MJ5 B;  2D7E A;  1JR3 D;  1NSF A;  3GLH E;  4OU7 A;  3GLG E;  3TL4 X;  5A2Q S;  1DGG A;  1P3Q Q;  1TH2 A;  3K9P A;  4LFB M;  3HX3 A;  1NY5 A;  1NJG A;  2JWS A;  2Z7J A;  1IQP A;  1QAQ A;  4FCT A;  1HNX M;  4R3D A;  2CV0 A;  4II7 A;  2BWE A;  3SAS A;  1L2C A;  3WHK A;  3EIE A;  2DI0 A;  3KSX A;  1IY1 A;  1IBM M;  2F5P A;  1TTE A;  5ITX A;  1R5L A;  5IWA M;  3FTF A;  4RNA A;  5E6J A;  2CV2 A;  3GLI B;  3PNY A;  1NV8 A;  1OFI A;  3VFD A;  1GKI A;  3Q8G A;  5ITY A;  2VQF M;  4DV7 M;  4IJE A;  4JI3 M;  4NC6 A;  1HQY E;  4BBA A;  4HL4 A;  2QNJ A;  1WIV A;  2NQ8 C;  4LJA A;  3RGS A;  5KQ8 A;  4G4R A;  1KFV A;  2M5Z A;  1L8Q A;  3NBX X;  4LF7 M;  4JI2 M;  4XGI A;  1YE9 A;  2QZ4 A;  3IEC A;  3LW5 F;  3HU2 A;  4DUZ M;  4L8R C;  2O25 A;  1L1Z A;  2L09 A;  5LMU M;  4DR2 M;  2DKL A;  3FYC A;  4G3O A;  5FTN A;  4B7F A;  1Z5C A;  3B9P A;  4CGY B;  2UXC M;  4LRS A;  4PDI A;  1WXQ A;  3HU1 A;  1WGN A;  3K8Z A;  3HZJ A;  4A3V B;  4IBE A;  1IXS B;  3KOW E;  4L78 A;  3UGJ A;  4JI6 M;  1HNW M;  2QQ8 A;  5EP1 A;  2EKK A;  2I7P A;  3QWL A;  1TH3 A;  3BXW A;  3CTW B;  1HJP A;  3KW6 A;  3HHZ A;  1VEJ A;  2RGO A;  3U6M A;  1OKS A;  4FD2 A;  3ZQJ A;  1IXS A;  5JI3 E;  2DAK A;  1OJL A;  3JR4 A;  2F5N A;  3GQ4 A;  3KSJ A;  2KZS A;  2VF8 A;  1XNQ M;  2R46 A;  1PM5 A;  3UJN A;  1YUB A;  2Z8Y M;  5FTK A;  3HJQ A;  4NRW A;  4NRV A;  3LMM A;  1X37 A;  1TR8 A;  2UXD M;  2FE8 A;  4MGY E;  3C58 A;  4HLQ A;  7CAT A;  1IXR C;  2DZL A;  5C18 A;  4GHA A;  2DZO B;  4MM3 B;  4AKG A;  3JAM S;  3GO8 A;  2JY6 B;  2WSC F;  3SC3 A;  3VLF B;  4L16 A;  1VG5 A;  2JXN A;  3SFZ A;  4QHT A;  2LTU A;  3W0L B;  3W67 A;  3U6L A;  2RRU A;  3K2L A;  2C96 A;  4LY6 A;  1J7K A;  2WSE F;  2J7O A;  2L4F A;  1GJT A;  3CF6 E;  5DFL A;  1GLN A;  2W82 A;  2J7N A;  4JI5 M;  3E9S A;  4P17 A;  1QZE A;  4LF6 M;  1NNU C;  3I4V A;  1QUT A;  4DR4 M;  2ERC A;  1KYI A;  4AG6 A;  4DV2 M;  2QCU A;  4M0W A;  1R6B X;  1VEK A;  3AOG A;  2Q2E B;  2GQF A;  3RE8 A;  1XC8 A;  4MH0 E;  4I8O A;  2DAE A;  2G3Q A;  2XSZ A;  3U6D A;  4TUW A;  3W0F A;  3SBJ A;  1R4G A;  2R4E A;  2Y21 A;  3LCU A;  1HT2 E;  3AOE A;  4F1I A;  3T38 A;  3K92 A;  3FTC A;  4NSO B;  1YLA A;  4OX9 M;  4YY3 M;  1IN5 A;  1QZM A;  3TQS A;  3U6Q A;  3TPZ A;  2L7I A;  1GAB A;  2C5R A;  4LF5 M;  3R9X B;  2EJS A;  4CHT B;  4AKI A;  1D0K A;  1QYR A;  4JN6 A;  3FUT A;  3OTO M;  2LVQ D;  2R18 A;  2XFT A;  3I01 M;  3HWS A;  1TF0 B;  2C99 A;  2KW0 A;  4QHS A;  3KOZ E;  3U6E A;  2V1C A;  2O01 F;  2YNM D;  1BVS A;  3SAT A;  4BB9 A;  2CUZ A;  3KS8 A;  3K1J A;  3CF2 A;  3GLF B;  2LXE A;  2KRK A;  1Z6T A;  3C3D A;  3FTD A;  2CHV A;  4QOS A;  3T6P A;  3ZCB B;  5KQD A;  2BJV A;  4M9Z A;  3U6C A;  4XK8 F;  1UM8 A;  1R2Z A;  2Z3X A;  4JI1 M;  2Y0Q A;  1SXJ B;  4I81 A;  4DUY M;  1YSY A;  3GLF A;  4MGI E;  1A5T A;  4LJ8 A;  5EXT A;  1XHB A;  1XXH A;  1Z59 A;  4LF8 M;  3DOA A;  3PFI A;  1FNN A;  1VQ1 A;  3HKP A;  1L2B A;  1NVM A;  1SXJ A;  1DO0 A;  2QPA A;  2OOB A;  3FUW A;  3NWL A;  4DV1 M;  4GRI A;  3GRR A;  3A46 A;  4WUR A;  4ITQ A;  4IIW A;  2OPF A;  2KNV A;  4G4O A;  1N36 M;  3VDU A;  5EXP A;  2YFQ A;  4F2L A;  1I94 M;  4GH9 A;  5H37 D;  2LNH C;  2CP8 A;  2FNA A;  3B7N A;  5DYI A;  2Z4S A;  1GJS A;  5EXS A;  4M0D A;  3SMP A;  2Z4R A;  3H4J A;  2KHH A;  3IHP A;  2ZBK B;  4XBO A;  5KO3 A;  4AG5 A;  3J7A S;  1HT1 E;  3AV0 A;  1OTR A;  1NHG C;  5FTL A;  3J2P B;  3PXG A;  3JR5 A;  3AOE C;  1UFZ A;  2HL7 A;  1E32 A;  1N33 M;  4IBC A;  3KDS E;  3KXE C;  1GL7 A;  2ZTD A;  4IBK A;  4QNR A;  3TWK A;  2DWM A;  2JZ0 A;  1DO2 A;  3M6A A;  1DGF A;  2Y0T A;  4B7H A;  3GLI A;  5FSW A;  4G4N A;  3KVW A;  3FKE A;  1OAI A;  2L6O A;  2R6F A;  3SHG B;  2XZF A;  1TH4 A;  2P5T A;  3UK6 A;  5IT9 S;  2DHY A;  1PRB A;  2K0B X;  1QVR A;  4FCW A;  2R62 A;  4LJ5 A;  2XLJ A;  3GPX A;  1F4I A;  2L2D A;  4GIT A;  2CFO A;  4G6Z A;  4JXJ A;  3J27 B;  2F5Q A;  4LJ4 A;  1LV7 A;  1OAO C;  3ILK A;  3FYD A;  4L4U A;  4W5W A;  1ORY B;  1V33 A;  2EKF A;  3VKH A;  2JA2 A;  5BR8 M;  4GC9 A;  4DV3 M;  4QOZ C;  1IN7 A;  2WZJ A;  3GP1 A;  1NO1 A;  2G5G X;  1PGY A;  1SXJ C;  1VEG A;  3FUU A;  4OVZ B;  2HAK A;  4FW9 A;  3TWM A;  4I4L A;  3Q8X A;  2UUC M;  2HKJ A;  4GIP A;  2LVA A;  3GLF E;  3M7G A;  4B3R M;  3SYL A;  2DVW B;  1IN4 A;  3IG8 A;  4UN2 B;  1DGH B;  2BWB A;  1ZAE A;  1XXH E;  1WJ7 A;  2YQZ A;  1GL6 A;  3AJI B;  3E46 A;  2HWJ A;  1GO5 A;  4IBB A;  2KZU A;  1T43 A;  3GRV A;  1J09 A;  1DGH A;  4LCB A;  3LCV B;  4EIW A;  1IFY A;  1WHC A;  3L2A A;  3U6S A;  1VDD A;  2OOA A;  3HJ8 A;  2CV1 A;  3VKG A;  4KOD A;  3U6P A;  2EUC A;  1NHW C;  4DR1 M;  4LJ6 A;  2XGN A;  2BJW A;  4S12 A;  4LF9 M;  3SAV A;  4LJ7 A;  4JYA M;  1H6U A;  4MGK E;  3U5Z B;  2XSZ D;  4GEW A;  5ITX E;  1TGU A;  2JUJ A;  3GLG B;  4LGM A;  2QP9 X;  4KHP M;  2HHH M;  4HEO A;  2AHM A;  3GRY A;  2DWL A;  2E5L M;  2DXI A;  2D7H A;  2LHG A;  3THG A;  2JNH A;  3MK6 A;  4MGH A;  2H1R A;  4IJF A;  1MX0 A;  3UMM A;  3GLG A;  2CHQ A;  3U5Z A;  4JV5 M;  1D0M A;  3GLI E;  3E4R A;  1IN8 A;  4JI0 M;  2ZTC A;  3J7B A;  2H5X A;  1N77 A;  1Q3C A;  1Y8G A;  1XMO M;  4JI7 M;  1QAM A;  2V6Z M;  1Q02 A;  1NY6 A;  2JY7 A;  1NJF A;  4LZJ A;  2CEA A;  1S3S A;  2WSF F;  3SYK A;  2F5O A;  4NXN M;  3PVS A;  2CHG A;  4B08 A;  4IBD A;  3GQ5 A;  1K3X A;  5E26 A;  4DV6 M;  2B3T A;  1EIJ A;  3KOY E;  3D8L A;  2C98 A;  4AQY M;  1WR1 B;  2OO9 A;  2UXB M;  2CRU A;  2LVP C;  2RGH A;  3MHV C;  1QAN A;  3A45 A;  4FVM A;  4X66 M;  4Z6Y A;  2DWN A;  4IBG A;  4B3T M;  2N35 A;  1T6O A;  2I7N A;  1XB2 B;  2JZ1 A;  1HQC A;  4FWG A;  3W68 A;  5JI2 E;  3E21 A;  1QAO A;  3MMP A;  2QSF X;  2C9O A;  3KOX E;  1JQJ C;  3KP0 E;  3FUX A;  1SXJ D;  2K6B A;  3SMS A;  1TDZ A;  4G4Q A;  3QYB A;  2V1U A;  4LF4 M;  4NXM M;  4GHL A;  3DA1 A;  4MGZ E;  1MN3 A;  3U61 B;  1DGB A;  5IZ7 D;  2ZM6 M;  1I4W A;  5KPR A;  1E94 E;  3D8B A;  3IG5 A;  3GPU A;  1C7Y A;  4IBJ A;  3M0E A;  3L25 A;  2O5R A;  2M60 A;  3AL0 C;  4D81 A;  3DZD A;  2KEB A;  2KDL A;  3HY5 A;  5EJC A;  5EXX A;  4P16 A;  3SHF A;  2DAI A;  2KXE A;  3GPY A;  2MRO B;  1XMQ M;  4NSR A;  1N78 A;  4D82 A;  1HNZ M;  3GPP A;  3B74 A;  2DZN B;  2ZAO A;  3L29 A;  1W5S A;  4LZZ A;  2HCB A;  3B7Q A;  3I04 M;  3DFZ A;  5ITQ A;  1AUA A;  8CAT A;  3FRH A;  5IRE B;  3A98 B;  4LFA M;  3LVW A;  4NOO B;  3A42 A;  1Q39 A;  4NL4 H;  5F3W A;  5L8R F;  1C1K A;  4X65 M;  1ZMU A;  5FTM A;  3SAW A;  3FRI A;  2MH8 A;  2UUB M;  4RKU F;  1NV9 A;  3C3E A;  5FTJ A;  1J5E M;  2R4J A;  3K9O A;  5LMN M;  4M9X A;  3L28 A;  1G71 A;  4JI4 M;  4FWH A;  3AKZ A;  2ZAN A;  4AZF A;  4DV0 M;  2JY8 A;  1IBL M;  2K9D A;  1N75 A;  1ZMV A;  4RF1 A;  3L27 A;  2VQE M;  3FTE A;  1JR3 A;  1IM2 A;  3QAU A;  1PJT A;  5BPV A;  3J81 S;  3LVV A;  5EP3 A;  4GKK M;  5EQT A;  4R71 A;  4FCV A;  4B3M M;  2MR9 A;  5KPZ A;  4B3S M;  2XZU A;  4RF0 A;  2XF3 A;  4I5S A;  2OQ4 A;  2F5S A;  4Q7J A;  3MJ5 A;  4IBI A;  3VK7 A;  4CJ6 A;  1V34 A;  4ANR A;  1MU5 A;  4KLN A;  1D2N A;  1GVN A;  1IY2 A;  1XWI A;  2GNO A;  1QDR A;  4AW4 A;  4MB7 A;  1T3T A;  1SG9 A;  4FWD A;  4BLC A;  5EP2 A;  1Z5B A;  1ZV1 A;  2DAM A;  2L4E A;  4REZ A;  5ITU A;  1DV0 A;  4LGY A;  1IBK M;  3SAR A;  1PJQ A;  1N32 M;  4LFC M;  4OVZ A;  2EO2 A;  3L26 A;  2UU9 M;  3CGW A;  1MJG M;  2YR0 A;  3KFU G;  3HHW A;  1L1T A;  4YHH M;  1IXZ A;  1D0L A;  1EFU B;  1QDT A;  1SXJ E;  1G41 A;  2XH9 A;  1QUS A;  1QQW A;  3I4Y A;  4DR7 M;  2DHR A;  2R65 A;  4ZPX A;  4B7G A;  4DR6 M;  4AI6 A;  1VDL A;  1ZMW A;  2EA0 A;  2UUA M;  3I51 A;  3WHL A;  2QBY B;  4K0K M;  1XNR M;  3GRU A;  1PJS A;  4LJ9 A;  3BOS A;  4WP2 A;  3T1H M;  4KO8 A;  2X4A A;  3ZC7 B;  2DWZ B;  3ZH9 B;  3C9P A;  2QBY A;  4X62 M;  1Q3B A;  2JY5 A;  3HJS A;  4L6V 6;  2X49 A;  5ITT A;  3GLH B;  3VK8 A;  3B7Z A;  4PDG A;  2LH0 A;  3F92 A;  3PNV A;  3TWL A;  1G59 A;  2F4V M; 
#chains in the Genus database with same CATH homology
 1WGN A;  3H4J A;  2KHH A;  3B89 A;  3IHP A;  5JI2 E;  3E21 A;  3MMP A;  2QSF X;  2LVN C;  1HT1 E;  1OTR A;  2EKK A;  1MN3 A;  1HJP A;  2MGW A;  1VEJ A;  1UFZ A;  1E94 E;  1OKS A;  2CWB A;  1IXS A;  2DAK A;  1JR3 E;  2QHO B;  2ZTD A;  1C7Y A;  1G3I A;  2JZ0 A;  1DO2 A;  2LVO C;  2R0I A;  1OAI A;  2DAI A;  2DHY A;  2MRO B;  1TR8 A;  2K0B X;  2JP7 A;  1V92 A;  1F4I A;  2L2D A;  2DEN A;  2DZL A;  2KNZ A;  3FRH A;  2JY6 B;  1VG5 A;  2LTU A;  2EKF A;  2LBC A;  1AIP C;  2RRU A;  1WGL A;  1OQY A;  2L4F A;  3FE3 A;  1ZMU A;  2WZJ A;  3FRI A;  5DFL A;  1PGY A;  1VEG A;  1NV9 A;  2HAK A;  3K9O A;  1CUK A;  1QZE A;  3BBZ A;  2JY8 A;  2LVA A;  3GLF E;  2K9D A;  1ZMV A;  2DNA A;  1KYI A;  4UN2 B;  1IM2 A;  2BWB A;  3E46 A;  1XXH E;  1WJ7 A;  1GO5 A;  2HWJ A;  1VEK A;  4R71 A;  2DAE A;  2G3Q A;  1T43 A;  2DAG A;  1G4A E;  2MR9 A;  1R4G A;  3LCV B;  1IFY A;  1WHC A;  4DBG B;  3LCU A;  4Q7J A;  1HT2 E;  4F1I A;  2KNA A;  2OOA A;  1YLA A;  2MJ5 B;  3GLH E;  2EJS A;  3GLG E;  1SG9 A;  1ZV1 A;  2DAM A;  2L4E A;  2LVQ D;  2JUJ A;  4GEW A;  1P3Q Q;  1DV0 A;  3K9P A;  4HEO A;  1BVS A;  2BWE A;  2JNH A;  2DI0 A;  3T6P A;  1EFU B;  3GLI E;  1G41 A;  1TTE A;  2ZTC A;  2H5X A;  1Y8G A;  1VDL A;  1ZMW A;  1Q02 A;  1NV8 A;  2JY7 A;  1A5T A;  1VQ1 A;  1HQY E;  4WP2 A;  1DO0 A;  2QNJ A;  1WIV A;  2OOB A;  2B3T A;  1WR1 B;  2OO9 A;  3IEC A;  2LVP C;  2JY5 A;  2KNV A;  2O25 A;  2DKL A;  4G3O A;  4F2L A;  3F92 A;  1T6O A;  2CP8 A;  1XB2 B;  2JZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...