2DAIA

Solution structure of the first uba domain in the human ubiquitin associated domain containing 1 (ubadc1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
83
structure length
83
Chain Sequence
GSSGSSGDAVELFKKANAMLDEDEDERVDEAALRQLTEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTIDTPLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin associated domain containing 1
publication title Solution Structure of the First UBA Domain in the Human Ubiquitin Associated Domain Containing 1 (UBADC1)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 10
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2daiA00
3E46A 2DAMA 4WP2A 2WZJA 1WGNA 2ZTCA 3IECA 2DZLA 2MGWA 1ZV1A 1QZEA 1TTEA 1F4IA 2JZ0A 4F2LA 1HQYE 3FE3A 1IFYA 3LCVB 2K9DA 1V92A 2DAGA 4Q7JA 2R0IA 2RRUA 1VQ1A 2CWBA 2QNJA 2LVOC 3BBZA 2LVAA 2L2DA 2KNVA 3IHPA 1XXHE 2H5XA 5DFLA 1KYIA 2JP7A 1BVSA 1EFUB 2LTUA 2OOAA 3FRIA 2G3QA 4DBGB 2EJSA 1SG9A 2ZTDA 1IM2A 1ZMUA 3T6PA 1P3QQ 1VEJA 2LVQD 3GLIE 2QSFX 1CUKA 1ZMVA 1WGLA 3B89A 1Y8GA 1IXSA 1XB2B 1NV8A 2LVPC 3K9PA 3E21A 2DAIA 1TR8A 2OO9A 1UFZA 2BWEA 1VEKA 2DKLA 1GO5A 1A5TA 1WIVA 3H4JA 1WR1B 2KHHA 2HWJA 1E94E 3LCUA 1VEGA 2DHYA 2MJ5B 1ZMWA 4HEOA 1PGYA 2EKKA 2MR9A 4GEWA 2DENA 1NV9A 3GLHE 1MN3A 3FRHA 2B3TA 3MMPA 1OTRA 4UN2B 1T43A 1HT1E 1VG5A 1HJPA 1WJ7A 3GLFE 2JY7A 2LVNC 2DI0A 2QHOB 2DNAA 2HAKA 1C7YA 1JR3E 3K9OA 2JUJA 2JY5A 4F1IA 1G41A 1OQYA 1OAIA 1DO0A 1G3IA 1AIPC 1DO2A 1WHCA 1VDLA 1T6OA 4R71A 2BWBA 2O25A 2LBCA 1DV0A 2JY6B 1Q02A 2JZ1A 2DAKA 2JNHA 2L4FA 1HT2E 2DAEA 2L4EA 2CP8A 1R4GA 1YLAA 2KNAA 2MROB 1G4AE 2K0BX 2OOBA 2EKFA 4G3OA 1OKSA 5JI2E 2JY8A 2KNZA 3F92A 3GLGE
chains in the Genus database with same CATH superfamily
3M7GA 2KZSA 4IBCA 1G8PA 5IWAM 3U6MA 3MHVC 4YY3M 5F3WA 3BXWA 2YFQA 3B7NA 3KP1E 5KQDA 3JR5A 2V1CA 1K82A 1S3SA 4JI6M 4LF8M 1XNRM 2DZLA 4D80A 5FTNA 4NXMM 1N77A 4L8RC 1F4IA 3VDPA 1GLNA 3KOXE 2KDLA 4IJEA 2JZ0A 5GKNA 2K6BA 4P16A 3L28A 4WURA 1QVRA 5EP2A 1NO1A 4PT5A 2WSFF 1IFYA 3FTDA 2CRUA 2XFTA 3E9SA 4MGYE 1DGHA 3HU2A 4LJ7A 1IXSB 3U61B 1XNQM 3U5ZA 5E26A 2N35A 5ITTA 2LVOC 3BBZA 3IG5A 2LVAA 1QUTA 2J7NA 3CTWB 4B3MM 3K8ZA 1R2YA 2H5XA 4FCWA 1EFUB 2OOAA 2EA0A 3L26A 2LWXA 3DFZA 3GO8A 1G71A 4GC9A 1G59A 1RU3A 3LVWA 1V33A 1P3QQ 3Q8XA 4FVMA 2D7GA 3W0LB 3GLIE 3KW6A 4B7FA 1YSYA 4IBDA 3NBIA 3DOAA 1Y8GA 1IXSA 1JB0F 3U61A 1XB2B 2R4JA 2Z7JA 4IBBA 3TQSA 4P17A 2OQ4A 2H1RA 2F5PA 1C1KA 3J2PB 2BWEA 4PDIA 3D8BA 2DKLA 1A5TA 1NVMA 2YR0A 4NXNM 2FNAA 2DWLA 2XSZA 4JYAM 1N34M 4LJ5A 3M6AA 2ZBKB 1QZMA 2BJVA 3L29A 1OIPA 4PDGA 3SAVA 2DXIA 2EKKA 5A2QS 4AI6A 2EO2A 3HU3A 4I8OA 3GQ5A 4G6ZA 3U6OA 4IBIA 3U60A 5IT9S 4AZFA 1ZAEA 3GLHA 3KDSE 3GRYA 1WXQA 2DHRA 3MMPA 1Z5BA 2JXNA 1N32M 4M9XA 4QNMA 2M60A 1IN7A 2R4EA 5EP4A 3OTOM 3FTEA 1WJ7A 4I4LA 2LVNC 2XEPA 3K1JA 3I01M 4D82A 1L2CA 1Q3BA 5EQTA 3GLFB 2HAKA 1VDDA 3I04M 4LFAM 1L1TA 3FTFA 4NRVA 5C1BA 2JY5A 1LV7A 2FS1A 1OFHA 4LF4M 5KPZA 3RGPA 1OQYA 4A3VB 4OX9M 1IQPA 2BNKA 4QHTA 1DO0A 3T15A 2ZAMA 1G3IA 2Y0TA 2QBYB 4QOSA 1AIPC 2X49A 5JI3E 2LNHC 4B3RM 3IG8A 1WHCA 3AKZA 2BJWA 4OVZA 3CF0A 5FTJA 3UJNA 2YQZA 3SYLA 3VK7A 1LTMA 1V34A 1Q02A 4M0WA 3HWSA 2JZ1A 3HY5A 5DNYA 1I4WA 3ZC7B 1TH4A 1HT2E 2DAEA 2DVWB 3GLFA 4AKHA 3GPPA 3VKHA 3PXGA 2QENA 2K0BX 1SXJE 3I4YA 3FYCA 4S12A 1OKSA 5FLXS 2QPAA 3F92A 2G8LA 3AOGA 5LMUM 1GVNA 3K2LA 4QNRA 4GH9A 2F4VM 3AL0C 5ITRA 4R7GA 3U6LA 4LJ9A 1E32A 2DAMA 2LXEA 2C96A 2ZTCA 4TUWA 3HHZA 1D0KA 2I7NA 1PJSA 2UXBM 4IBFA 1TTEA 3C58A 1EE8A 1K3WA 4XGIA 1ORYB 3T38A 1IBKM 1N36M 4GKKM 3LCVB 1NY6A 1NY5A 3A45A 3A42A 4DR7M 2DAGA 3SMPA 2CUZA 4JI4M 2R0IA 2RRUA 2KXEA 1VQ1A 3HHYA 2OPFA 3K92A 2L2DA 4LJAA 4NSOB 1I94M 4K0KM 1R7RA 2XFSA 2R44A 3U6PA 2JP7A 3KVWA 1BVSA 2XF3A 3SFZA 3LW5F 4GHAA 2KW0A 4LG2A 5DYGA 3GQ3A 2LTUA 2UXCM 2DWZB 3QYBA 3FRIA 3C3EA 1XXHB 3SHGB 3J80S 3NWLA 5EP3A 1QYRA 4MGHA 5FSWA 1GJSA 1KSFX 4L4UA 2LHGA 4G4QA 1D2NA 4DR5M 5KO3A 1MX0A 2LVQD 1ZQ9A 3KSJA 1GKIA 4MM3B 2QSFX 2C99A 3R9XB 2E5LM 4DUZM 2Z3XA 2XZUA 2R65A 2L7HA 5FTLA 1NV8A 5FTMA 1EIJA 3FUTA 2QCUA 2OO9A 4IJFA 3W68A 2QQ8A 2Z4RA 4DV1M 1Z59A 1IXRC 4M0DA 2HHHM 2KHHA 2M5ZA 4KT0F 1NHWC 5ITXA 1E94E 4MH0E 1Q3CA 2KA6B 1VEGA 2DHYA 1ZMWA 1OIZA 4HEOA 1E9RA 1J7KA 1XXHA 1OJLA 4OU7A 3T1YM 1GABA 4G4OA 2DENA 1NV9A 4LCBA 3TPZA 2KEBA 3ZQJA 3B7QA 3AV0A 4DV7M 3U60B 4KODA 1L1ZA 3GLHB 2O01F 3TWMA 1VG5A 1HT1E 4L16A 4B7GA 1R2ZA 2UUCM 3GLFE 3ZCBB 3PVSA 3A46A 1GJTA 1SXJD 2I7PA 4CJ6A 4CIZA 4YHHM 3KP0E 4IIWA 4JV5M 1XHBA 2QHOB 2DNAA 3SAUA 2C5RA 1C7YA 3EIHA 3AFHA 2AHMA 4NOOB 4DUYM 1HR0M 4XBOA 4BBAA 3U6CA 3HGIA 1IN5A 4X62M 1OAIA 3I4VA 4DR1M 4AQYM 1IY0A 2J5YA 4I5SA 4RF1A 2L6OA 3HKPA 4LF5M 4EIWA 5BR8M 3L25A 4NC6A 3GPXA 1QDRA 1T6OA 2KRKA 2CE7A 3FUWA 3TWLA 3UZUA 4R71A 5IZ7D 2O25A 4BB9A 3VFDA 3R8FA 2LBCA 4OVZB 4PD2A 1UM8A 2Z8YM 1DV0A 4RNAA 3VK8A 4B3TM 4JN6A 2WSCF 4M9SA 1TGUA 5EXPA 2L4FA 3H4MA 4IBKA 3SBJA 4FW9A 3JR4A 2L4EA 3Q8GA 2Y20A 3B7ZA 4JXJA 1NNUC 3RE8A 4ANRA 4LGYA 5DYIA 4RF0A 3GQ4A 3U6QA 2EKFA 2F5OA 3FD9A 1IN4A 2ZAOA 2L7IA 2DZOB 4GC5A 1JR3A 4LRSA 5JI2E 2DWMA 3SMSA 4OW0A 2JY8A 4LGMA 3LVVA 2DWNA 1W5SA 4MGZE 2C9OA 3E46A 4R3DA 1DGGA 4X65M 3A98B 4GRIA 3ZH9B 4WP2A 3MK6A 1WGNA 4JI8M 3HX3A 2F5QA 1ZV1A 4JI0M 1XMOM 2ERCA 3KOZE 1HQYE 3FE3A 1QANA 3GRVA 3KOWE 2Y21A 4NSRA 1V92A 1DGFA 1D0LA 4Q7JA 3PNYA 2VQFM 4CHTB 4DV5M 3KSXA 3GRUA 4PCZA 3J81S 4DV3M 1TDHA 2YNMD 2KNVA 4KO8A 1XXHE 2Y0QA 5DFLA 1TDZA 3HJQA 5C18A 2CEAA 3LQQA 4X64M 3T1HM 2ZANA 2A5YB 3UGJA 2G3QA 4DBGB 1SG9A 3U6EA 3HJ8A 1MU5A 1IM2A 2DZNB 2R45A 4AKIA 1Z5AA 4QHSA 2X8AA 3GLIA 3LQRA 1PJJA 1QAOA 2Z4SA 3CGWA 1ZMVA 3EIEA 3AOEC 5L8RF 2LVPC 3DZDA 2C98A 2DAIA 4LY6A 4DR4M 1R5LA 2W82A 1VEKA 1GO5A 1WIVA 3H4JA 5EXXA 4WW0A 4LRTA 4G4NA 4DR6M 3LCUA 2FH0A 3CF6E 2MJ5B 5ITUA 1PGYA 3PFIA 3KXEC 3GLHE 1MN3A 1JQJC 2CFOA 4JI2M 2UXDM 3MJ5A 2B3TA 3I51A 4Z6YA 5KPTA 1OTRA 4UN2B 2XH9A 5ITYA 4KLNA 5H37D 1HJPA 4ITQA 5EP1A 1QUSA 3E4RA 2K47A 1L2BA 2F5SA 2DI0A 4GMQA 3THGA 2V1UA 4KHPM 1YUBA 3LMMA 4IBEA 2FFJA 1JR3E 4LFBM 2HL7A 2JUJA 3M0EA 3FYDA 4F1IA 5LMNM 1AUAA 2Q2EB 1GL7A 2RKOA 3VLFB 2JWSA 4II7A 2HKJA 5EJCA 2CV1A 4MGIE 1MJGM 1VDLA 1IN6A 3RFWA 1J5EM 3U6SA 4W5WA 4DV0M 1Z6TA 3CF2A 2P5TA 3B9PA 2JY6B 3GP1A 2MH8A 4REZA 2XZFA 4CISA 4DV2M 1XC8A 1T3TA 1Q39A 4HL4A 1Z5CA 3HJSA 4DR3M 4D81A 3SHFA 3FUUA 2MROB 1G4AE 3FKEA 2X4AA 4G3OA 4NL4H 1SXJA 3HZJA 3C3DA 3UMMA 3SAWA 3L27A 2FE8A 4DV6M 2J7OA 3SYKA 2EUCA 3GRRA 1NJFA 1QAMA 1IBLM 4NRWA 3GLGB 2LHCA 5IREB 4JI1M 2WZJA 4B3SM 3IECA 2MGWA 3HHWA 1N78A 2GQFA 1R6BX 2CHQA 3KOYE 1YE9A 1QZEA 4M9ZA 2WSEF 2RGOA 4X66M 3FUXA 5KPRA 2QP9X 3ILKA 3J7AS 4F2LA 4L15A 4ZPXA 3VKGA 4LJ4A 1PJIA 2K9DA 2CHGA 2JA2A 4AKGA 2XSZD 3QWLA 3C9PA 3KS4A 4B7HA 4FWDA 1SXJC 4B08A 1GL6A 2O5RA 3SARA 3GPUA 2LH0A 3J7BA 2CWBA 2QNJA 2V6ZM 4JI3M 2XLJA 1IY1A 1L2DA 1N75A 5BPVA 2FOIC 2QZ4A 3IHPA 1FJGM 1HNWM 1KYIA 4RKUF 1NNJA 2R6FA 1IBMM 1XWIA 2R18A 3GLGA 3SASA 3BOSA 3V76A 1PJQA 1PRBA 2VF7A 2EJSA 4CGYB 4AG5A 2KRUA 3TL4X 2ZTDA 3KS8A 1ZMUA 3T6PA 4I81A 4JI5M 4FCVA 1VEJA 2G5GX 5FTKA 5EXTA 2L09A 2UU9M 4IBJA 1CUKA 1HNZM 1JR3D 3VDUA 4LF9M 1WGLA 1OFIA 2CHVA 3B89A 3GLIB 1J09A 3K9PA 3NBXX 3E21A 1TR8A 3D8LA 3AOEA 4L78A 1UFZA 5ITXE 4LFCM 1IY2A 1IN8A 1WR1B 2GNOA 1E9SA 3J27B 2HWJA 4MB7A 4MGKE 1PJTA 4FD2A 4Z8XA 4LJ6A 5E6JA 2MR9A 3JAMS 4L6V6 7CATA 3U6DA 3QYEA 4GEWA 3PNVA 1HQCA 2F5NA 4FCTA 1NJGA 1QAQA 3FRHA 2KZUA 1D0MA 2VF8A 2NQ8C 2XGNA 4FWGA 1L8QA 1T43A 3WHKA 2APLA 3SATA 1NSFA 1X37A 4FWHA 2UUAM 4GIPA 4GHLA 3SC3A 4GITA 1FNNA 2JY7A 3DA1A 4LJ8A 4XK8F 5KQ8A 3B74A 4JI7M 1H6UA 4LZJA 3FUVA 3K9OA 1PM5A 2ZM6M 1G41A 2C9CA 1IXZA 3HHXA 2QBYA 1QQWA 2HCBA 4BLCA 5ITQA 4LF7M 3W0FA 1QDTA 1NHGC 1KFVA 1DO2A 3L2AA 3KFUG 4HLQA 3GPYA 1K3XA 3TWKA 1W5TA 2BWBA 4DR2M 5EXSA 1TH2A 1TH3A 2R46A 2VIIA 3QAUA 1OAOC 2VQEM 2DAKA 1DGBA 2JNHA 2VDBB 4AG6A 4AW4A 8CATA 4LF6M 3AJIB 3HU1A 2CP8A 4LZZA 1R4GA 4Y28F 3W67A 2CV2A 4QOZC 4G4RA 1YLAA 2CV0A 2KNAA 2RGHA 1DGHB 2OOBA 3RGSA 3WHLA 1N33M 3TE6A 3U5ZB 1XMQM 2R62A 4DV4M 2UUBM 4GKJM 1HNXM 3FTCA 2KNZA 4IBGA 1SXJB 3GLGE 3UK6A 1TF0B 2D7EA 2D7HA
chains in the Genus database with same CATH topology
3E46A 2DAMA 4WP2A 2WZJA 1WGNA 2ZTCA 3IECA 2DZLA 2MGWA 1ZV1A 1QZEA 1TTEA 1F4IA 2JZ0A 4F2LA 1HQYE 3FE3A 1IFYA 3LCVB 2K9DA 1V92A 2DAGA 4Q7JA 2R0IA 2RRUA 1VQ1A 2CWBA 2QNJA 2LVOC 3BBZA 2LVAA 2L2DA 2KNVA 3IHPA 1XXHE 2H5XA 5DFLA 1KYIA 2JP7A 1BVSA 1EFUB 2LTUA 2OOAA 3FRIA 2G3QA 4DBGB 2EJSA 1SG9A 2ZTDA 1IM2A 1ZMUA 3T6PA 1P3QQ 1VEJA 2LVQD 3GLIE 2QSFX 1CUKA 1ZMVA 1WGLA 3B89A 1Y8GA 1IXSA 1XB2B 1NV8A 2LVPC 3K9PA 3E21A 2DAIA 1TR8A 2OO9A 1UFZA 2BWEA 1VEKA 2DKLA 1GO5A 1A5TA 1WIVA 3H4JA 1WR1B 2KHHA 2HWJA 1E94E 3LCUA 1VEGA 2DHYA 2MJ5B 1ZMWA 4HEOA 1PGYA 2EKKA 2MR9A 4GEWA 2DENA 1NV9A 3GLHE 1MN3A 3FRHA 2B3TA 3MMPA 1OTRA 4UN2B 1T43A 1HT1E 1VG5A 1HJPA 1WJ7A 3GLFE 2JY7A 2LVNC 2DI0A 2QHOB 2DNAA 2HAKA 1C7YA 1JR3E 3K9OA 2JUJA 2JY5A 4F1IA 1G41A 1OQYA 1OAIA 1DO0A 1G3IA 1AIPC 1DO2A 1WHCA 1VDLA 1T6OA 4R71A 2BWBA 2O25A 2LBCA 1DV0A 2JY6B 1Q02A 2JZ1A 2DAKA 2JNHA 2L4FA 1HT2E 2DAEA 2L4EA 2CP8A 1R4GA 1YLAA 2KNAA 2MROB 1G4AE 2K0BX 2OOBA 2EKFA 4G3OA 1OKSA 5JI2E 2JY8A 2KNZA 3F92A 3GLGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E46 A;  2DAM A;  4WP2 A;  2WZJ A;  1WGN A;  2ZTC A;  3IEC A;  2DZL A;  2MGW A;  1ZV1 A;  1QZE A;  1TTE A;  1F4I A;  2JZ0 A;  4F2L A;  1HQY E;  3FE3 A;  1IFY A;  3LCV B;  2K9D A;  1V92 A;  2DAG A;  4Q7J A;  2R0I A;  2RRU A;  1VQ1 A;  2CWB A;  2QNJ A;  2LVO C;  3BBZ A;  2LVA A;  2L2D A;  2KNV A;  3IHP A;  1XXH E;  2H5X A;  5DFL A;  1KYI A;  2JP7 A;  1BVS A;  1EFU B;  2LTU A;  2OOA A;  3FRI A;  2G3Q A;  4DBG B;  2EJS A;  1SG9 A;  2ZTD A;  1IM2 A;  1ZMU A;  3T6P A;  1P3Q Q;  1VEJ A;  2LVQ D;  3GLI E;  2QSF X;  1CUK A;  1ZMV A;  1WGL A;  3B89 A;  1Y8G A;  1IXS A;  1XB2 B;  1NV8 A;  2LVP C;  3K9P A;  3E21 A;  2DAI A;  1TR8 A;  2OO9 A;  1UFZ A;  2BWE A;  1VEK A;  2DKL A;  1GO5 A;  1A5T A;  1WIV A;  3H4J A;  1WR1 B;  2KHH A;  2HWJ A;  1E94 E;  3LCU A;  1VEG A;  2DHY A;  2MJ5 B;  1ZMW A;  4HEO A;  1PGY A;  2EKK A;  2MR9 A;  4GEW A;  2DEN A;  1NV9 A;  3GLH E;  1MN3 A;  3FRH A;  2B3T A;  3MMP A;  1OTR A;  4UN2 B;  1T43 A;  1HT1 E;  1VG5 A;  1HJP A;  1WJ7 A;  3GLF E;  2JY7 A;  2LVN C;  2DI0 A;  2QHO B;  2DNA A;  2HAK A;  1C7Y A;  1JR3 E;  3K9O A;  2JUJ A;  2JY5 A;  4F1I A;  1G41 A;  1OQY A;  1OAI A;  1DO0 A;  1G3I A;  1AIP C;  1DO2 A;  1WHC A;  1VDL A;  1T6O A;  4R71 A;  2BWB A;  2O25 A;  2LBC A;  1DV0 A;  2JY6 B;  1Q02 A;  2JZ1 A;  2DAK A;  2JNH A;  2L4F A;  1HT2 E;  2DAE A;  2L4E A;  2CP8 A;  1R4G A;  1YLA A;  2KNA A;  2MRO B;  1G4A E;  2K0B X;  2OOB A;  2EKF A;  4G3O A;  1OKS A;  5JI2 E;  2JY8 A;  2KNZ A;  3F92 A;  3GLG E; 
#chains in the Genus database with same CATH topology
 3M7G A;  2KZS A;  4IBC A;  1G8P A;  5IWA M;  3U6M A;  3MHV C;  4YY3 M;  5F3W A;  3BXW A;  2YFQ A;  3B7N A;  3KP1 E;  5KQD A;  3JR5 A;  2V1C A;  1K82 A;  1S3S A;  4JI6 M;  4LF8 M;  1XNR M;  2DZL A;  4D80 A;  5FTN A;  4NXM M;  1N77 A;  4L8R C;  1F4I A;  3VDP A;  1GLN A;  3KOX E;  2KDL A;  4IJE A;  2JZ0 A;  5GKN A;  2K6B A;  4P16 A;  3L28 A;  4WUR A;  1QVR A;  5EP2 A;  1NO1 A;  4PT5 A;  2WSF F;  1IFY A;  3FTD A;  2CRU A;  2XFT A;  3E9S A;  4MGY E;  1DGH A;  3HU2 A;  4LJ7 A;  1IXS B;  3U61 B;  1XNQ M;  3U5Z A;  5E26 A;  2N35 A;  5ITT A;  2LVO C;  3BBZ A;  3IG5 A;  2LVA A;  1QUT A;  2J7N A;  3CTW B;  4B3M M;  3K8Z A;  1R2Y A;  2H5X A;  4FCW A;  1EFU B;  2OOA A;  2EA0 A;  3L26 A;  2LWX A;  3DFZ A;  3GO8 A;  1G71 A;  4GC9 A;  1G59 A;  1RU3 A;  3LVW A;  1V33 A;  1P3Q Q;  3Q8X A;  4FVM A;  2D7G A;  3W0L B;  3GLI E;  3KW6 A;  4B7F A;  1YSY A;  4IBD A;  3NBI A;  3DOA A;  1Y8G A;  1IXS A;  1JB0 F;  3U61 A;  1XB2 B;  2R4J A;  2Z7J A;  4IBB A;  3TQS A;  4P17 A;  2OQ4 A;  2H1R A;  2F5P A;  1C1K A;  3J2P B;  2BWE A;  4PDI A;  3D8B A;  2DKL A;  1A5T A;  1NVM A;  2YR0 A;  4NXN M;  2FNA A;  2DWL A;  2XSZ A;  4JYA M;  1N34 M;  4LJ5 A;  3M6A A;  2ZBK B;  1QZM A;  2BJV A;  3L29 A;  1OIP A;  4PDG A;  3SAV A;  2DXI A;  2EKK A;  5A2Q S;  4AI6 A;  2EO2 A;  3HU3 A;  4I8O A;  3GQ5 A;  4G6Z A;  3U6O A;  4IBI A;  3U60 A;  5IT9 S;  4AZF A;  1ZAE A;  3GLH A;  3KDS E;  3GRY A;  1WXQ A;  2DHR A;  3MMP A;  1Z5B A;  2JXN A;  1N32 M;  4M9X A;  4QNM A;  2M60 A;  1IN7 A;  2R4E A;  5EP4 A;  3OTO M;  3FTE A;  1WJ7 A;  4I4L A;  2LVN C;  2XEP A;  3K1J A;  3I01 M;  4D82 A;  1L2C A;  1Q3B A;  5EQT A;  3GLF B;  2HAK A;  1VDD A;  3I04 M;  4LFA M;  1L1T A;  3FTF A;  4NRV A;  5C1B A;  2JY5 A;  1LV7 A;  2FS1 A;  1OFH A;  4LF4 M;  5KPZ A;  3RGP A;  1OQY A;  4A3V B;  4OX9 M;  1IQP A;  2BNK A;  4QHT A;  1DO0 A;  3T15 A;  2ZAM A;  1G3I A;  2Y0T A;  2QBY B;  4QOS A;  1AIP C;  2X49 A;  5JI3 E;  2LNH C;  4B3R M;  3IG8 A;  1WHC A;  3AKZ A;  2BJW A;  4OVZ A;  3CF0 A;  5FTJ A;  3UJN A;  2YQZ A;  3SYL A;  3VK7 A;  1LTM A;  1V34 A;  1Q02 A;  4M0W A;  3HWS A;  2JZ1 A;  3HY5 A;  5DNY A;  1I4W A;  3ZC7 B;  1TH4 A;  1HT2 E;  2DAE A;  2DVW B;  3GLF A;  4AKH A;  3GPP A;  3VKH A;  3PXG A;  2QEN A;  2K0B X;  1SXJ E;  3I4Y A;  3FYC A;  4S12 A;  1OKS A;  5FLX S;  2QPA A;  3F92 A;  2G8L A;  3AOG A;  5LMU M;  1GVN A;  3K2L A;  4QNR A;  4GH9 A;  2F4V M;  3AL0 C;  5ITR A;  4R7G A;  3U6L A;  4LJ9 A;  1E32 A;  2DAM A;  2LXE A;  2C96 A;  2ZTC A;  4TUW A;  3HHZ A;  1D0K A;  2I7N A;  1PJS A;  2UXB M;  4IBF A;  1TTE A;  3C58 A;  1EE8 A;  1K3W A;  4XGI A;  1ORY B;  3T38 A;  1IBK M;  1N36 M;  4GKK M;  3LCV B;  1NY6 A;  1NY5 A;  3A45 A;  3A42 A;  4DR7 M;  2DAG A;  3SMP A;  2CUZ A;  4JI4 M;  2R0I A;  2RRU A;  2KXE A;  1VQ1 A;  3HHY A;  2OPF A;  3K92 A;  2L2D A;  4LJA A;  4NSO B;  1I94 M;  4K0K M;  1R7R A;  2XFS A;  2R44 A;  3U6P A;  2JP7 A;  3KVW A;  1BVS A;  2XF3 A;  3SFZ A;  3LW5 F;  4GHA A;  2KW0 A;  4LG2 A;  5DYG A;  3GQ3 A;  2LTU A;  2UXC M;  2DWZ B;  3QYB A;  3FRI A;  3C3E A;  1XXH B;  3SHG B;  3J80 S;  3NWL A;  5EP3 A;  1QYR A;  4MGH A;  5FSW A;  1GJS A;  1KSF X;  4L4U A;  2LHG A;  4G4Q A;  1D2N A;  4DR5 M;  5KO3 A;  1MX0 A;  2LVQ D;  1ZQ9 A;  3KSJ A;  1GKI A;  4MM3 B;  2QSF X;  2C99 A;  3R9X B;  2E5L M;  4DUZ M;  2Z3X A;  2XZU A;  2R65 A;  2L7H A;  5FTL A;  1NV8 A;  5FTM A;  1EIJ A;  3FUT A;  2QCU A;  2OO9 A;  4IJF A;  3W68 A;  2QQ8 A;  2Z4R A;  4DV1 M;  1Z59 A;  1IXR C;  4M0D A;  2HHH M;  2KHH A;  2M5Z A;  4KT0 F;  1NHW C;  5ITX A;  1E94 E;  4MH0 E;  1Q3C A;  2KA6 B;  1VEG A;  2DHY A;  1ZMW A;  1OIZ A;  4HEO A;  1E9R A;  1J7K A;  1XXH A;  1OJL A;  4OU7 A;  3T1Y M;  1GAB A;  4G4O A;  2DEN A;  1NV9 A;  4LCB A;  3TPZ A;  2KEB A;  3ZQJ A;  3B7Q A;  3AV0 A;  4DV7 M;  3U60 B;  4KOD A;  1L1Z A;  3GLH B;  2O01 F;  3TWM A;  1VG5 A;  1HT1 E;  4L16 A;  4B7G A;  1R2Z A;  2UUC M;  3GLF E;  3ZCB B;  3PVS A;  3A46 A;  1GJT A;  1SXJ D;  2I7P A;  4CJ6 A;  4CIZ A;  4YHH M;  3KP0 E;  4IIW A;  4JV5 M;  1XHB A;  2QHO B;  2DNA A;  3SAU A;  2C5R A;  1C7Y A;  3EIH A;  3AFH A;  2AHM A;  4NOO B;  4DUY M;  1HR0 M;  4XBO A;  4BBA A;  3U6C A;  3HGI A;  1IN5 A;  4X62 M;  1OAI A;  3I4V A;  4DR1 M;  4AQY M;  1IY0 A;  2J5Y A;  4I5S A;  4RF1 A;  2L6O A;  3HKP A;  4LF5 M;  4EIW A;  5BR8 M;  3L25 A;  4NC6 A;  3GPX A;  1QDR A;  1T6O A;  2KRK A;  2CE7 A;  3FUW A;  3TWL A;  3UZU A;  4R71 A;  5IZ7 D;  2O25 A;  4BB9 A;  3VFD A;  3R8F A;  2LBC A;  4OVZ B;  4PD2 A;  1UM8 A;  2Z8Y M;  1DV0 A;  4RNA A;  3VK8 A;  4B3T M;  4JN6 A;  2WSC F;  4M9S A;  1TGU A;  5EXP A;  2L4F A;  3H4M A;  4IBK A;  3SBJ A;  4FW9 A;  3JR4 A;  2L4E A;  3Q8G A;  2Y20 A;  3B7Z A;  4JXJ A;  1NNU C;  3RE8 A;  4ANR A;  4LGY A;  5DYI A;  4RF0 A;  3GQ4 A;  3U6Q A;  2EKF A;  2F5O A;  3FD9 A;  1IN4 A;  2ZAO A;  2L7I A;  2DZO B;  4GC5 A;  1JR3 A;  4LRS A;  5JI2 E;  2DWM A;  3SMS A;  4OW0 A;  2JY8 A;  4LGM A;  3LVV A;  2DWN A;  1W5S A;  4MGZ E;  2C9O A;  3E46 A;  4R3D A;  1DGG A;  4X65 M;  3A98 B;  4GRI A;  3ZH9 B;  4WP2 A;  3MK6 A;  1WGN A;  4JI8 M;  3HX3 A;  2F5Q A;  1ZV1 A;  4JI0 M;  1XMO M;  2ERC A;  3KOZ E;  1HQY E;  3FE3 A;  1QAN A;  3GRV A;  3KOW E;  2Y21 A;  4NSR A;  1V92 A;  1DGF A;  1D0L A;  4Q7J A;  3PNY A;  2VQF M;  4CHT B;  4DV5 M;  3KSX A;  3GRU A;  4PCZ A;  3J81 S;  4DV3 M;  1TDH A;  2YNM D;  2KNV A;  4KO8 A;  1XXH E;  2Y0Q A;  5DFL A;  1TDZ A;  3HJQ A;  5C18 A;  2CEA A;  3LQQ A;  4X64 M;  3T1H M;  2ZAN A;  2A5Y B;  3UGJ A;  2G3Q A;  4DBG B;  1SG9 A;  3U6E A;  3HJ8 A;  1MU5 A;  1IM2 A;  2DZN B;  2R45 A;  4AKI A;  1Z5A A;  4QHS A;  2X8A A;  3GLI A;  3LQR A;  1PJJ A;  1QAO A;  2Z4S A;  3CGW A;  1ZMV A;  3EIE A;  3AOE C;  5L8R F;  2LVP C;  3DZD A;  2C98 A;  2DAI A;  4LY6 A;  4DR4 M;  1R5L A;  2W82 A;  1VEK A;  1GO5 A;  1WIV A;  3H4J A;  5EXX A;  4WW0 A;  4LRT A;  4G4N A;  4DR6 M;  3LCU A;  2FH0 A;  3CF6 E;  2MJ5 B;  5ITU A;  1PGY A;  3PFI A;  3KXE C;  3GLH E;  1MN3 A;  1JQJ C;  2CFO A;  4JI2 M;  2UXD M;  3MJ5 A;  2B3T A;  3I51 A;  4Z6Y A;  5KPT A;  1OTR A;  4UN2 B;  2XH9 A;  5ITY A;  4KLN A;  5H37 D;  1HJP A;  4ITQ A;  5EP1 A;  1QUS A;  3E4R A;  2K47 A;  1L2B A;  2F5S A;  2DI0 A;  4GMQ A;  3THG A;  2V1U A;  4KHP M;  1YUB A;  3LMM A;  4IBE A;  2FFJ A;  1JR3 E;  4LFB M;  2HL7 A;  2JUJ A;  3M0E A;  3FYD A;  4F1I A;  5LMN M;  1AUA A;  2Q2E B;  1GL7 A;  2RKO A;  3VLF B;  2JWS A;  4II7 A;  2HKJ A;  5EJC A;  2CV1 A;  4MGI E;  1MJG M;  1VDL A;  1IN6 A;  3RFW A;  1J5E M;  3U6S A;  4W5W A;  4DV0 M;  1Z6T A;  3CF2 A;  2P5T A;  3B9P A;  2JY6 B;  3GP1 A;  2MH8 A;  4REZ A;  2XZF A;  4CIS A;  4DV2 M;  1XC8 A;  1T3T A;  1Q39 A;  4HL4 A;  1Z5C A;  3HJS A;  4DR3 M;  4D81 A;  3SHF A;  3FUU A;  2MRO B;  1G4A E;  3FKE A;  2X4A A;  4G3O A;  4NL4 H;  1SXJ A;  3HZJ A;  3C3D A;  3UMM A;  3SAW A;  3L27 A;  2FE8 A;  4DV6 M;  2J7O A;  3SYK A;  2EUC A;  3GRR A;  1NJF A;  1QAM A;  1IBL M;  4NRW A;  3GLG B;  2LHC A;  5IRE B;  4JI1 M;  2WZJ A;  4B3S M;  3IEC A;  2MGW A;  3HHW A;  1N78 A;  2GQF A;  1R6B X;  2CHQ A;  3KOY E;  1YE9 A;  1QZE A;  4M9Z A;  2WSE F;  2RGO A;  4X66 M;  3FUX A;  5KPR A;  2QP9 X;  3ILK A;  3J7A S;  4F2L A;  4L15 A;  4ZPX A;  3VKG A;  4LJ4 A;  1PJI A;  2K9D A;  2CHG A;  2JA2 A;  4AKG A;  2XSZ D;  3QWL A;  3C9P A;  3KS4 A;  4B7H A;  4FWD A;  1SXJ C;  4B08 A;  1GL6 A;  2O5R A;  3SAR A;  3GPU A;  2LH0 A;  3J7B A;  2CWB A;  2QNJ A;  2V6Z M;  4JI3 M;  2XLJ A;  1IY1 A;  1L2D A;  1N75 A;  5BPV A;  2FOI C;  2QZ4 A;  3IHP A;  1FJG M;  1HNW M;  1KYI A;  4RKU F;  1NNJ A;  2R6F A;  1IBM M;  1XWI A;  2R18 A;  3GLG A;  3SAS A;  3BOS A;  3V76 A;  1PJQ A;  1PRB A;  2VF7 A;  2EJS A;  4CGY B;  4AG5 A;  2KRU A;  3TL4 X;  2ZTD A;  3KS8 A;  1ZMU A;  3T6P A;  4I81 A;  4JI5 M;  4FCV A;  1VEJ A;  2G5G X;  5FTK A;  5EXT A;  2L09 A;  2UU9 M;  4IBJ A;  1CUK A;  1HNZ M;  1JR3 D;  3VDU A;  4LF9 M;  1WGL A;  1OFI A;  2CHV A;  3B89 A;  3GLI B;  1J09 A;  3K9P A;  3NBX X;  3E21 A;  1TR8 A;  3D8L A;  3AOE A;  4L78 A;  1UFZ A;  5ITX E;  4LFC M;  1IY2 A;  1IN8 A;  1WR1 B;  2GNO A;  1E9S A;  3J27 B;  2HWJ A;  4MB7 A;  4MGK E;  1PJT A;  4FD2 A;  4Z8X A;  4LJ6 A;  5E6J A;  2MR9 A;  3JAM S;  4L6V 6;  7CAT A;  3U6D A;  3QYE A;  4GEW A;  3PNV A;  1HQC A;  2F5N A;  4FCT A;  1NJG A;  1QAQ A;  3FRH A;  2KZU A;  1D0M A;  2VF8 A;  2NQ8 C;  2XGN A;  4FWG A;  1L8Q A;  1T43 A;  3WHK A;  2APL A;  3SAT A;  1NSF A;  1X37 A;  4FWH A;  2UUA M;  4GIP A;  4GHL A;  3SC3 A;  4GIT A;  1FNN A;  2JY7 A;  3DA1 A;  4LJ8 A;  4XK8 F;  5KQ8 A;  3B74 A;  4JI7 M;  1H6U A;  4LZJ A;  3FUV A;  3K9O A;  1PM5 A;  2ZM6 M;  1G41 A;  2C9C A;  1IXZ A;  3HHX A;  2QBY A;  1QQW A;  2HCB A;  4BLC A;  5ITQ A;  4LF7 M;  3W0F A;  1QDT A;  1NHG C;  1KFV A;  1DO2 A;  3L2A A;  3KFU G;  4HLQ A;  3GPY A;  1K3X A;  3TWK A;  1W5T A;  2BWB A;  4DR2 M;  5EXS A;  1TH2 A;  1TH3 A;  2R46 A;  2VII A;  3QAU A;  1OAO C;  2VQE M;  2DAK A;  1DGB A;  2JNH A;  2VDB B;  4AG6 A;  4AW4 A;  8CAT A;  4LF6 M;  3AJI B;  3HU1 A;  2CP8 A;  4LZZ A;  1R4G A;  4Y28 F;  3W67 A;  2CV2 A;  4QOZ C;  4G4R A;  1YLA A;  2CV0 A;  2KNA A;  2RGH A;  1DGH B;  2OOB A;  3RGS A;  3WHL A;  1N33 M;  3TE6 A;  3U5Z B;  1XMQ M;  2R62 A;  4DV4 M;  2UUB M;  4GKJ M;  1HNX M;  3FTC A;  2KNZ A;  4IBG A;  1SXJ B;  3GLG E;  3UK6 A;  1TF0 B;  2D7E A;  2D7H A; 
#chains in the Genus database with same CATH homology
 3E46 A;  2DAM A;  4WP2 A;  2WZJ A;  1WGN A;  2ZTC A;  3IEC A;  2DZL A;  2MGW A;  1ZV1 A;  1QZE A;  1TTE A;  1F4I A;  2JZ0 A;  4F2L A;  1HQY E;  3FE3 A;  1IFY A;  3LCV B;  2K9D A;  1V92 A;  2DAG A;  4Q7J A;  2R0I A;  2RRU A;  1VQ1 A;  2CWB A;  2QNJ A;  2LVO C;  3BBZ A;  2LVA A;  2L2D A;  2KNV A;  3IHP A;  1XXH E;  2H5X A;  5DFL A;  1KYI A;  2JP7 A;  1BVS A;  1EFU B;  2LTU A;  2OOA A;  3FRI A;  2G3Q A;  4DBG B;  2EJS A;  1SG9 A;  2ZTD A;  1IM2 A;  1ZMU A;  3T6P A;  1P3Q Q;  1VEJ A;  2LVQ D;  3GLI E;  2QSF X;  1CUK A;  1ZMV A;  1WGL A;  3B89 A;  1Y8G A;  1IXS A;  1XB2 B;  1NV8 A;  2LVP C;  3K9P A;  3E21 A;  2DAI A;  1TR8 A;  2OO9 A;  1UFZ A;  2BWE A;  1VEK A;  2DKL A;  1GO5 A;  1A5T A;  1WIV A;  3H4J A;  1WR1 B;  2KHH A;  2HWJ A;  1E94 E;  3LCU A;  1VEG A;  2DHY A;  2MJ5 B;  1ZMW A;  4HEO A;  1PGY A;  2EKK A;  2MR9 A;  4GEW A;  2DEN A;  1NV9 A;  3GLH E;  1MN3 A;  3FRH A;  2B3T A;  3MMP A;  1OTR A;  4UN2 B;  1T43 A;  1HT1 E;  1VG5 A;  1HJP A;  1WJ7 A;  3GLF E;  2JY7 A;  2LVN C;  2DI0 A;  2QHO B;  2DNA A;  2HAK A;  1C7Y A;  1JR3 E;  3K9O A;  2JUJ A;  2JY5 A;  4F1I A;  1G41 A;  1OQY A;  1OAI A;  1DO0 A;  1G3I A;  1AIP C;  1DO2 A;  1WHC A;  1VDL A;  1T6O A;  4R71 A;  2BWB A;  2O25 A;  2LBC A;  1DV0 A;  2JY6 B;  1Q02 A;  2JZ1 A;  2DAK A;  2JNH A;  2L4F A;  1HT2 E;  2DAE A;  2L4E A;  2CP8 A;  1R4G A;  1YLA A;  2KNA A;  2MRO B;  1G4A E;  2K0B X;  2OOB A;  2EKF A;  4G3O A;  1OKS A;  5JI2 E;  2JY8 A;  2KNZ A;  3F92 A;  3GLG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...