2DAIA

Solution structure of the first uba domain in the human ubiquitin associated domain containing 1 (ubadc1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
83
structure length
83
Chain Sequence
GSSGSSGDAVELFKKANAMLDEDEDERVDEAALRQLTEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTIDTPLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin associated domain containing 1
publication title Solution Structure of the First UBA Domain in the Human Ubiquitin Associated Domain Containing 1 (UBADC1)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 10
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2daiA00
1PGYA 3GLGE 2MGWA 2DI0A 3MMPA 2MJ5B 2LBCA 4R71A 1R4GA 5DFLA 2LVNC 1G41A 2KHHA 1E94E 1VQ1A 1UFZA 3H4JA 1VG5A 3IHPA 1WJ7A 1WHCA 1NV8A 1G4AE 2LVQD 1T43A 1ZMUA 4G3OA 2DAIA 2B3TA 1T6OA 3E46A 1OAIA 1BVSA 2R0IA 3LCUA 2G3QA 1Q02A 1NV9A 1VEJA 2KNVA 4F2LA 1EFUB 3FE3A 2DAKA 1WR1B 3B89A 3GLIE 1G3IA 2DNAA 1DV0A 2JY7A 2K9DA 1QZEA 2HWJA 1XB2B 4Q7JA 2OOAA 2DENA 1CUKA 4DBGB 1IXSA 5JI2E 3LCVB 2EKFA 1WIVA 4WP2A 3K9PA 1TTEA 1KYIA 1WGNA 2DKLA 1HT2E 2ZTCA 2KNAA 2CWBA 1V92A 1F4IA 1ZMVA 1Y8GA 2WZJA 1OTRA 2H5XA 2LVPC 1MN3A 4GEWA 1VDLA 1SG9A 2K0BX 3K9OA 1HT1E 2BWBA 1GO5A 1IM2A 2JZ1A 1ZV1A 2QSFX 1VEGA 3IECA 2JNHA 2DAGA 2ZTDA 3GLHE 1OQYA 2JY8A 2LVAA 1DO0A 1P3QQ 1JR3E 2QNJA 1HQYE 1A5TA 2BWEA 3FRHA 2DHYA 2LTUA 2JZ0A 2QHOB 1YLAA 1HJPA 2JY5A 2L4FA 2KNZA 2DAMA 2EJSA 2JY6B 2L4EA 2LVOC 3GLFE 2EKKA 3BBZA 2MR9A 2O25A 2OO9A 2JUJA 1AIPC 4HEOA 3F92A 2DAEA 4F1IA 2CP8A 1WGLA 3FRIA 3T6PA 2HAKA 2DZLA 2OOBA 1TR8A 2MROB 1OKSA 1C7YA 1ZMWA 2JP7A 4UN2B 2L2DA 2RRUA 1VEKA 1IFYA 1DO2A 3E21A 1XXHE
chains in the Genus database with same CATH superfamily
5KO3A 2CV2A 2VIIA 2DI0A 2O01F 4D80A 4QOZC 4MGIE 2QCUA 5IT9S 2M60A 4DR1M 2MJ5B 3U6CA 1J09A 4GC9A 3SFZA 2LVNC 3TPZA 1TH3A 3RFWA 4BB9A 1VG5A 1WJ7A 1JR3A 1TDHA 5GKNA 3JR4A 1IY2A 1Z6TA 2LH0A 1YSYA 4LFAM 2LVQD 1N75A 3U5ZB 1PRBA 1QUTA 3BOSA 2F5QA 4GMQA 4PD2A 2DAIA 1T6OA 2BJVA 1D2NA 1KSFX 2R46A 3D8BA 3GRRA 2EUCA 2KDLA 2R0IA 2G3QA 3I04M 1VEJA 4L16A 3TE6A 5L8RF 1EFUB 3C9PA 4KLNA 4GITA 1L1ZA 4LY6A 4LF5M 1L8QA 2G5GX 3PVSA 3L27A 1Q3CA 2VQFM 2XZUA 5ITTA 1FJGM 3GRYA 2D7EA 3U6LA 2F5OA 2R18A 4Q7JA 5DYIA 3KS4A 3B7QA 3U61A 1FNNA 3LCVB 4DR4M 2FH0A 3NBIA 4B7HA 3FYDA 3K2LA 2R65A 4MGKE 3IG5A 1XMOM 1KYIA 1WGNA 1QYRA 3TQSA 4DV4M 1N36M 2VQEM 3U5ZA 1R2ZA 3SBJA 4CISA 4PDGA 4GHAA 2LVPC 2QP9X 1MN3A 2KW0A 2R45A 2K0BX 2XF3A 5KPTA 5FTMA 1K3XA 3SMPA 5KPZA 4I4LA 4G4OA 4JI8M 2D7HA 4AKIA 2BWBA 2L7IA 3M6AA 5FTLA 3I01M 5EQTA 1IM2A 2F4VM 1ZV1A 2HKJA 1X37A 2LWXA 1R7RA 3IECA 3VLFB 2DAGA 2ZTDA 2LHGA 3GLHE 3LW5F 1QUSA 2LVAA 1SXJB 3K92A 3GQ5A 1JR3E 4LFBM 3H4MA 3I4YA 2CHVA 1Z5BA 3R8FA 7CATA 2C5RA 1V34A 4B08A 3U6DA 4DV1M 3FRHA 4BLCA 3KOZE 2QQ8A 3KS8A 2R6FA 2X8AA 2R4JA 2H1RA 2Z3XA 2L4FA 4G4QA 1TF0B 1WXQA 2KNZA 3AOGA 2EJSA 2JY6B 3B9PA 4LZZA 3CF0A 3RGPA 3DFZA 4JN6A 3A45A 3U6MA 1K3WA 2MR9A 2Z8YM 4ZPXA 2YNMD 1Q39A 3TWKA 1XXHA 4F1IA 1LTMA 4L4UA 2APLA 4PT5A 4B3RM 4LRSA 5EXPA 1ZAEA 4LJ9A 2DXIA 1D0LA 1ORYB 2KA6B 1NJFA 1HNXM 3J27B 4IBEA 2KEBA 2G8LA 1OKSA 3MJ5A 3SHGB 3Q8XA 1QDTA 3FUWA 3HHZA 1C7YA 3KP0E 2X4AA 4XGIA 1IXZA 5EJCA 2DWZB 3L26A 2CFOA 4MGZE 4CHTB 4LCBA 4AI6A 3DA1A 4GKKM 1DO2A 3LVVA 4KHPM 1IFYA 4FW9A 3NBXX 3J81S 3PXGA 2ZAOA 4AG6A 2XSZA 1I4WA 4DV5M 2CV0A 3L28A 2V1CA 4CGYB 2LBCA 1G59A 2UXCM 5DFLA 3U6PA 3GPUA 3KOXE 3KFUG 5LMUM 3BXWA 1J7KA 1G41A 2MH8A 4IBBA 3RGSA 4LF8M 1E94E 1VQ1A 3PNYA 3GP1A 2XEPA 1IN7A 2C96A 3KW6A 3SC3A 5ITQA 3U60B 1NV8A 1H6UA 3C3DA 3E46A 4FWHA 2M5ZA 3I51A 3LCUA 1D0KA 3KSJA 1YUBA 3J2PB 4NL4H 3M0EA 4MM3B 4BBAA 3GLGB 3HHYA 1QANA 2L7HA 4IIWA 4NRWA 1GVNA 4AKHA 4IBDA 1WR1B 1DV0A 2DNAA 1QZEA 1XB2B 2LXEA 3IG8A 4IBIA 1QZMA 1C1KA 1QVRA 4M0WA 4JV5M 3HU1A 5ITRA 1IXSA 5JI2E 1QQWA 1XMQM 1WIVA 1UM8A 1E9RA 1DGFA 1OJLA 3GLHA 4JI3M 2ZAMA 1TTEA 4LZJA 1TGUA 3EIHA 1TH2A 1L1TA 2Y20A 3W67A 3KVWA 5EP3A 2I7NA 2HL7A 4TUWA 3E4RA 4R3DA 3HKPA 3HWSA 3E9SA 1L2DA 4OVZA 1F4IA 5ITXA 1V33A 3W68A 1R2YA 2Z4SA 4GH9A 3W0LB 2FOIC 2QPAA 4S12A 5A2QS 3GLIB 1GJSA 2JWSA 2UUBM 2DWLA 1OIZA 3J7BA 4LJ8A 1IN5A 1AUAA 2C9OA 4GKJM 4Y28F 2CHQA 2QSFX 1VEGA 3AFHA 3PNVA 2JNHA 2RGHA 3WHLA 5KQDA 1P3QQ 3W0FA 2F5PA 3SATA 1SXJD 3GRUA 1EIJA 2ZM6M 3GQ3A 1A5TA 3UGJA 1DGHB 1GJTA 1GLNA 1D0MA 2DZOB 2LNHC 5IWAM 2CV1A 2QBYB 2XGNA 4GHLA 3FUUA 1NY5A 3FTFA 1QAMA 2CE7A 2X49A 4M9SA 3B74A 1SXJC 2O25A 3V76A 1OFIA 1IBMM 4HEOA 3WHKA 4CJ6A 2CP8A 1W5TA 4QHSA 2Q2EB 5H37D 2JA2A 3T38A 2HAKA 3K1JA 1XWIA 3VFDA 2Y21A 4M9ZA 3GPYA 1TR8A 3L2AA 2OQ4A 3LMMA 3NWLA 4LF4M 5EXTA 4FCVA 4KO8A 4LF6M 4R7GA 3VKGA 3RE8A 5E26A 2JP7A 2RGOA 1N32M 5ITXE 1N77A 1IBKM 2UU9M 3FYCA 5FLXS 3GLFB 2C98A 2RRUA 3HJQA 4A3VB 4AW4A 3GRVA 4M0DA 4DV2M 1PGYA 3GLGE 2WSCF 4MB7A 3UZUA 2A5YB 1TH4A 3C3EA 3MMPA 2L6OA 4CIZA 1NSFA 3QAUA 4R71A 3AL0C 4D82A 3I4VA 3SYKA 1MX0A 3A42A 3AKZA 4FWGA 4IJFA 3K8ZA 3H4JA 1UFZA 4LJAA 3ZC7B 4DV3M 1HR0M 4IJEA 1NNUC 4DR3M 1SXJA 3TL4X 5FSWA 4FCWA 1T43A 4X65M 1L2BA 3UK6A 1XC8A 4LG2A 1OAOC 3OTOM 3R9XB 1Z59A 3TWLA 3CF2A 4RNAA 4F2LA 1XHBA 2W82A 3FE3A 2EO2A 2J7OA 4AG5A 3KSXA 2DAKA 3B89A 1MU5A 1OFHA 1G3IA 2VDBB 4I8OA 4IBFA 4MH0E 3GLIE 4LJ4A 2HWJA 1PJQA 2WSEF 4II7A 1N33M 4JI4M 2OOAA 1IN8A 2DENA 2ERCA 1JB0F 2FNAA 4P16A 2CEAA 2XLJA 1KFVA 1JR3D 3T1HM 2ZANA 2EKFA 2FFJA 1G8PA 3K9PA 1QAQA 4NSRA 3HHXA 2DZNB 2J7NA 4G6ZA 4LJ7A 1GABA 4OU7A 2HHHM 2KZSA 2BNKA 3AJIB 5C18A 4AQYM 4I81A 1HT2E 1GL7A 1E32A 3QYEA 2CWBA 4MGHA 3SYLA 3VDUA 5KPRA 3UJNA 1V92A 3T1YM 2KRUA 1QAOA 2C99A 1Y8GA 2WZJA 1OTRA 4LGMA 5IREB 3ZCBB 1GKIA 4GEWA 4RF1A 1SG9A 5IZ7D 3JR5A 4JYAM 1HT1E 4YY3M 3AV0A 1DGGA 1N34M 3U6EA 2R4EA 3ILKA 4B3TM 3T15A 3AOEC 5DYGA 4NXMM 2JY8A 1I94M 1W5SA 2K47A 4MGYE 4LRTA 1NNJA 1SXJE 3FUXA 1HQYE 2BWEA 4L8RC 8CATA 1R6BX 2DHYA 2LTUA 5EP1A 4DV0M 4LF7M 4RF0A 1J5EM 2JZ0A 3U60A 5BPVA 3EIEA 2JY5A 2DAMA 2D7GA 2GQFA 2L4EA 2LVOC 3GLFE 5E6JA 4FD2A 3FD9A 2UUCM 2EKKA 1L2CA 1NVMA 5F3WA 4ITQA 3B7NA 2UXDM 2JUJA 4NXNM 3F92A 2KZUA 2FE8A 3LQRA 4NSOB 1XNQM 3GLGA 4QNMA 4OX9M 4NOOB 2CRUA 4L78A 2XFSA 3FRIA 4FWDA 3U61B 3VKHA 4GRIA 4HLQA 1R5LA 4B7GA 1N78A 4P17A 2XZFA 2DZLA 2OOBA 3MK6A 3Q8GA 2UXBM 4QOSA 1TDZA 2MROB 2WSFF 4IBCA 3A46A 4G4RA 4KT0F 2R44A 4IBJA 1JQJC 4L6V6 4XBOA 3U6OA 3KP1E 3M7GA 2NQ8C 3B7ZA 5EXXA 4RKUF 2L2DA 1PJTA 3AOEA 3FKEA 4M9XA 4NRVA 4QNRA 1VEKA 3LQQA 3E21A 3DOAA 3KXEC 1IN4A 4DV7M 2MGWA 3KDSE 5JI3E 2XFTA 3HHWA 4DV6M 3GLIA 2E5LM 4G4NA 1R4GA 4LF9M 4LFCM 2KHHA 2Z4RA 1QDRA 4LGYA 3CF6E 2KRKA 3HX3A 3IHPA 4DUZM 3D8LA 4IBGA 1WHCA 3ZQJA 4B3MM 1NHWC 2DHRA 1G4AE 3SAUA 3VDPA 2I7PA 2K6BA 1ZMUA 4G3OA 3VK8A 2B3TA 4L15A 2BJWA 4HL4A 3GPXA 1OAIA 1BVSA 4KODA 5KQ8A 1Q02A 1DGHA 1NV9A 2KNVA 1ZQ9A 3GQ4A 1PJIA 2XSZD 3FTCA 4LJ6A 1XXHB 4NC6A 1PM5A 4GIPA 2QBYA 5EP2A 4PCZA 5DNYA 1S3SA 1LV7A 2XH9A 2OPFA 3FTDA 1Z5AA 3MHVC 3U6SA 2JY7A 1OIPA 2K9DA 4JI6M 2Y0QA 3KOWE 1K82A 2CUZA 3L29A 1CUKA 3VK7A 5FTKA 2AHMA 4DBGB 2UUAM 1PJJA 1HQCA 4WP2A 3C58A 4OW0A 1IBLM 3SHFA 2V1UA 2Z7JA 3CTWB 3QYBA 3ZH9B 3CGWA 3UMMA 1IXRC 3HU3A 1IY1A 1E9SA 2DKLA 2VF7A 2ZTCA 5FTJA 2KNAA 2R62A 1HNZM 2DWNA 4FVMA 1HNWM 1ZMVA 4WURA 4JI7M 4I5SA 2H5XA 3FUVA 2QENA 3GO8A 1VDLA 2V6ZM 3L25A 4REZA 1RU3A 2JXNA 2HCBA 2GNOA 3K9OA 3LVWA 4JXJA 1PJSA 5EXSA 4PDIA 3GLFA 1VDDA 4EIWA 4ANRA 4GC5A 5EP4A 1IN6A 2YQZA 3THGA 1NHGC 2JZ1A 4FCTA 4LJ5A 4Z6YA 2EA0A 1GO5A 3KOYE 2FS1A 1Z5CA 4B7FA 4WW0A 2VF8A 3HU2A 4JI2M 1NJGA 2ZBKB 1OQYA 3JAMS 4W5WA 1DO0A 3FUTA 2O5RA 4DR5M 2QNJA 2YFQA 2LHCA 4AZFA 4DUYM 1EE8A 2C9CA 4YHHM 4K0KM 2YR0A 1IQPA 1MJGM 3J7AS 1YE9A 1NY6A 3HJSA 3SASA 2DVWB 2P5TA 2QHOB 2J5YA 4AKGA 1YLAA 2KXEA 1HJPA 4Z8XA 4DR6M 3FTEA 3SARA 4DR7M 3SMSA 3BBZA 2Y0TA 4JI0M 3TWMA 2OO9A 4QHTA 3SAWA 1AIPC 4D81A 4JI1M 2DAEA 3PFIA 5C1BA 1T3TA 4B3SM 4X66M 1IXSB 1WGLA 3T6PA 3GLHB 2F5SA 1GL6A 5ITYA 3A98B 3DZDA 2L09A 3HY5A 3HJ8A 3GPPA 4JI5M 5LMNM 3HGIA 4X62M 2QZ4A 2F5NA 2N35A 3SAVA 4OVZB 1IY0A 1ZMWA 5FTNA 4DR2M 1XNRM 3J80S 3QWLA 4XK8F 1G71A 5ITUA 2RKOA 4X64M 2CHGA 1Q3BA 3U6QA 4UN2B 3HZJA 1DGBA 5BR8M 1NO1A 4IBKA 2DWMA 1XXHE
chains in the Genus database with same CATH topology
1PGYA 3GLGE 2MGWA 2DI0A 3MMPA 2MJ5B 2LBCA 4R71A 1R4GA 5DFLA 2LVNC 1G41A 2KHHA 1E94E 1VQ1A 1UFZA 3H4JA 1VG5A 3IHPA 1WJ7A 1WHCA 1NV8A 1G4AE 2LVQD 1T43A 1ZMUA 4G3OA 2DAIA 2B3TA 1T6OA 3E46A 1OAIA 1BVSA 2R0IA 3LCUA 2G3QA 1Q02A 1NV9A 1VEJA 2KNVA 4F2LA 1EFUB 3FE3A 2DAKA 1WR1B 3B89A 3GLIE 1G3IA 2DNAA 1DV0A 2JY7A 2K9DA 1QZEA 2HWJA 1XB2B 4Q7JA 2OOAA 2DENA 1CUKA 4DBGB 1IXSA 5JI2E 3LCVB 2EKFA 1WIVA 4WP2A 3K9PA 1TTEA 1KYIA 1WGNA 2DKLA 1HT2E 2ZTCA 2KNAA 2CWBA 1V92A 1F4IA 1ZMVA 1Y8GA 2WZJA 1OTRA 2H5XA 2LVPC 1MN3A 4GEWA 1VDLA 1SG9A 2K0BX 3K9OA 1HT1E 2BWBA 1GO5A 1IM2A 2JZ1A 1ZV1A 2QSFX 1VEGA 3IECA 2JNHA 2DAGA 2ZTDA 3GLHE 1OQYA 2JY8A 2LVAA 1DO0A 1P3QQ 1JR3E 2QNJA 1HQYE 1A5TA 2BWEA 3FRHA 2DHYA 2LTUA 2JZ0A 2QHOB 1YLAA 1HJPA 2JY5A 2L4FA 2KNZA 2DAMA 2EJSA 2JY6B 2L4EA 2LVOC 3GLFE 2EKKA 3BBZA 2MR9A 2O25A 2OO9A 2JUJA 1AIPC 4HEOA 3F92A 2DAEA 4F1IA 2CP8A 1WGLA 3FRIA 3T6PA 2HAKA 2DZLA 2OOBA 1TR8A 2MROB 1OKSA 1C7YA 1ZMWA 2JP7A 4UN2B 2L2DA 2RRUA 1VEKA 1IFYA 1DO2A 3E21A 1XXHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGY A;  3GLG E;  2MGW A;  2DI0 A;  3MMP A;  2MJ5 B;  2LBC A;  4R71 A;  1R4G A;  5DFL A;  2LVN C;  1G41 A;  2KHH A;  1E94 E;  1VQ1 A;  1UFZ A;  3H4J A;  1VG5 A;  3IHP A;  1WJ7 A;  1WHC A;  1NV8 A;  1G4A E;  2LVQ D;  1T43 A;  1ZMU A;  4G3O A;  2DAI A;  2B3T A;  1T6O A;  3E46 A;  1OAI A;  1BVS A;  2R0I A;  3LCU A;  2G3Q A;  1Q02 A;  1NV9 A;  1VEJ A;  2KNV A;  4F2L A;  1EFU B;  3FE3 A;  2DAK A;  1WR1 B;  3B89 A;  3GLI E;  1G3I A;  2DNA A;  1DV0 A;  2JY7 A;  2K9D A;  1QZE A;  2HWJ A;  1XB2 B;  4Q7J A;  2OOA A;  2DEN A;  1CUK A;  4DBG B;  1IXS A;  5JI2 E;  3LCV B;  2EKF A;  1WIV A;  4WP2 A;  3K9P A;  1TTE A;  1KYI A;  1WGN A;  2DKL A;  1HT2 E;  2ZTC A;  2KNA A;  2CWB A;  1V92 A;  1F4I A;  1ZMV A;  1Y8G A;  2WZJ A;  1OTR A;  2H5X A;  2LVP C;  1MN3 A;  4GEW A;  1VDL A;  1SG9 A;  2K0B X;  3K9O A;  1HT1 E;  2BWB A;  1GO5 A;  1IM2 A;  2JZ1 A;  1ZV1 A;  2QSF X;  1VEG A;  3IEC A;  2JNH A;  2DAG A;  2ZTD A;  3GLH E;  1OQY A;  2JY8 A;  2LVA A;  1DO0 A;  1P3Q Q;  1JR3 E;  2QNJ A;  1HQY E;  1A5T A;  2BWE A;  3FRH A;  2DHY A;  2LTU A;  2JZ0 A;  2QHO B;  1YLA A;  1HJP A;  2JY5 A;  2L4F A;  2KNZ A;  2DAM A;  2EJS A;  2JY6 B;  2L4E A;  2LVO C;  3GLF E;  2EKK A;  3BBZ A;  2MR9 A;  2O25 A;  2OO9 A;  2JUJ A;  1AIP C;  4HEO A;  3F92 A;  2DAE A;  4F1I A;  2CP8 A;  1WGL A;  3FRI A;  3T6P A;  2HAK A;  2DZL A;  2OOB A;  1TR8 A;  2MRO B;  1OKS A;  1C7Y A;  1ZMW A;  2JP7 A;  4UN2 B;  2L2D A;  2RRU A;  1VEK A;  1IFY A;  1DO2 A;  3E21 A;  1XXH E; 
#chains in the Genus database with same CATH topology
 5KO3 A;  2CV2 A;  2VII A;  2DI0 A;  2O01 F;  4D80 A;  4QOZ C;  4MGI E;  2QCU A;  5IT9 S;  2M60 A;  4DR1 M;  2MJ5 B;  3U6C A;  1J09 A;  4GC9 A;  3SFZ A;  2LVN C;  3TPZ A;  1TH3 A;  3RFW A;  4BB9 A;  1VG5 A;  1WJ7 A;  1JR3 A;  1TDH A;  5GKN A;  3JR4 A;  1IY2 A;  1Z6T A;  2LH0 A;  1YSY A;  4LFA M;  2LVQ D;  1N75 A;  3U5Z B;  1PRB A;  1QUT A;  3BOS A;  2F5Q A;  4GMQ A;  4PD2 A;  2DAI A;  1T6O A;  2BJV A;  1D2N A;  1KSF X;  2R46 A;  3D8B A;  3GRR A;  2EUC A;  2KDL A;  2R0I A;  2G3Q A;  3I04 M;  1VEJ A;  4L16 A;  3TE6 A;  5L8R F;  1EFU B;  3C9P A;  4KLN A;  4GIT A;  1L1Z A;  4LY6 A;  4LF5 M;  1L8Q A;  2G5G X;  3PVS A;  3L27 A;  1Q3C A;  2VQF M;  2XZU A;  5ITT A;  1FJG M;  3GRY A;  2D7E A;  3U6L A;  2F5O A;  2R18 A;  4Q7J A;  5DYI A;  3KS4 A;  3B7Q A;  3U61 A;  1FNN A;  3LCV B;  4DR4 M;  2FH0 A;  3NBI A;  4B7H A;  3FYD A;  3K2L A;  2R65 A;  4MGK E;  3IG5 A;  1XMO M;  1KYI A;  1WGN A;  1QYR A;  3TQS A;  4DV4 M;  1N36 M;  2VQE M;  3U5Z A;  1R2Z A;  3SBJ A;  4CIS A;  4PDG A;  4GHA A;  2LVP C;  2QP9 X;  1MN3 A;  2KW0 A;  2R45 A;  2K0B X;  2XF3 A;  5KPT A;  5FTM A;  1K3X A;  3SMP A;  5KPZ A;  4I4L A;  4G4O A;  4JI8 M;  2D7H A;  4AKI A;  2BWB A;  2L7I A;  3M6A A;  5FTL A;  3I01 M;  5EQT A;  1IM2 A;  2F4V M;  1ZV1 A;  2HKJ A;  1X37 A;  2LWX A;  1R7R A;  3IEC A;  3VLF B;  2DAG A;  2ZTD A;  2LHG A;  3GLH E;  3LW5 F;  1QUS A;  2LVA A;  1SXJ B;  3K92 A;  3GQ5 A;  1JR3 E;  4LFB M;  3H4M A;  3I4Y A;  2CHV A;  1Z5B A;  3R8F A;  7CAT A;  2C5R A;  1V34 A;  4B08 A;  3U6D A;  4DV1 M;  3FRH A;  4BLC A;  3KOZ E;  2QQ8 A;  3KS8 A;  2R6F A;  2X8A A;  2R4J A;  2H1R A;  2Z3X A;  2L4F A;  4G4Q A;  1TF0 B;  1WXQ A;  2KNZ A;  3AOG A;  2EJS A;  2JY6 B;  3B9P A;  4LZZ A;  3CF0 A;  3RGP A;  3DFZ A;  4JN6 A;  3A45 A;  3U6M A;  1K3W A;  2MR9 A;  2Z8Y M;  4ZPX A;  2YNM D;  1Q39 A;  3TWK A;  1XXH A;  4F1I A;  1LTM A;  4L4U A;  2APL A;  4PT5 A;  4B3R M;  4LRS A;  5EXP A;  1ZAE A;  4LJ9 A;  2DXI A;  1D0L A;  1ORY B;  2KA6 B;  1NJF A;  1HNX M;  3J27 B;  4IBE A;  2KEB A;  2G8L A;  1OKS A;  3MJ5 A;  3SHG B;  3Q8X A;  1QDT A;  3FUW A;  3HHZ A;  1C7Y A;  3KP0 E;  2X4A A;  4XGI A;  1IXZ A;  5EJC A;  2DWZ B;  3L26 A;  2CFO A;  4MGZ E;  4CHT B;  4LCB A;  4AI6 A;  3DA1 A;  4GKK M;  1DO2 A;  3LVV A;  4KHP M;  1IFY A;  4FW9 A;  3NBX X;  3J81 S;  3PXG A;  2ZAO A;  4AG6 A;  2XSZ A;  1I4W A;  4DV5 M;  2CV0 A;  3L28 A;  2V1C A;  4CGY B;  2LBC A;  1G59 A;  2UXC M;  5DFL A;  3U6P A;  3GPU A;  3KOX E;  3KFU G;  5LMU M;  3BXW A;  1J7K A;  1G41 A;  2MH8 A;  4IBB A;  3RGS A;  4LF8 M;  1E94 E;  1VQ1 A;  3PNY A;  3GP1 A;  2XEP A;  1IN7 A;  2C96 A;  3KW6 A;  3SC3 A;  5ITQ A;  3U60 B;  1NV8 A;  1H6U A;  3C3D A;  3E46 A;  4FWH A;  2M5Z A;  3I51 A;  3LCU A;  1D0K A;  3KSJ A;  1YUB A;  3J2P B;  4NL4 H;  3M0E A;  4MM3 B;  4BBA A;  3GLG B;  3HHY A;  1QAN A;  2L7H A;  4IIW A;  4NRW A;  1GVN A;  4AKH A;  4IBD A;  1WR1 B;  1DV0 A;  2DNA A;  1QZE A;  1XB2 B;  2LXE A;  3IG8 A;  4IBI A;  1QZM A;  1C1K A;  1QVR A;  4M0W A;  4JV5 M;  3HU1 A;  5ITR A;  1IXS A;  5JI2 E;  1QQW A;  1XMQ M;  1WIV A;  1UM8 A;  1E9R A;  1DGF A;  1OJL A;  3GLH A;  4JI3 M;  2ZAM A;  1TTE A;  4LZJ A;  1TGU A;  3EIH A;  1TH2 A;  1L1T A;  2Y20 A;  3W67 A;  3KVW A;  5EP3 A;  2I7N A;  2HL7 A;  4TUW A;  3E4R A;  4R3D A;  3HKP A;  3HWS A;  3E9S A;  1L2D A;  4OVZ A;  1F4I A;  5ITX A;  1V33 A;  3W68 A;  1R2Y A;  2Z4S A;  4GH9 A;  3W0L B;  2FOI C;  2QPA A;  4S12 A;  5A2Q S;  3GLI B;  1GJS A;  2JWS A;  2UUB M;  2DWL A;  1OIZ A;  3J7B A;  4LJ8 A;  1IN5 A;  1AUA A;  2C9O A;  4GKJ M;  4Y28 F;  2CHQ A;  2QSF X;  1VEG A;  3AFH A;  3PNV A;  2JNH A;  2RGH A;  3WHL A;  5KQD A;  1P3Q Q;  3W0F A;  2F5P A;  3SAT A;  1SXJ D;  3GRU A;  1EIJ A;  2ZM6 M;  3GQ3 A;  1A5T A;  3UGJ A;  1DGH B;  1GJT A;  1GLN A;  1D0M A;  2DZO B;  2LNH C;  5IWA M;  2CV1 A;  2QBY B;  2XGN A;  4GHL A;  3FUU A;  1NY5 A;  3FTF A;  1QAM A;  2CE7 A;  2X49 A;  4M9S A;  3B74 A;  1SXJ C;  2O25 A;  3V76 A;  1OFI A;  1IBM M;  4HEO A;  3WHK A;  4CJ6 A;  2CP8 A;  1W5T A;  4QHS A;  2Q2E B;  5H37 D;  2JA2 A;  3T38 A;  2HAK A;  3K1J A;  1XWI A;  3VFD A;  2Y21 A;  4M9Z A;  3GPY A;  1TR8 A;  3L2A A;  2OQ4 A;  3LMM A;  3NWL A;  4LF4 M;  5EXT A;  4FCV A;  4KO8 A;  4LF6 M;  4R7G A;  3VKG A;  3RE8 A;  5E26 A;  2JP7 A;  2RGO A;  1N32 M;  5ITX E;  1N77 A;  1IBK M;  2UU9 M;  3FYC A;  5FLX S;  3GLF B;  2C98 A;  2RRU A;  3HJQ A;  4A3V B;  4AW4 A;  3GRV A;  4M0D A;  4DV2 M;  1PGY A;  3GLG E;  2WSC F;  4MB7 A;  3UZU A;  2A5Y B;  1TH4 A;  3C3E A;  3MMP A;  2L6O A;  4CIZ A;  1NSF A;  3QAU A;  4R71 A;  3AL0 C;  4D82 A;  3I4V A;  3SYK A;  1MX0 A;  3A42 A;  3AKZ A;  4FWG A;  4IJF A;  3K8Z A;  3H4J A;  1UFZ A;  4LJA A;  3ZC7 B;  4DV3 M;  1HR0 M;  4IJE A;  1NNU C;  4DR3 M;  1SXJ A;  3TL4 X;  5FSW A;  4FCW A;  1T43 A;  4X65 M;  1L2B A;  3UK6 A;  1XC8 A;  4LG2 A;  1OAO C;  3OTO M;  3R9X B;  1Z59 A;  3TWL A;  3CF2 A;  4RNA A;  4F2L A;  1XHB A;  2W82 A;  3FE3 A;  2EO2 A;  2J7O A;  4AG5 A;  3KSX A;  2DAK A;  3B89 A;  1MU5 A;  1OFH A;  1G3I A;  2VDB B;  4I8O A;  4IBF A;  4MH0 E;  3GLI E;  4LJ4 A;  2HWJ A;  1PJQ A;  2WSE F;  4II7 A;  1N33 M;  4JI4 M;  2OOA A;  1IN8 A;  2DEN A;  2ERC A;  1JB0 F;  2FNA A;  4P16 A;  2CEA A;  2XLJ A;  1KFV A;  1JR3 D;  3T1H M;  2ZAN A;  2EKF A;  2FFJ A;  1G8P A;  3K9P A;  1QAQ A;  4NSR A;  3HHX A;  2DZN B;  2J7N A;  4G6Z A;  4LJ7 A;  1GAB A;  4OU7 A;  2HHH M;  2KZS A;  2BNK A;  3AJI B;  5C18 A;  4AQY M;  4I81 A;  1HT2 E;  1GL7 A;  1E32 A;  3QYE A;  2CWB A;  4MGH A;  3SYL A;  3VDU A;  5KPR A;  3UJN A;  1V92 A;  3T1Y M;  2KRU A;  1QAO A;  2C99 A;  1Y8G A;  2WZJ A;  1OTR A;  4LGM A;  5IRE B;  3ZCB B;  1GKI A;  4GEW A;  4RF1 A;  1SG9 A;  5IZ7 D;  3JR5 A;  4JYA M;  1HT1 E;  4YY3 M;  3AV0 A;  1DGG A;  1N34 M;  3U6E A;  2R4E A;  3ILK A;  4B3T M;  3T15 A;  3AOE C;  5DYG A;  4NXM M;  2JY8 A;  1I94 M;  1W5S A;  2K47 A;  4MGY E;  4LRT A;  1NNJ A;  1SXJ E;  3FUX A;  1HQY E;  2BWE A;  4L8R C;  8CAT A;  1R6B X;  2DHY A;  2LTU A;  5EP1 A;  4DV0 M;  4LF7 M;  4RF0 A;  1J5E M;  2JZ0 A;  3U60 A;  5BPV A;  3EIE A;  2JY5 A;  2DAM A;  2D7G A;  2GQF A;  2L4E A;  2LVO C;  3GLF E;  5E6J A;  4FD2 A;  3FD9 A;  2UUC M;  2EKK A;  1L2C A;  1NVM A;  5F3W A;  4ITQ A;  3B7N A;  2UXD M;  2JUJ A;  4NXN M;  3F92 A;  2KZU A;  2FE8 A;  3LQR A;  4NSO B;  1XNQ M;  3GLG A;  4QNM A;  4OX9 M;  4NOO B;  2CRU A;  4L78 A;  2XFS A;  3FRI A;  4FWD A;  3U61 B;  3VKH A;  4GRI A;  4HLQ A;  1R5L A;  4B7G A;  1N78 A;  4P17 A;  2XZF A;  2DZL A;  2OOB A;  3MK6 A;  3Q8G A;  2UXB M;  4QOS A;  1TDZ A;  2MRO B;  2WSF F;  4IBC A;  3A46 A;  4G4R A;  4KT0 F;  2R44 A;  4IBJ A;  1JQJ C;  4L6V 6;  4XBO A;  3U6O A;  3KP1 E;  3M7G A;  2NQ8 C;  3B7Z A;  5EXX A;  4RKU F;  2L2D A;  1PJT A;  3AOE A;  3FKE A;  4M9X A;  4NRV A;  4QNR A;  1VEK A;  3LQQ A;  3E21 A;  3DOA A;  3KXE C;  1IN4 A;  4DV7 M;  2MGW A;  3KDS E;  5JI3 E;  2XFT A;  3HHW A;  4DV6 M;  3GLI A;  2E5L M;  4G4N A;  1R4G A;  4LF9 M;  4LFC M;  2KHH A;  2Z4R A;  1QDR A;  4LGY A;  3CF6 E;  2KRK A;  3HX3 A;  3IHP A;  4DUZ M;  3D8L A;  4IBG A;  1WHC A;  3ZQJ A;  4B3M M;  1NHW C;  2DHR A;  1G4A E;  3SAU A;  3VDP A;  2I7P A;  2K6B A;  1ZMU A;  4G3O A;  3VK8 A;  2B3T A;  4L15 A;  2BJW A;  4HL4 A;  3GPX A;  1OAI A;  1BVS A;  4KOD A;  5KQ8 A;  1Q02 A;  1DGH A;  1NV9 A;  2KNV A;  1ZQ9 A;  3GQ4 A;  1PJI A;  2XSZ D;  3FTC A;  4LJ6 A;  1XXH B;  4NC6 A;  1PM5 A;  4GIP A;  2QBY A;  5EP2 A;  4PCZ A;  5DNY A;  1S3S A;  1LV7 A;  2XH9 A;  2OPF A;  3FTD A;  1Z5A A;  3MHV C;  3U6S A;  2JY7 A;  1OIP A;  2K9D A;  4JI6 M;  2Y0Q A;  3KOW E;  1K82 A;  2CUZ A;  3L29 A;  1CUK A;  3VK7 A;  5FTK A;  2AHM A;  4DBG B;  2UUA M;  1PJJ A;  1HQC A;  4WP2 A;  3C58 A;  4OW0 A;  1IBL M;  3SHF A;  2V1U A;  2Z7J A;  3CTW B;  3QYB A;  3ZH9 B;  3CGW A;  3UMM A;  1IXR C;  3HU3 A;  1IY1 A;  1E9S A;  2DKL A;  2VF7 A;  2ZTC A;  5FTJ A;  2KNA A;  2R62 A;  1HNZ M;  2DWN A;  4FVM A;  1HNW M;  1ZMV A;  4WUR A;  4JI7 M;  4I5S A;  2H5X A;  3FUV A;  2QEN A;  3GO8 A;  1VDL A;  2V6Z M;  3L25 A;  4REZ A;  1RU3 A;  2JXN A;  2HCB A;  2GNO A;  3K9O A;  3LVW A;  4JXJ A;  1PJS A;  5EXS A;  4PDI A;  3GLF A;  1VDD A;  4EIW A;  4ANR A;  4GC5 A;  5EP4 A;  1IN6 A;  2YQZ A;  3THG A;  1NHG C;  2JZ1 A;  4FCT A;  4LJ5 A;  4Z6Y A;  2EA0 A;  1GO5 A;  3KOY E;  2FS1 A;  1Z5C A;  4B7F A;  4WW0 A;  2VF8 A;  3HU2 A;  4JI2 M;  1NJG A;  2ZBK B;  1OQY A;  3JAM S;  4W5W A;  1DO0 A;  3FUT A;  2O5R A;  4DR5 M;  2QNJ A;  2YFQ A;  2LHC A;  4AZF A;  4DUY M;  1EE8 A;  2C9C A;  4YHH M;  4K0K M;  2YR0 A;  1IQP A;  1MJG M;  3J7A S;  1YE9 A;  1NY6 A;  3HJS A;  3SAS A;  2DVW B;  2P5T A;  2QHO B;  2J5Y A;  4AKG A;  1YLA A;  2KXE A;  1HJP A;  4Z8X A;  4DR6 M;  3FTE A;  3SAR A;  4DR7 M;  3SMS A;  3BBZ A;  2Y0T A;  4JI0 M;  3TWM A;  2OO9 A;  4QHT A;  3SAW A;  1AIP C;  4D81 A;  4JI1 M;  2DAE A;  3PFI A;  5C1B A;  1T3T A;  4B3S M;  4X66 M;  1IXS B;  1WGL A;  3T6P A;  3GLH B;  2F5S A;  1GL6 A;  5ITY A;  3A98 B;  3DZD A;  2L09 A;  3HY5 A;  3HJ8 A;  3GPP A;  4JI5 M;  5LMN M;  3HGI A;  4X62 M;  2QZ4 A;  2F5N A;  2N35 A;  3SAV A;  4OVZ B;  1IY0 A;  1ZMW A;  5FTN A;  4DR2 M;  1XNR M;  3J80 S;  3QWL A;  4XK8 F;  1G71 A;  5ITU A;  2RKO A;  4X64 M;  2CHG A;  1Q3B A;  3U6Q A;  4UN2 B;  3HZJ A;  1DGB A;  5BR8 M;  1NO1 A;  4IBK A;  2DWM A;  1XXH E; 
#chains in the Genus database with same CATH homology
 1PGY A;  3GLG E;  2MGW A;  2DI0 A;  3MMP A;  2MJ5 B;  2LBC A;  4R71 A;  1R4G A;  5DFL A;  2LVN C;  1G41 A;  2KHH A;  1E94 E;  1VQ1 A;  1UFZ A;  3H4J A;  1VG5 A;  3IHP A;  1WJ7 A;  1WHC A;  1NV8 A;  1G4A E;  2LVQ D;  1T43 A;  1ZMU A;  4G3O A;  2DAI A;  2B3T A;  1T6O A;  3E46 A;  1OAI A;  1BVS A;  2R0I A;  3LCU A;  2G3Q A;  1Q02 A;  1NV9 A;  1VEJ A;  2KNV A;  4F2L A;  1EFU B;  3FE3 A;  2DAK A;  1WR1 B;  3B89 A;  3GLI E;  1G3I A;  2DNA A;  1DV0 A;  2JY7 A;  2K9D A;  1QZE A;  2HWJ A;  1XB2 B;  4Q7J A;  2OOA A;  2DEN A;  1CUK A;  4DBG B;  1IXS A;  5JI2 E;  3LCV B;  2EKF A;  1WIV A;  4WP2 A;  3K9P A;  1TTE A;  1KYI A;  1WGN A;  2DKL A;  1HT2 E;  2ZTC A;  2KNA A;  2CWB A;  1V92 A;  1F4I A;  1ZMV A;  1Y8G A;  2WZJ A;  1OTR A;  2H5X A;  2LVP C;  1MN3 A;  4GEW A;  1VDL A;  1SG9 A;  2K0B X;  3K9O A;  1HT1 E;  2BWB A;  1GO5 A;  1IM2 A;  2JZ1 A;  1ZV1 A;  2QSF X;  1VEG A;  3IEC A;  2JNH A;  2DAG A;  2ZTD A;  3GLH E;  1OQY A;  2JY8 A;  2LVA A;  1DO0 A;  1P3Q Q;  1JR3 E;  2QNJ A;  1HQY E;  1A5T A;  2BWE A;  3FRH A;  2DHY A;  2LTU A;  2JZ0 A;  2QHO B;  1YLA A;  1HJP A;  2JY5 A;  2L4F A;  2KNZ A;  2DAM A;  2EJS A;  2JY6 B;  2L4E A;  2LVO C;  3GLF E;  2EKK A;  3BBZ A;  2MR9 A;  2O25 A;  2OO9 A;  2JUJ A;  1AIP C;  4HEO A;  3F92 A;  2DAE A;  4F1I A;  2CP8 A;  1WGL A;  3FRI A;  3T6P A;  2HAK A;  2DZL A;  2OOB A;  1TR8 A;  2MRO B;  1OKS A;  1C7Y A;  1ZMW A;  2JP7 A;  4UN2 B;  2L2D A;  2RRU A;  1VEK A;  1IFY A;  1DO2 A;  3E21 A;  1XXH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...