2DAJA

Solution structure of the novel identified ubiquitin-like domain in the human cobl-like 1 protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
91
structure length
91
Chain Sequence
GSSGSSGEKTVRVVINFKKTQKTIVRVSPHASLQELAPIICSKCEFDPLHTLLLKDYQSQEPLDLTKSLNDLGLRELYAMDVNRESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Novel Identified Ubiquitin-like Domain in the Human COBL-like 1 Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA0977 protein
total genus 8
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dajA00
2Z0DB 4HPLB 4HLEA 3NS8A 4HCPB 3L17A 4K7UA 2KDFB 2BGFA 2IO2B 1GNUA 2MLBA 3BY4B 2C7NB 5L95C 2JZ3B 3T8MA 4HVBA 2JWZA 3WIMA 4IWQA 4HJKA 3PTFC 2WDTB 2RSUA 1V9JA 4ANWA 4A3PA 5CHWA 1OTRB 4BKSA 2CHXA 2N7EA 3VFKA 3A1QA 4GSWA 4G0NB 4I6LB 4FN2A 1KOTA 5AZFA 2K6DB 3HM3A 2KN5A 2J0KA 2K25A 3LDZE 2BKRB 3ECIA 2MA9B 2GBNA 3PPAA 4K81A 3CSTA 2RR9A 2L3ZA 2IZVB 2OOBB 2LXAA 1E8YA 1Z2MA 1F9JA 1EUVB 1UH6A 1V5TA 1V2YA 2KDEB 2Z0EB 2MBEA 1WR1A 1WE6A 4XZ4A 3U8ZA 4HK2A 3X0WA 2ZNVC 4GXBA 2FNJB 3DDCB 5G55A 2HJ8A 4IUMB 5DCNA 2KDBA 3L10B 3H7PB 3I3TB 4KZCA 4WWPA 3VVWB 4FADA 2BWES 1QZEA 2A4ZA 1Y8RC 3QHTA 4NAWA 1TBEA 2VRRB 4KZ0A 3W1YA 2K8CA 2AYOB 2ASQA 3L54A 3K9OB 3PV1A 4GDLA 4DHZE 5KHOA 2N4FA 2LVOA 1GC7A 1YJ1A 3MJWA 4M0WB 4WAAA 4PS7A 1SE9A 1D3ZA 3VH4B 4RMAA 3M3JA 2JPHA 4IM0A 1Q1OA 5CHVC 2IBIB 2G4DB 1WJ6A 3ZIMA 4W9IA 2G45B 2BYFA 4TUUA 2C7HA 2O2VB 3APDA 4II3B 1E5WA 4MJSA 3PVLA 1WMHB 2Y5BB 1AARA 3APFA 3PRPB 4IWOA 1WJ4A 3QAQA 3H6NA 4HDQA 1RAXA 4RM8A 3RCZA 3UIPB 2M8SA 4DK5A 5E6OA 4ANVA 4A3OA 1VCBA 4WWOA 4TKNA 2WX0A 1LFDA 3VXWA 2D11A 4DDID 2BYVE 3L0WB 1T0YA 3A9KB 5E6PA 4DHZB 1KM7A 2KMAA 4JL9A 3DVNU 2NPTB 2ZCCA 3UGBB 2PJHA 5D6JB 3V60A 3M62B 4HWIB 2KTRA 5C1ZA 4B95A 1GUAB 5D94A 1WE7A 2KQSA 3R66C 3A9JB 5AZGA 3QA8A 2AL3A 2AWTA 3VUXA 4W9HA 2C60A 3DQVA 3ZRCA 4DDGD 2LASA 4MGYE 4WJPA 5HKHA 4JLCA 5CTRC 2GBRA 3ONSA 1Q0WB 2L00B 3VQIA 3PS6A 3ZRFA 4AJYB 2KHWB 3B08A 3QC8B 1XT9B 2D07B 2JVCA 3ZUNA 2GBKA 2N1WA 2JY6A 3RZFA 4TQ0A 1H4RA 3KYDD 3OJ3A 1J8CA 4KIKB 3AULA 3DCGA 1WY8A 2BPSA 1EF5A 1L2NA 3RT3B 3MHSD 2NBVB 4E71A 1BT0A 2N7DA 1V81A 2DZMA 2ZPNA 2OJRA 3KW5B 2W9NA 4PS3A 3OJ4B 1RRBA 1J19A 4II2B 2L8JA 4ASWC 3ZVVA 2IO0B 3CSFA 3K9PB 5DPWA 2KJ6A 4I6NB 4JGHB 3D32A 2M1MA 2C9WB 2PPHA 2WWZA 3AU4A 2JT4B 4MELA 5G2NA 3ZNID 2ZPYA 2JRIB 4KDIC 1S3SG 2KFKB 1UELA 2KXJA 1WX8A 3RYTA 1WGGA 1V49A 4BOZB 1YX5B 2LJ5A 2Z59B 4EUTA 3TBLD 3JSVA 2WX1A 4BKTA 3A33B 2MBQA 1NBFC 2N1VA 1UGMA 1V6EA 4EFOA 4FHJA 3DPDA 3IG3A 3PLUA 2C5LC 3VDZA 2K8HA 2KDIA 4B6WA 2MRPA 2GBJA 3DVGX 3NOBA 4BVUC 1H8CA 2ZEQA 1OEYA 2LGXA 5FR6A 1UZXB 2DX5B 2FIFA 3VTWA 3JW0X 2ZCBA 3L16A 1FXTB 1UBQA 2QHOA 3KH0A 3WAMA 1M94A 1WXAA 3L13A 3IVFA 2PE9A 1E8XA 4I6PA 4MGZE 2DENB 1P0RA 1WM3A 1SGHA 2I1JA 1TZ1A 1RLFA 3M63B 2KC1A 3VUWA 3RUIB 2KVRA 2L0TA 3MTNB 4W9LA 1C3TA 2CHWA 3IBEA 4F1SA 2IY1B 2IYDB 4MGIE 4BBNF 2JUOA 3CMMB 2A5UA 3QQ8B 1WGDA 4DHJD 2LGYA 4G50A 3WA0A 4MGKE 2KWCA 1NDDA 1OQYA 2M0XA 1X1MA 4KSKC 2L76A 2KANA 3PRZA 2KTFA 1J0GA 2KJHB 4HPMB 3NZSA 2NBWB 4DBGA 2CR5A 2NBUA 3A9KA 4GU2A 1GJZA 4AWJA 3ML8A 2O6VA 3PREA 4OVUA 4ANUA 2C7MB 1P9DU 4AJWA 2KLGA 3AU5A 3N3KB 1OEYJ 2K39A 2RPQA 3KYCD 2I1KA 1A5RA 3R3MA 3S2AA 3UQBA 3A1QB 1YX6B 2BKFA 3DVGY 3PSEB 3QWZB 1WX9A 1WH3A 4IG7B 4W9EA 5LXIB 2GOWA 2LUEA 4ANXA 4WJOA 5CHFA 2KK8A 3ENEA 4GGQA 2KKCA 3V6CB 4E74A 4X57B 3WALA 2KX3A 2LZ6A 3U7DA 3DBHI 3A4RA 2FCNA 2NVUI 2L05A 3OLMD 3DVNV 4FULA 2MP2A 1V5OA 2XK5B 2O2VA 4MJSB 3WANA 4FLHA 3JYUA 2ZVNA 2FCMA 3R7QA 4ICUA 1WRDB 2FCQA 1K8RB 3PLVA 3U30A 5CX3A 3P2BA 3VH3B 2DAJA 2MCNB 4NAWB 5LXHA 4F7ZA 1L7YA 5D2MB 2BF8B 4P7IA 2CU1A 4ZDVA 3PHXB 1LXDA 1CMXB 5JHAA 4BFRA 2JXXA 4M8MA 1E8ZA 2YLMA 4FHKA 2FIDA 3QCAA 3W1SC 1WIAA 2KNBA 2RGFA 4HDOA 4ICVA 2GMIC 4KDLB 2KO3A 3V6EB 1NI2A 2CHZA 2MW5A 3EFUA 4F8CB 4EZJA 4ZRKA 3WAPA 1GG3A 2AL6A 3PT2B 2LVQA 3VTVA 4WJQA 2REXA 4OVVA 1PQSA 2J0JA 1WJUA 1P3QU 2MSED 2ZZPB 3ZTDA 4A20A 3N32A 4DWFA 1JRUA 3OAWA 4W9JA 3SDLC 2O6VD 2IY0B 4GMVA 4GN1A 3NHEB 4W9GA 4PS8A 3B0AA 5BO4B 3ZDMC 1WR6E 3O65B 2LRUA 4BBNC 2KX0A 5IAAC 3TL5A 3Q3JA 2CKHB 2BWFA 4ZYNA 3DOWA 3HIZA 4AOFA 4BOSC 4URKA 1YD8U 3H7PA 1LM8B 2LRWA 3N30A 1HE8A 2HD5B 2DZJA 3UQAA 2YVCA 2GBMA 2LD9A 3DBRI 3HK0A 5DPSA 2KZRA 4LDTD 2K6QA 2MQJA 2NCNA 3B1LX 1GC6A 1TTNA 2DYMA 4NJ6A 2JRHA 5E6NA 3UIOB 4TQ1A 5LLIA 3ALBA 4EZKA 3V62A 2K8BA 3QARA 2UWQA 1Z5SB 4GDKA 3VUYA 4AUQC 4IC7B 3X23A 2K1FA 2FCSA 3H9DA 2L7RA 2MBOA 4HXDA 1XQQA 1Q5WB 2MX2A 2XEWA 3VAWA 2ZJDA 4FJZA 5J18A 2DZIA 1P98A 3W1SA 2NS5A 2D3GA 3PHWB 2EMSA 4KSLC 3SU8X 4NPNA 4TV3A 4GOCA 3WAOA 4FBJB 5EDSA 3AXCA 3HHMA 3LJ3A 5J17A 1R4NI 2KC2A 1ZW7A 2KFJA 2PEAA 4GB9A 2KTRB 3GOEA 4IM3A 3NZUA 5J2RA 3EECA 4CHKA 4LJPB 4K7SA 2NPTA 4MEMA 4M8NA 3ZO5B 4EZLA 2V3SA 3A4SC 3IHPC 3JVZX 1SIFA 1RFAA 2KFKA 1WFYA 3VTUA 3QIJA 1WYWB 4EKUA 3Q3FA 4PYUA 1WZ3A 4LCDE 4LJOB 2FUHB 2LXCA 3QK0A 2J7QB 1P1AA 1WGYA 3CF6E 2CS4A 1WGHA 2MBHA 2M4NA 4ZRIA 5C23A 4YL8A 3V61A 2LVPA 1TGZB 3KUDB 4G3XB 2KMCA 4NQKE 4IM2A 2KOXA 4WWNA 4B9KA 4FJVB 3H7SA 3L08A 3H1UA 5DPRA 2MP2B 4GDLB 5AZHA 2R2QA 2MBBB 1VD2A 2ZNVB 4G11A 3ZTCA 2LWPA 1IPGA 2R2OA 3ML9A 1IP9A 4W9KA 3PRMB 3RD2A 1MG8A 2LI5A 4XC2A 3ZKJC 4MH0E 2NR2A 3TMPB 3ZNGC 2UYZB 3A9JA 4JIOU 2DHZA 2KLCA 4K7WA 3EC8A 3UINB 5L83A 1E7VA 1WMHA 5D7GA 2DYOA 5GMVA 3VHTC 3IFWB 4MSQB 3R7RA 1WM2A 3DBLI 2LGDA 3C0RB 1ISNA 4BKGA 3JSVB 2O6VB 1EO6A 3GZNI 4EEWA 2V4LA 1C1YB 3TJPA 2ZVOA 1E8WA 4W9CA 1WF9A 1V86A 2XBBC 1I42A 3BINA 5JHBA 3ZLZA 1WJNA 4KVGB 5TR5A 1WGRA 3DBSA 4NNJB 3UF8A 4CYEA 1E90A 2N9XA 1WXMA 3HM6X 3KUZA 3PZDA 2MWSB 1YQBA 3KUCB 2DYBA 4WQOB 2EKEC 1R4MI 5KHQA 5JH5C 4MM3A 1OGWA 1V80A 3EHVA 2G3QB 2JF5A 4FJYA 4N9F4 4IWPA 3RULA 2N9PC 4ZRJA 1WXSA 4FA6A 5JZEB 4NY0A 1YIWA 2J0MA 3PGEA 2B3AA 2V1YA 4JQWC 1E7UA 4EOYA 4MDKE 4MSMB 1WXVA 2N9EB 4KIKA 1EF1A 4K1RB 3SHQA 4DHJB 2HE7A 1WI0A 4NJ7A 4E3CA 4BKSD 2L0FA 1I35A 3QJZA 4J6IA 4RM9A 3TCAA 2HTHA 1UBIA 2FAZA 2KJRA 4HCNB 3KVFB 5IA7A 2KD0A 3QX1A 4KV2A 4XX5A 4AP4C 2AEHA 4GIVA 3NY5A 3M95A 1IYFA 1U4AA 2M17A 1G6JA 2RD0A 2G4SA 3ZW3A 1XD3B 3ZDTA 2DAFA 2D10A 4LDTB 4DXAB 2DZKA 2EMTA 3SD5A 1KLVA 4CO7A 4WJNA 4W9DA 2IO3B 1KJTA 2D2QA 5AEKB 3APCA 1S1QB 1ZGUB 1ZKHA 5DPTA 2KWUB 3RZWC 4PYZA 3AI5A 2KQ7A 2JZZA 3T9LA 1WZ0A 2BYEA 2IO1B 1UD7A 3ZNZB 4W9FA 4NQLB 2WYQA 2PE6B 4IW0A 3ZNHB 2KWVB 2XK5A 1LQBA 3TIXA 1WX7A 4GDKB
chains in the Genus database with same CATH superfamily
2Z0DB 4HPLB 2N7JA 1PYWD 2IO2B 2K0PA 2N9LA 4ACFA 2MLBA 3BY4B 1IGDA 3T8MA 4HVBA 2JWZA 2PVOD 3A1QA 2AQ1B 1C9FA 3Q3NC 1C4CA 2KN5A 3VR8B 2YEPF 3ECIA 1CJEA 2WHIA 2LXAA 1Z2MA 1EUVB 1V5TA 1V2YA 2KDEB 2MBEA 1WR1A 1WE6A 5MPOA 3AV8A 5G55A 2HJ8A 3NVVA 3L10B 4WWPA 3H7PB 4FADA 1SF0A 3QHTA 1TBEA 4KZ0A 2K8CA 2DWQA 2ASQA 3L54A 4P1BC 3PV1A 1YJ1A 3MJWA 2AQ2B 2WXOA 4PS7A 1D3ZA 1IBXB 2D3BA 1DOIA 2IBIB 2BYFA 3PVLA 1WMHB 2Y5BB 1AARA 5BMHA 1RAXA 3RCZA 4DK5A 2K9XA 3N9YC 5FKAC 1LFDA 2D11A 4DDID 2BYVE 3E56A 1T0YA 2KMAA 4JL9A 2WXGA 3DVNU 3UGBB 5D6JB 3V60A 3EUB2 4B95A 1GUAB 2JWUA 2KQSA 2ZW1A 5AZGA 3QA8A 2AL3A 2JQRB 2V3NA 4W9HA 3W2DA 1KRHA 2LGSA 3DQVA 3KLSX 2BS3B 2MEKA 4HPPA 3PS6A 3ZRFA 4AJYB 4C7ZA 2KHWB 2GI9A 2M19A 3ZUNA 3OJ3A 1J8CA 2BTEA 4NJCA 4CQNA 1GPXA 4WH4A 2QDFA 2DZMA 4PS3A 2D3AA 2INDC 2KJ6A 1WRIA 2X8XX 1ENFA 4JGHB 3D32A 1FD6A 4MELA 2JT4B 3ZNID 2ZPYA 2JRIB 1S3SG 1UELA 2WXNA 1WX8A 3RYTA 2NMQA 2Z59B 3Q8BA 2WX1A 1ET9A 1ZDXA 4EFOA 2X38A 3U52E 1FPYA 3FILA 2WQYB 2EKIA 5IP4D 1F0ZA 4N58A 2LGXA 2DX5B 2QJLA 3JW0X 1UBQA 2QHOA 1WXAA 1JWSD 1TYGB 3IVFA 1JW9D 2DENB 1WM3A 1YOVB 4M0WA 1SB3C 3VRAB 2KC1A 4LNFA 3SR6A 3RNEC 1XLPA 4W9LA 1AYFA 3MTNB 1KLGD 2GB1A 3ZGZA 4YTNB 1QOGA 2A5UA 3DWGC 1RFKA 3WA0A 4DHJD 5G5GA 1NDDA 1OQYA 1X1MA 2PVGC 2Q5WD 2KANA 2WGSA 2KJHB 4HPMB 2XN9C 4US9A 2CR5A 4OVUA 2KN4A 3AU5A 3S2AA 3Q8EA 3HVZA 5C2TB 1WX9A 4WWMA 2LUEA 4ANXA 2RMMA 4A90A 2KK8A 4GGQA 3DBRB 3PO0A 3U7DA 3B2GA 4LNIA 2MHJA 1V5OA 4L23A 3NVZA 3JYUA 4ICUA 2JU6X 1JWBD 1PDXA 3U30A 3P2BA 3VH3B 4RNAA 4XWTA 4YWGG 1FCCC 2YEPB 3T3OA 2Y3AA 1LXDA 1CMXB 1HA5A 1I4GA 3U7ZA 4BFRA 4M8MA 1E8ZA 5AUIA 2Y5CA 3P4RB 2WU2B 4F8CB 1JRPA 3WAPA 3AEDB 2AL6A 3IXSA 4O1NA 2LVQA 1PGAA 4XDDA 2MSED 3DWMA 1IUEA 1FCLA 4GMVA 3BK2A 1NYRA 2V9HA 3NHEB 4W9GA 2KX0A 5IAAC 3TL5A 2CKHB 4ZHOA 1LM8B 2HD5B 1N6ZA 2BYTA 2YVCA 4OW0A 2LD9A 5HHDG 4A9AA 2K6QA 2DYMA 5LLIA 3ALBA 3HUIA 3V62A 2PKOA 3QARA 1Z5SB 3GE8C 1J7CA 4IC7B 3H9DA 3NVYA 4HXDA 1K51A 3W1SA 1K53A 3ZJVA 3GZNB 1PUTA 1FFVA 4GB9A 3Q8FA 3MFGA 2W54A 3BIID 3NZUA 4TSSA 4CHKA 2NPTA 4MEMA 2LEKA 1ZE3D 1SIFA 3J9CA 1RFAA 2KFKA 3W5VB 3VTUA 3P63A 1T0QC 4ARCA 4LCDE 1XEEA 2R61A 1R7SA 4NZLB 4C4VA 2KDMA 1WGYA 3KUDB 2KMCA 2KOXA 3AE3B 3GE3C 2XNAC 1EU4A 4P1CC 3L08A 2V4IB 1TS3A 4GDLB 1V1PB 2MBBB 1TY0A 2LWPA 1IPGA 4W9KA 3AEGB 3PRMB 4XC2A 5BYQA 3ZKJC 3MC8A 5IOIA 2DYOA 2TSSA 4MSQB 3C0RB 3JSVB 3TJPA 1C1YB 2MH7A 3AEBB 1E8WA 5E6JA 4XWWA 3NS1A 3VRBB 1WF9A 1I42A 3AB5A 3ZLZA 1ACCA 5TR5A 4NNJB 2QMTA 1EM7A 2N9XA 2MWSB 1FRDA 1KLUD 2EKEC 1SXTA 1V8CA 2KVZA 1L4ZB 1RWSA 1YMHE 4RF0A 3RULA 1JQ4A 5JZEB 1YIWA 3PGEA 1NEKB 1GB4A 2V1YA 1E7UA 4MSMB 3SHQA 2WXLA 4LNNA 4XDCA 2HE7A 4NJ7A 1I35A 1JWAD 2HTHA 1UBIA 1AN8A 1WWTA 3RFZB 3AE1B 3QX1A 5D3DA 5IN7A 3M95A 1YN5A 1T0RC 3URYA 3WCQA 2G4SA 4LDTB 1KLVA 1VZ8A 3AE9B 3ZYYX 2I2YA 2IO3B 1F2RI 2D2QA 5AEKB 2VZKD 2V0GA 1ZGUB 5DPTA 2KWUB 3AECB 5D3IB 2L52A 3T9LA 1WZ0A 2IO1B 4L1BA 5BMGA 1YN4A 4IW0A 2KWVB 3NJTA 1YJIA 4PK1A 4HLEA 4RF1A 3NS8A 2BGFA 4D2KA 4A6QA 1M4VA 1GNUA 3PZ8A 2C7NB 2JZ3B 1ZXIA 4IWQA 3PTFC 2WDTB 2WXHA 1OTRB 4BKSA 3V05A 2N7EA 3AE8B 1A70A 4FN2A 1NENB 1KOTA 2BKRB 2GBNA 2RR9A 2W3SA 2OOBB 5AUKA 2Z0EB 1VZ6A 3X0WA 4GXBA 2WXKA 3Q14C 2FNJB 4IUMB 1CK1A 2A4ZA 1Y8RC 4GDLA 5KHOA 1SE9A 4WAFA 4RMAA 5CHVC 3MHZA 3AEAB 2IGHA 4YSZB 2O2VB 3APDA 4II3B 1SE2A 1DYQA 3QAQA 3H6NA 3L4PA 4HDQA 4RM8A 4ANVA 2WXQA 1VCBA 3KQ4A 3Q6BA 4TKNA 2WDVB 2VH1A 1WXQA 4REZA 5LNK1 2LHEA 2E3TA 3L0WB 4DHZB 3CIRB 1VLBA 2PJHA 4HWIB 2KTRA 1KF6B 5D94A 1HQRD 3A9JB 3VUXA 3I63C 3ZRCA 2LASA 3P4SB 5HKHA 4JLCA 1L5PA 2GBRA 2I38A 4LLGM 4RGOS 2L00B 3VQIA 4GLSC 2JXTA 1EWYC 2GLSA 3B08A 3QC8B 1XT9B 4MH8A 2GBKA 2WDRB 2JY6A 4TQ0A 1ZXHA 1WY8A 1L2NA 1K52A 3MHSD 1BT0A 1WSPA 2N7DA 1HZ6A 1R4NB 1TKEA 1V81A 2ZPNA 3KW5B 2W9NA 1RRBA 3RN9C 2MJEA 4ASWC 2IO0B 5DPWA 2PPHA 4HEA1 5G2NA 1TZOA 2B76B 3MC9A 3NUHB 2BBCA 2LJ5A 4K3CA 4EUTA 3TBLD 1QOAA 3A33B 1NBFC 3RNFC 1NYQA 3DPDA 1E7PB 3VDZA 2KDIA 2MRPA 1N62A 2PTLA 5FR6A 3L16A 3KH0A 1QOFA 2L83A 2HTME 2UU7A 2WXJA 1MPEA 1T6BX 5EE1A 3RUIB 1IGCA 1C3TA 2CHWA 3IBEA 2IY1B 2IYDB 1Q10A 4MGIE 2WDQB 3DHGC 1OFFA 2JUOA 2SAKA 3TSSA 3RMKC 1WGDA 2LGYA 3HRDD 3T3NA 4MGKE 2M0XA 1D5XC 2L76A 2KTFA 1R4MB 4GU2A 1GJZA 2PMVA 1I4HA 3KYCD 2I1KA 2J53A 3MC0B 4C7YA 5EE0A 3PSEB 1WH3A 4IG7B 1E9MA 4WJOA 2WXMA 3ENEA 3WALA 3IT6B 2LZ6A 4XYCA 3VR9B 2FCNA 2L05A 3DVNV 4FULA 2MP2A 2XK5B 2DLBA 2O2VA 4KGSA 3WANA 3AE6B 2FCMA 4RCOA 5CX3A 4QAYA 2N0SB 1C4PA 4KKIA 4NAWB 1KFYB 1C76A 4F7ZA 2L1AA 3TEYA 2YLMA 2FIDA 3QCAA 1SE3A 1NI2A 1T3QA 3EFUA 4BZAA 1GG3A 1MG4A 4WJQA 4OVVA 2ZZPB 3OAWA 4ARIA 2O6VD 2H88B 3ZDMC 3O65B 2LRUA 4C00A 2BWFA 3DOWA 4BOSC 3H7PA 2LRWA 3NG0A 1HE8A 2DZJA 1TKYA 2LHDA 3DBRI 3HK0A 2KZRA 4LDTD 2JYTA 2NCNA 1FNVA 1GC6A 1TTNA 2JRHA 3I5JC 4TQ1A 4MACA 1I4XA 2K1FA 1UGJA 2MBOA 4JX1C 1Q5WB 2JZPA 2MX2A 4AS1A 3VAWA 5J18A 2DZIA 2D3GA 1SJHD 2MJDA 4KSLC 5EDSA 5J17A 3LB8C 3GOEA 4EZLA 2V3SA 3EA6A 1WFYA 3QIJA 4L2YA 2WNMA 1KH0A 1WZ3A 4LJOB 3AN1A 2FUHB 2LXCA 3QK0A 2KAJA 1P1AA 4YL8A 3V61A 2LVPA 1TGZB 4G3XB 4NQKE 4WWNA 4IDIA 4B9KA 4FJVB 3H7SA 3ZJUA 5DPRA 5AZHA 2R2QA 2ZNVB 4G11A 3BYTB 2Y5PA 1IP9A 1VJKA 2J52A 3RD2A 1MG8A 1T5XD 3TMPB 2UYZB 2KLCA 4K7WA 1SJED 3UINB 2SEBD 5BYSA 5GMVA 3TEXA 3VHTC 1MHHE 1L0VB 3IFWB 4HJGE 2WLBA 3GZNI 1FXIA 1D4BA 3ZQ4A 1OQQA 4HKZE 1WJNA 4KVGB 1WGRA 3DBSA 1I4QA 1ZOYB 1E90A 2LUMA 2JX5A 1YQBA 3KUCB 2DYBA 2JYEA 5G5HA 5KHQA 5JH5C 3IAM1 4FJYA 2N9PC 4ZRJA 1QT9A 4FA6A 1I7HA 4JPSA 1WXVA 2N9EB 1EF1A 2N9KA 2RDBC 3W9CB 2WXRA 4BKSD 4J6IA 3KVFB 4KV2A 4AP4C 4GIVA 3NY5A 3Q8CA 2QIEB 2M17A 3ZW3A 3PZ7A 3ZDTA 4DXAB 3SD5A 4OZBA 4PYZA 2KQ7A 1UWMA 2IGDA 4HCPB 4ITKA 4YSXB 1XCTL 5L95C 3I57A 2MJ3A 1STEA 2RSUA 1V9JA 2J42A 4JE3B 3B2FA 4M00A 3RNAC 4G0NB 4I6LB 4YTMB 5AZFA 2K6DB 2BW2A 2J0KA 4N59A 2K25A 2K5PA 3LDZE 3RI7C 2MA9B 4JWUC 2FE8A 3CSTA 2E6XA 2L3ZA 3Q3MC 1VDVA 4XZ4A 3U8ZA 4HK2A 2ZNVC 1QF6A 5DCNA 2DNFA 2AQ3B 3VVWB 1XLQA 2BWES 4HRSA 3W1YA 2VRRB 2KQ4X 3K9OB 4DHZE 4KGRA 2N4FA 2LVOA 1GC7A 4WAAA 3SFEB 1MFWA 3VH4B 3GP7A 3M3JA 2ICIA 4IM0A 1Q1OA 2G4DB 1WJ6A 3ZIMA 4W9IA 4TUUA 2C7HA 1SEBD 1E5WA 1CZPA 3PRPB 4IWOA 4JWSC 4KKJA 4OZCA 1ZPSA 1NVID 2M8SA 1V1OA 2W3RA 5E6OA 1ZDVA 4WWOA 5EE3A 2KT7A 2M0AA 2HDEA 3VXWA 3ZXRA 2LGIA 3AE2B 3A9KB 1KM7A 1DGJA 2ZCCA 3M62B 5C1ZA 4AQ7A 2QSDA 4DDGD 4WJPA 5H92C 5IKCM 3ONSA 1Q0WB 3O13A 2BT6A 2WXFA 3AE5B 1D6EC 2D07B 3Q69A 1ESFA 2BPSA 4P6VF 3RT3B 1C79A 4E71A 3RNGC 2D5GA 1XLNA 1J19A 4II2B 2L8JA 3ZVVA 3CSFA 1I4PA 4I6NB 4IKGA 2M1MA 2C9WB 3ETRA 3AEFB 2KFKB 2QILA 1VR9A 1RM6C 2WU5B 4YT0B 3LXFA 3U4EG 4BOZB 3Q8AA 3JSVA 4BKTA 2MBQA 2WXPA 1V6EA 3SFDB 2OHFA 1N60A 4S17A 3C19A 3IG3A 3OWEB 2C5LC 1N5XA 2K8HA 3AE7B 4B6WA 2GBJA 3NOBA 2OJWA 4BVUC 1H8CA 2ZEQA 1OEYA 3E9SA 2M56B 3VTWA 4MT5A 1FXTB 3BK1A 3L13A 2PE9A 3R2IA 1E8XA 4MGZE 1P0RA 2I1JA 1TZ1A 1HZ5A 1SE4A 3M63B 3GB1A 3VUWA 4R3DA 2HJ1A 1C77A 2KVRA 2L0TA 4F1SA 4BBNF 3CMMB 3QQ8B 1SBBB 1YN3A 4KSKC 3N1YC 1J0GA 1FMAD 3NZSA 2NBWB 4DBGA 2NBUA 4AWJA 3PREA 1MI0A 1XCQL 4ANUA 4AJWA 3N3KB 1OEYJ 2RPQA 1A5RA 2BVCA 3UQBA 4S0RA 3A1QB 3DVGY 1QILA 3QWZB 1JCKB 4W9EA 2GOWA 5CHFA 3V6CB 4X57B 1ROEA 3DBHI 3A4RA 4DXGA 3C8YA 1L4DB 4FLHA 1SIJA 3MJ5A 1WRDB 1K8RB 3PLVA 2DAJA 2MCNB 2KYWA 1L7YA 2BF8B 4P7IA 2CU1A 1HTQA 3PHXB 2KWDA 4FHKA 4P16A 1IBXA 1WIAA 2RGFA 2V3PA 2INCC 4HDOA 2GMIC 4KDLB 2KO3A 2MW5A 3KWLA 4EZJA 4ZRKA 1FRRA 3PT2B 2REXA 1P3QU 3ZTDA 1AWDA 3DBHB 1JRUA 2H89B 4W9JA 3SDLC 2IY0B 3W5UB 4DQOC 1PFDA 2FUG1 4WQMA 4MM3B 1WR6E 4BBNC 1JWMD 3Q3JA 3HIZA 4A8XC 4AOFA 4URKA 1YD8U 3N20C 3N30A 5H8YE 5DPSA 3B1LX 2MQJA 5E6NA 4NJ6A 4LNOA 3V3XA 2K8BA 3HVDA 3NZ3A 2PLPA 3FKYA 2DBYA 2XEWA 1P98A 3DBLB 2EMSA 3SU8X 2INPE 4GOCA 2J4XA 4C56C 3WAOA 3HHMA 2KC2A 1ZW7A 2PEAA 3AEEB 3EECA 3KWVA 1EWCA 4LJPB 3A4SC 4ZHPA 1WYWB 4EKUA 3Q3FA 4PYUA 3R2TA 2J7QB 2G9HD 3CF6E 2CS4A 1WGHA 2M4NA 3MP9A 4ZRIA 4IM2A 1FNUA 5C3JB 4LTUA 4ZOHC 3P4QB 2MP2B 3N1ZC 4FXCA 4NAMA 2R2OA 2K22A 2LI5A 3P42A 4MH0E 2NR2A 1JMLA 3A9JA 4JIOU 3EC8A 5L83A 1E7VA 5T8IA 2ZW0A 1MHXA 1WM2A 3RNCC 2LGDA 1ISNA 1L0XB 1ZP0B 2V4LA 5JXVA 2BB6A 1V86A 2XBBC 4CYEA 3HM6X 3KUZA 5EE9A 1VZ7A 3PZDA 2W82A 4XE0A 1DOYA 5HFYA 1QKZA 2IPKD 4N6EB 4IWPA 1D5MC 1J7BA 2J0MA 1HTOA 2B3AA 4RH6A 2LJIA 2PIAA 4JQWC 1FO4A 4A55A 4MDKE 3GS2A 4KIKA 4DHJB 1FFUA 1WI0A 2L0FA 3QJZA 3TCAA 4RM9A 2FAZA 4HCNB 1OQRA 2AEHA 4YSYB 4KGTA 1IYFA 2RD0A 2DAFA 2D10A 2DZKA 1E0ZA 3BWUD 4CO7A 4WJNA 1GOZA 1T0SC 1S1QB 3RZWC 2IJ0A 4HKQA 3AI5A 2JZZA 1B9RA 3ZNZB 3BVGA 4NQLB 2PE6B 3ZNHB 1EU3A 1LQBA 1WX7A 3TUOA 3L17A 4K7UA 2KDFB 3TEWA 1SSNA 1HXYD 3DHIC 3B9JA 3RPFC 2VZKB 3BYYB 3WIMA 4WIPA 4HJKA 4ANWA 4A3PA 5CHWA 3IT4B 1NI3A 2CHXA 3VFKA 1ET6A 4GSWA 3N1XC 5FR3A 3P1MA 2ONQA 3AH7A 2CU3A 1XF5L 3HM3A 4K81A 3PPAA 3FC4A 2IZVB 1E8YA 1F9JA 1UH6A 4ZYSA 1KTKA 3DDCB 2G1EA 2KDBA 4KZCA 3I3TB 1QZEA 4NAWA 2AYOB 1TS4A 3AMZA 4M0WB 2JPHA 1VRAB 1YQ4B 3BVMA 2G45B 4MJSA 2QC8A 3APFA 1WJ4A 4C80A 2IDYA 1CQVA 3UIPB 1QLBB 3NRZA 4A3OA 1YNTE 2WX0A 1TS5A 4PT5A 2RDGA 5E6PA 2NPTB 1JROA 2NTTA 3EGRA 1UUPA 1WE7A 2ON8A 3R66C 2AWTA 2C60A 4MGYE 3RNBC 4C4VB 1TY2A 1WGKA 5CTRC 2W55A 1BUIC 4K3BA 1L6UA 2JVCA 2N1WA 3RZFA 1F1HA 1H4RA 3KYDD 1TT5B 4KIKB 3AULA 2EELA 3DCGA 4USAA 1EF5A 1N61A 2NBVB 3CWIA 2WP9B 2OJRA 3OJ4B 4OHJA 3K9PB 1UWXA 2WXIA 2WWZA 3AU4A 4KDIC 2KXJA 2OEDA 1D5ZC 4DXFA 4J3OD 3ZJTA 1MJDA 1WGGA 1V49A 3BVZA 1YX5B 1GAQB 2N1VA 1UGMA 4FHJA 3AE4B 4HROA 3PLUA 2D3CA 3DVGX 3ZXVA 1UZXB 2FIFA 2ZCBA 3WAMA 1E6EB 1M94A 5TSSA 4I6PA 1N5WA 4TMAB 1SGHA 2VH2A 4ZRPA 1BMLC 1RLFA 2QCZA 1UNSA 4RGMA 3TEZA 3Q2AC 1JALA 1UF0A 1ZUD2 3I9V1 4G50A 2KWCA 3ABVB 2GRIA 3PRZA 4BAXA 3A9KA 4UDUC 3ML8A 2O6VA 2C7MB 1P9DU 4Q2JA 2KLGA 2K39A 3R3MA 1YX6B 2BKFA 4YXDB 4H2AA 5LXIB 4E74A 2KKCA 2KX3A 2NVUI 2FBWB 3OLMD 4RGTA 1FM0D 2RDHA 4LK0M 1V1PA 3SEBA 4MJSB 4RGNA 3IAS1 1E10A 2ZVNA 3R7QA 2KACA 2CJOA 2RPVA 2FCQA 4B0MA 1P7EA 5LXHA 5D2MB 4WURA 1TJEA 4ZDVA 3R8BA 5JHAA 1DOXA 2JXXA 1XXGA 3W1SC 1RYJA 2KNBA 4ICVA 5BYRA 3V6EB 2CHZA 2BS2B 3VTVA 1PQSA 2J0JA 1WJUA 4A20A 2ACZB 3N32A 4DWFA 1TKGA 4M01A 4GN1A 4PS8A 3B0AA 5BO4B 1MVKA 4ZRQA 2IGGA 4ZYNA 1P7FA 3DHHC 2QEJC 3UQAA 4M02A 2CJNA 5GXGB 2GBMA 3UIOB 4EZKA 3P4PB 2AX5A 1AW7A 5I4DA 4GDKA 2UWQA 3VUYA 4AUQC 4B0EA 3X23A 2FCSA 2L7RA 2KMMA 1XQQA 1F2RC 3Q3OC 5HG2A 2ZJDA 4FJZA 1F52A 2NS5A 1F77A 3PHWB 4OZAA 4US8A 4NPNA 4TV3A 2BS4B 5BMIA 4FBJB 3AXCA 4KX6B 3LJ3A 1R4NI 2KFJA 2JSVX 1L0YB 1N63A 2KTRB 4IM3A 5J2RA 4XGAB 2INNE 1FXAA 4RFBA 2Z8LA 4IOIE 4K7SA 4M8NA 3ZO5B 3IHPC 3JVZX 3NVWA 2MBHA 1JWUD 5C23A 2BQQA 1TS2A 1J7AA 1PGXA 1TIFA 3H1UA 5IO9A 1VD2A 3ZTCA 3ML9A 2NTSA 3ZNGC 2DHZA 1C4AA 1WMHA 5D7GA 3R7RA 3DBLI 4BKGA 2O6VB 1EO6A 4EEWA 4EE2A 2LMCA 2ZVOA 4W9CA 3BINA 5JHBA 4YTPB 1I4RA 3UF8A 3U2SC 1WXMA 4WQOB 2WS3B 1R4MI 1WYGA 4MM3A 1OGWA 4OVZA 1V80A 3EHVA 1HEZE 2G3QB 2JF5A 4N9F4 2K3UA 1WXSA 4NY0A 1YQ3B 1YJJA 1Y56A 1FEHA 4EOYA 4K1RB 1QOBA 5FK9C 1K50A 2BB5A 1V97A 4E3CA 3H8HA 2KJRA 1FNWA 1XO3A 1PGBA 5IA7A 2PW9A 2KD0A 4XX5A 3BZDB 5HI1A 1L6VA 3AM9A 1U4AA 2LFIA 1B1ZA 1C78A 1G6JA 1LGRA 3EFCA 1XD3B 2EMTA 4LNKA 1LO5D 3UI3A 4W9DA 3FAHA 1KJTA 3APCA 1ZKHA 1GB1A 1XLOA 1BXTA 2BYEA 3FILB 1UD7A 3OG5A 1QQRA 4W9FA 3LYYA 2WYQA 2L32A 1FIQA 2XK5A 3TIXA 4GDKB
chains in the Genus database with same CATH topology
2Z0DB 4HPLB 4HLEA 3NS8A 4HCPB 3L17A 4K7UA 2KDFB 2BGFA 2IO2B 1GNUA 2MLBA 3BY4B 2C7NB 5L95C 2JZ3B 3T8MA 4HVBA 2JWZA 3WIMA 4IWQA 4HJKA 3PTFC 2WDTB 2RSUA 1V9JA 4ANWA 4A3PA 5CHWA 1OTRB 4BKSA 2CHXA 2N7EA 3VFKA 3A1QA 4GSWA 4G0NB 4I6LB 4FN2A 1KOTA 5AZFA 2K6DB 3HM3A 2KN5A 2J0KA 2K25A 3LDZE 2BKRB 3ECIA 2MA9B 2GBNA 3PPAA 4K81A 3CSTA 2RR9A 2L3ZA 2IZVB 2OOBB 2LXAA 1E8YA 1Z2MA 1F9JA 1EUVB 1UH6A 1V5TA 1V2YA 2KDEB 2Z0EB 2MBEA 1WR1A 1WE6A 4XZ4A 3U8ZA 4HK2A 3X0WA 2ZNVC 4GXBA 2FNJB 3DDCB 5G55A 2HJ8A 4IUMB 5DCNA 2KDBA 3L10B 3H7PB 3I3TB 4KZCA 4WWPA 3VVWB 4FADA 2BWES 1QZEA 2A4ZA 1Y8RC 3QHTA 4NAWA 1TBEA 2VRRB 4KZ0A 3W1YA 2K8CA 2AYOB 2ASQA 3L54A 3K9OB 3PV1A 4GDLA 4DHZE 5KHOA 2N4FA 2LVOA 1GC7A 1YJ1A 3MJWA 4M0WB 4WAAA 4PS7A 1SE9A 1D3ZA 3VH4B 4RMAA 3M3JA 2JPHA 4IM0A 1Q1OA 5CHVC 2IBIB 2G4DB 1WJ6A 3ZIMA 4W9IA 2G45B 2BYFA 4TUUA 2C7HA 2O2VB 3APDA 4II3B 1E5WA 4MJSA 3PVLA 1WMHB 2Y5BB 1AARA 3APFA 3PRPB 4IWOA 1WJ4A 3QAQA 3H6NA 4HDQA 1RAXA 4RM8A 3RCZA 3UIPB 2M8SA 4DK5A 5E6OA 4ANVA 4A3OA 1VCBA 4WWOA 4TKNA 2WX0A 1LFDA 3VXWA 2D11A 4DDID 2BYVE 3L0WB 1T0YA 3A9KB 5E6PA 4DHZB 1KM7A 2KMAA 4JL9A 3DVNU 2NPTB 2ZCCA 3UGBB 2PJHA 5D6JB 3V60A 3M62B 4HWIB 2KTRA 5C1ZA 4B95A 1GUAB 5D94A 1WE7A 2KQSA 3R66C 3A9JB 5AZGA 3QA8A 2AL3A 2AWTA 3VUXA 4W9HA 2C60A 3DQVA 3ZRCA 4DDGD 2LASA 4MGYE 4WJPA 5HKHA 4JLCA 5CTRC 2GBRA 3ONSA 1Q0WB 2L00B 3VQIA 3PS6A 3ZRFA 4AJYB 2KHWB 3B08A 3QC8B 1XT9B 2D07B 2JVCA 3ZUNA 2GBKA 2N1WA 2JY6A 3RZFA 4TQ0A 1H4RA 3KYDD 3OJ3A 1J8CA 4KIKB 3AULA 3DCGA 1WY8A 2BPSA 1EF5A 1L2NA 3RT3B 3MHSD 2NBVB 4E71A 1BT0A 2N7DA 1V81A 2DZMA 2ZPNA 2OJRA 3KW5B 2W9NA 4PS3A 3OJ4B 1RRBA 1J19A 4II2B 2L8JA 4ASWC 3ZVVA 2IO0B 3CSFA 3K9PB 5DPWA 2KJ6A 4I6NB 4JGHB 3D32A 2M1MA 2C9WB 2PPHA 2WWZA 3AU4A 2JT4B 4MELA 5G2NA 3ZNID 2ZPYA 2JRIB 4KDIC 1S3SG 2KFKB 1UELA 2KXJA 1WX8A 3RYTA 1WGGA 1V49A 4BOZB 1YX5B 2LJ5A 2Z59B 4EUTA 3TBLD 3JSVA 2WX1A 4BKTA 3A33B 2MBQA 1NBFC 2N1VA 1UGMA 1V6EA 4EFOA 4FHJA 3DPDA 3IG3A 3PLUA 2C5LC 3VDZA 2K8HA 2KDIA 4B6WA 2MRPA 2GBJA 3DVGX 3NOBA 4BVUC 1H8CA 2ZEQA 1OEYA 2LGXA 5FR6A 1UZXB 2DX5B 2FIFA 3VTWA 3JW0X 2ZCBA 3L16A 1FXTB 1UBQA 2QHOA 3KH0A 3WAMA 1M94A 1WXAA 3L13A 3IVFA 2PE9A 1E8XA 4I6PA 4MGZE 2DENB 1P0RA 1WM3A 1SGHA 2I1JA 1TZ1A 1RLFA 3M63B 2KC1A 3VUWA 3RUIB 2KVRA 2L0TA 3MTNB 4W9LA 1C3TA 2CHWA 3IBEA 4F1SA 2IY1B 2IYDB 4MGIE 4BBNF 2JUOA 3CMMB 2A5UA 3QQ8B 1WGDA 4DHJD 2LGYA 4G50A 3WA0A 4MGKE 2KWCA 1NDDA 1OQYA 2M0XA 1X1MA 4KSKC 2L76A 2KANA 3PRZA 2KTFA 1J0GA 2KJHB 4HPMB 3NZSA 2NBWB 4DBGA 2CR5A 2NBUA 3A9KA 4GU2A 1GJZA 4AWJA 3ML8A 2O6VA 3PREA 4OVUA 4ANUA 2C7MB 1P9DU 4AJWA 2KLGA 3AU5A 3N3KB 1OEYJ 2K39A 2RPQA 3KYCD 2I1KA 1A5RA 3R3MA 3S2AA 3UQBA 3A1QB 1YX6B 2BKFA 3DVGY 3PSEB 3QWZB 1WX9A 1WH3A 4IG7B 4W9EA 5LXIB 2GOWA 2LUEA 4ANXA 4WJOA 5CHFA 2KK8A 3ENEA 4GGQA 2KKCA 3V6CB 4E74A 4X57B 3WALA 2KX3A 2LZ6A 3U7DA 3DBHI 3A4RA 2FCNA 2NVUI 2L05A 3OLMD 3DVNV 4FULA 2MP2A 1V5OA 2XK5B 2O2VA 4MJSB 3WANA 4FLHA 3JYUA 2ZVNA 2FCMA 3R7QA 4ICUA 1WRDB 2FCQA 1K8RB 3PLVA 3U30A 5CX3A 3P2BA 3VH3B 2DAJA 2MCNB 4NAWB 5LXHA 4F7ZA 1L7YA 5D2MB 2BF8B 4P7IA 2CU1A 4ZDVA 3PHXB 1LXDA 1CMXB 5JHAA 4BFRA 2JXXA 4M8MA 1E8ZA 2YLMA 4FHKA 2FIDA 3QCAA 3W1SC 1WIAA 2KNBA 2RGFA 4HDOA 4ICVA 2GMIC 4KDLB 2KO3A 3V6EB 1NI2A 2CHZA 2MW5A 3EFUA 4F8CB 4EZJA 4ZRKA 3WAPA 1GG3A 2AL6A 3PT2B 2LVQA 3VTVA 4WJQA 2REXA 4OVVA 1PQSA 2J0JA 1WJUA 1P3QU 2MSED 2ZZPB 3ZTDA 4A20A 3N32A 4DWFA 1JRUA 3OAWA 4W9JA 3SDLC 2O6VD 2IY0B 4GMVA 4GN1A 3NHEB 4W9GA 4PS8A 3B0AA 5BO4B 3ZDMC 1WR6E 3O65B 2LRUA 4BBNC 2KX0A 5IAAC 3TL5A 3Q3JA 2CKHB 2BWFA 4ZYNA 3DOWA 3HIZA 4AOFA 4BOSC 4URKA 1YD8U 3H7PA 1LM8B 2LRWA 3N30A 1HE8A 2HD5B 2DZJA 3UQAA 2YVCA 2GBMA 2LD9A 3DBRI 3HK0A 5DPSA 2KZRA 4LDTD 2K6QA 2MQJA 2NCNA 3B1LX 1GC6A 1TTNA 2DYMA 4NJ6A 2JRHA 5E6NA 3UIOB 4TQ1A 5LLIA 3ALBA 4EZKA 3V62A 2K8BA 3QARA 2UWQA 1Z5SB 4GDKA 3VUYA 4AUQC 4IC7B 3X23A 2K1FA 2FCSA 3H9DA 2L7RA 2MBOA 4HXDA 1XQQA 1Q5WB 2MX2A 2XEWA 3VAWA 2ZJDA 4FJZA 5J18A 2DZIA 1P98A 3W1SA 2NS5A 2D3GA 3PHWB 2EMSA 4KSLC 3SU8X 4NPNA 4TV3A 4GOCA 3WAOA 4FBJB 5EDSA 3AXCA 3HHMA 3LJ3A 5J17A 1R4NI 2KC2A 1ZW7A 2KFJA 2PEAA 4GB9A 2KTRB 3GOEA 4IM3A 3NZUA 5J2RA 3EECA 4CHKA 4LJPB 4K7SA 2NPTA 4MEMA 4M8NA 3ZO5B 4EZLA 2V3SA 3A4SC 3IHPC 3JVZX 1SIFA 1RFAA 2KFKA 1WFYA 3VTUA 3QIJA 1WYWB 4EKUA 3Q3FA 4PYUA 1WZ3A 4LCDE 4LJOB 2FUHB 2LXCA 3QK0A 2J7QB 1P1AA 1WGYA 3CF6E 2CS4A 1WGHA 2MBHA 2M4NA 4ZRIA 5C23A 4YL8A 3V61A 2LVPA 1TGZB 3KUDB 4G3XB 2KMCA 4NQKE 4IM2A 2KOXA 4WWNA 4B9KA 4FJVB 3H7SA 3L08A 3H1UA 5DPRA 2MP2B 4GDLB 5AZHA 2R2QA 2MBBB 1VD2A 2ZNVB 4G11A 3ZTCA 2LWPA 1IPGA 2R2OA 3ML9A 1IP9A 4W9KA 3PRMB 3RD2A 1MG8A 2LI5A 4XC2A 3ZKJC 4MH0E 2NR2A 3TMPB 3ZNGC 2UYZB 3A9JA 4JIOU 2DHZA 2KLCA 4K7WA 3EC8A 3UINB 5L83A 1E7VA 1WMHA 5D7GA 2DYOA 5GMVA 3VHTC 3IFWB 4MSQB 3R7RA 1WM2A 3DBLI 2LGDA 3C0RB 1ISNA 4BKGA 3JSVB 2O6VB 1EO6A 3GZNI 4EEWA 2V4LA 1C1YB 3TJPA 2ZVOA 1E8WA 4W9CA 1WF9A 1V86A 2XBBC 1I42A 3BINA 5JHBA 3ZLZA 1WJNA 4KVGB 5TR5A 1WGRA 3DBSA 4NNJB 3UF8A 4CYEA 1E90A 2N9XA 1WXMA 3HM6X 3KUZA 3PZDA 2MWSB 1YQBA 3KUCB 2DYBA 4WQOB 2EKEC 1R4MI 5KHQA 5JH5C 4MM3A 1OGWA 1V80A 3EHVA 2G3QB 2JF5A 4FJYA 4N9F4 4IWPA 3RULA 2N9PC 4ZRJA 1WXSA 4FA6A 5JZEB 4NY0A 1YIWA 2J0MA 3PGEA 2B3AA 2V1YA 4JQWC 1E7UA 4EOYA 4MDKE 4MSMB 1WXVA 2N9EB 4KIKA 1EF1A 4K1RB 3SHQA 4DHJB 2HE7A 1WI0A 4NJ7A 4E3CA 4BKSD 2L0FA 1I35A 3QJZA 4J6IA 4RM9A 3TCAA 2HTHA 1UBIA 2FAZA 2KJRA 4HCNB 3KVFB 5IA7A 2KD0A 3QX1A 4KV2A 4XX5A 4AP4C 2AEHA 4GIVA 3NY5A 3M95A 1IYFA 1U4AA 2M17A 1G6JA 2RD0A 2G4SA 3ZW3A 1XD3B 3ZDTA 2DAFA 2D10A 4LDTB 4DXAB 2DZKA 2EMTA 3SD5A 1KLVA 4CO7A 4WJNA 4W9DA 2IO3B 1KJTA 2D2QA 5AEKB 3APCA 1S1QB 1ZGUB 1ZKHA 5DPTA 2KWUB 3RZWC 4PYZA 3AI5A 2KQ7A 2JZZA 3T9LA 1WZ0A 2BYEA 2IO1B 1UD7A 3ZNZB 4W9FA 4NQLB 2WYQA 2PE6B 4IW0A 3ZNHB 2KWVB 2XK5A 1LQBA 3TIXA 1WX7A 4GDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0D B;  4HPL B;  4HLE A;  3NS8 A;  4HCP B;  3L17 A;  4K7U A;  2KDF B;  2BGF A;  2IO2 B;  1GNU A;  2MLB A;  3BY4 B;  2C7N B;  5L95 C;  2JZ3 B;  3T8M A;  4HVB A;  2JWZ A;  3WIM A;  4IWQ A;  4HJK A;  3PTF C;  2WDT B;  2RSU A;  1V9J A;  4ANW A;  4A3P A;  5CHW A;  1OTR B;  4BKS A;  2CHX A;  2N7E A;  3VFK A;  3A1Q A;  4GSW A;  4G0N B;  4I6L B;  4FN2 A;  1KOT A;  5AZF A;  2K6D B;  3HM3 A;  2KN5 A;  2J0K A;  2K25 A;  3LDZ E;  2BKR B;  3ECI A;  2MA9 B;  2GBN A;  3PPA A;  4K81 A;  3CST A;  2RR9 A;  2L3Z A;  2IZV B;  2OOB B;  2LXA A;  1E8Y A;  1Z2M A;  1F9J A;  1EUV B;  1UH6 A;  1V5T A;  1V2Y A;  2KDE B;  2Z0E B;  2MBE A;  1WR1 A;  1WE6 A;  4XZ4 A;  3U8Z A;  4HK2 A;  3X0W A;  2ZNV C;  4GXB A;  2FNJ B;  3DDC B;  5G55 A;  2HJ8 A;  4IUM B;  5DCN A;  2KDB A;  3L10 B;  3H7P B;  3I3T B;  4KZC A;  4WWP A;  3VVW B;  4FAD A;  2BWE S;  1QZE A;  2A4Z A;  1Y8R C;  3QHT A;  4NAW A;  1TBE A;  2VRR B;  4KZ0 A;  3W1Y A;  2K8C A;  2AYO B;  2ASQ A;  3L54 A;  3K9O B;  3PV1 A;  4GDL A;  4DHZ E;  5KHO A;  2N4F A;  2LVO A;  1GC7 A;  1YJ1 A;  3MJW A;  4M0W B;  4WAA A;  4PS7 A;  1SE9 A;  1D3Z A;  3VH4 B;  4RMA A;  3M3J A;  2JPH A;  4IM0 A;  1Q1O A;  5CHV C;  2IBI B;  2G4D B;  1WJ6 A;  3ZIM A;  4W9I A;  2G45 B;  2BYF A;  4TUU A;  2C7H A;  2O2V B;  3APD A;  4II3 B;  1E5W A;  4MJS A;  3PVL A;  1WMH B;  2Y5B B;  1AAR A;  3APF A;  3PRP B;  4IWO A;  1WJ4 A;  3QAQ A;  3H6N A;  4HDQ A;  1RAX A;  4RM8 A;  3RCZ A;  3UIP B;  2M8S A;  4DK5 A;  5E6O A;  4ANV A;  4A3O A;  1VCB A;  4WWO A;  4TKN A;  2WX0 A;  1LFD A;  3VXW A;  2D11 A;  4DDI D;  2BYV E;  3L0W B;  1T0Y A;  3A9K B;  5E6P A;  4DHZ B;  1KM7 A;  2KMA A;  4JL9 A;  3DVN U;  2NPT B;  2ZCC A;  3UGB B;  2PJH A;  5D6J B;  3V60 A;  3M62 B;  4HWI B;  2KTR A;  5C1Z A;  4B95 A;  1GUA B;  5D94 A;  1WE7 A;  2KQS A;  3R66 C;  3A9J B;  5AZG A;  3QA8 A;  2AL3 A;  2AWT A;  3VUX A;  4W9H A;  2C60 A;  3DQV A;  3ZRC A;  4DDG D;  2LAS A;  4MGY E;  4WJP A;  5HKH A;  4JLC A;  5CTR C;  2GBR A;  3ONS A;  1Q0W B;  2L00 B;  3VQI A;  3PS6 A;  3ZRF A;  4AJY B;  2KHW B;  3B08 A;  3QC8 B;  1XT9 B;  2D07 B;  2JVC A;  3ZUN A;  2GBK A;  2N1W A;  2JY6 A;  3RZF A;  4TQ0 A;  1H4R A;  3KYD D;  3OJ3 A;  1J8C A;  4KIK B;  3AUL A;  3DCG A;  1WY8 A;  2BPS A;  1EF5 A;  1L2N A;  3RT3 B;  3MHS D;  2NBV B;  4E71 A;  1BT0 A;  2N7D A;  1V81 A;  2DZM A;  2ZPN A;  2OJR A;  3KW5 B;  2W9N A;  4PS3 A;  3OJ4 B;  1RRB A;  1J19 A;  4II2 B;  2L8J A;  4ASW C;  3ZVV A;  2IO0 B;  3CSF A;  3K9P B;  5DPW A;  2KJ6 A;  4I6N B;  4JGH B;  3D32 A;  2M1M A;  2C9W B;  2PPH A;  2WWZ A;  3AU4 A;  2JT4 B;  4MEL A;  5G2N A;  3ZNI D;  2ZPY A;  2JRI B;  4KDI C;  1S3S G;  2KFK B;  1UEL A;  2KXJ A;  1WX8 A;  3RYT A;  1WGG A;  1V49 A;  4BOZ B;  1YX5 B;  2LJ5 A;  2Z59 B;  4EUT A;  3TBL D;  3JSV A;  2WX1 A;  4BKT A;  3A33 B;  2MBQ A;  1NBF C;  2N1V A;  1UGM A;  1V6E A;  4EFO A;  4FHJ A;  3DPD A;  3IG3 A;  3PLU A;  2C5L C;  3VDZ A;  2K8H A;  2KDI A;  4B6W A;  2MRP A;  2GBJ A;  3DVG X;  3NOB A;  4BVU C;  1H8C A;  2ZEQ A;  1OEY A;  2LGX A;  5FR6 A;  1UZX B;  2DX5 B;  2FIF A;  3VTW A;  3JW0 X;  2ZCB A;  3L16 A;  1FXT B;  1UBQ A;  2QHO A;  3KH0 A;  3WAM A;  1M94 A;  1WXA A;  3L13 A;  3IVF A;  2PE9 A;  1E8X A;  4I6P A;  4MGZ E;  2DEN B;  1P0R A;  1WM3 A;  1SGH A;  2I1J A;  1TZ1 A;  1RLF A;  3M63 B;  2KC1 A;  3VUW A;  3RUI B;  2KVR A;  2L0T A;  3MTN B;  4W9L A;  1C3T A;  2CHW A;  3IBE A;  4F1S A;  2IY1 B;  2IYD B;  4MGI E;  4BBN F;  2JUO A;  3CMM B;  2A5U A;  3QQ8 B;  1WGD A;  4DHJ D;  2LGY A;  4G50 A;  3WA0 A;  4MGK E;  2KWC A;  1NDD A;  1OQY A;  2M0X A;  1X1M A;  4KSK C;  2L76 A;  2KAN A;  3PRZ A;  2KTF A;  1J0G A;  2KJH B;  4HPM B;  3NZS A;  2NBW B;  4DBG A;  2CR5 A;  2NBU A;  3A9K A;  4GU2 A;  1GJZ A;  4AWJ A;  3ML8 A;  2O6V A;  3PRE A;  4OVU A;  4ANU A;  2C7M B;  1P9D U;  4AJW A;  2KLG A;  3AU5 A;  3N3K B;  1OEY J;  2K39 A;  2RPQ A;  3KYC D;  2I1K A;  1A5R A;  3R3M A;  3S2A A;  3UQB A;  3A1Q B;  1YX6 B;  2BKF A;  3DVG Y;  3PSE B;  3QWZ B;  1WX9 A;  1WH3 A;  4IG7 B;  4W9E A;  5LXI B;  2GOW A;  2LUE A;  4ANX A;  4WJO A;  5CHF A;  2KK8 A;  3ENE A;  4GGQ A;  2KKC A;  3V6C B;  4E74 A;  4X57 B;  3WAL A;  2KX3 A;  2LZ6 A;  3U7D A;  3DBH I;  3A4R A;  2FCN A;  2NVU I;  2L05 A;  3OLM D;  3DVN V;  4FUL A;  2MP2 A;  1V5O A;  2XK5 B;  2O2V A;  4MJS B;  3WAN A;  4FLH A;  3JYU A;  2ZVN A;  2FCM A;  3R7Q A;  4ICU A;  1WRD B;  2FCQ A;  1K8R B;  3PLV A;  3U30 A;  5CX3 A;  3P2B A;  3VH3 B;  2DAJ A;  2MCN B;  4NAW B;  5LXH A;  4F7Z A;  1L7Y A;  5D2M B;  2BF8 B;  4P7I A;  2CU1 A;  4ZDV A;  3PHX B;  1LXD A;  1CMX B;  5JHA A;  4BFR A;  2JXX A;  4M8M A;  1E8Z A;  2YLM A;  4FHK A;  2FID A;  3QCA A;  3W1S C;  1WIA A;  2KNB A;  2RGF A;  4HDO A;  4ICV A;  2GMI C;  4KDL B;  2KO3 A;  3V6E B;  1NI2 A;  2CHZ A;  2MW5 A;  3EFU A;  4F8C B;  4EZJ A;  4ZRK A;  3WAP A;  1GG3 A;  2AL6 A;  3PT2 B;  2LVQ A;  3VTV A;  4WJQ A;  2REX A;  4OVV A;  1PQS A;  2J0J A;  1WJU A;  1P3Q U;  2MSE D;  2ZZP B;  3ZTD A;  4A20 A;  3N32 A;  4DWF A;  1JRU A;  3OAW A;  4W9J A;  3SDL C;  2O6V D;  2IY0 B;  4GMV A;  4GN1 A;  3NHE B;  4W9G A;  4PS8 A;  3B0A A;  5BO4 B;  3ZDM C;  1WR6 E;  3O65 B;  2LRU A;  4BBN C;  2KX0 A;  5IAA C;  3TL5 A;  3Q3J A;  2CKH B;  2BWF A;  4ZYN A;  3DOW A;  3HIZ A;  4AOF A;  4BOS C;  4URK A;  1YD8 U;  3H7P A;  1LM8 B;  2LRW A;  3N30 A;  1HE8 A;  2HD5 B;  2DZJ A;  3UQA A;  2YVC A;  2GBM A;  2LD9 A;  3DBR I;  3HK0 A;  5DPS A;  2KZR A;  4LDT D;  2K6Q A;  2MQJ A;  2NCN A;  3B1L X;  1GC6 A;  1TTN A;  2DYM A;  4NJ6 A;  2JRH A;  5E6N A;  3UIO B;  4TQ1 A;  5LLI A;  3ALB A;  4EZK A;  3V62 A;  2K8B A;  3QAR A;  2UWQ A;  1Z5S B;  4GDK A;  3VUY A;  4AUQ C;  4IC7 B;  3X23 A;  2K1F A;  2FCS A;  3H9D A;  2L7R A;  2MBO A;  4HXD A;  1XQQ A;  1Q5W B;  2MX2 A;  2XEW A;  3VAW A;  2ZJD A;  4FJZ A;  5J18 A;  2DZI A;  1P98 A;  3W1S A;  2NS5 A;  2D3G A;  3PHW B;  2EMS A;  4KSL C;  3SU8 X;  4NPN A;  4TV3 A;  4GOC A;  3WAO A;  4FBJ B;  5EDS A;  3AXC A;  3HHM A;  3LJ3 A;  5J17 A;  1R4N I;  2KC2 A;  1ZW7 A;  2KFJ A;  2PEA A;  4GB9 A;  2KTR B;  3GOE A;  4IM3 A;  3NZU A;  5J2R A;  3EEC A;  4CHK A;  4LJP B;  4K7S A;  2NPT A;  4MEM A;  4M8N A;  3ZO5 B;  4EZL A;  2V3S A;  3A4S C;  3IHP C;  3JVZ X;  1SIF A;  1RFA A;  2KFK A;  1WFY A;  3VTU A;  3QIJ A;  1WYW B;  4EKU A;  3Q3F A;  4PYU A;  1WZ3 A;  4LCD E;  4LJO B;  2FUH B;  2LXC A;  3QK0 A;  2J7Q B;  1P1A A;  1WGY A;  3CF6 E;  2CS4 A;  1WGH A;  2MBH A;  2M4N A;  4ZRI A;  5C23 A;  4YL8 A;  3V61 A;  2LVP A;  1TGZ B;  3KUD B;  4G3X B;  2KMC A;  4NQK E;  4IM2 A;  2KOX A;  4WWN A;  4B9K A;  4FJV B;  3H7S A;  3L08 A;  3H1U A;  5DPR A;  2MP2 B;  4GDL B;  5AZH A;  2R2Q A;  2MBB B;  1VD2 A;  2ZNV B;  4G11 A;  3ZTC A;  2LWP A;  1IPG A;  2R2O A;  3ML9 A;  1IP9 A;  4W9K A;  3PRM B;  3RD2 A;  1MG8 A;  2LI5 A;  4XC2 A;  3ZKJ C;  4MH0 E;  2NR2 A;  3TMP B;  3ZNG C;  2UYZ B;  3A9J A;  4JIO U;  2DHZ A;  2KLC A;  4K7W A;  3EC8 A;  3UIN B;  5L83 A;  1E7V A;  1WMH A;  5D7G A;  2DYO A;  5GMV A;  3VHT C;  3IFW B;  4MSQ B;  3R7R A;  1WM2 A;  3DBL I;  2LGD A;  3C0R B;  1ISN A;  4BKG A;  3JSV B;  2O6V B;  1EO6 A;  3GZN I;  4EEW A;  2V4L A;  1C1Y B;  3TJP A;  2ZVO A;  1E8W A;  4W9C A;  1WF9 A;  1V86 A;  2XBB C;  1I42 A;  3BIN A;  5JHB A;  3ZLZ A;  1WJN A;  4KVG B;  5TR5 A;  1WGR A;  3DBS A;  4NNJ B;  3UF8 A;  4CYE A;  1E90 A;  2N9X A;  1WXM A;  3HM6 X;  3KUZ A;  3PZD A;  2MWS B;  1YQB A;  3KUC B;  2DYB A;  4WQO B;  2EKE C;  1R4M I;  5KHQ A;  5JH5 C;  4MM3 A;  1OGW A;  1V80 A;  3EHV A;  2G3Q B;  2JF5 A;  4FJY A;  4N9F 4;  4IWP A;  3RUL A;  2N9P C;  4ZRJ A;  1WXS A;  4FA6 A;  5JZE B;  4NY0 A;  1YIW A;  2J0M A;  3PGE A;  2B3A A;  2V1Y A;  4JQW C;  1E7U A;  4EOY A;  4MDK E;  4MSM B;  1WXV A;  2N9E B;  4KIK A;  1EF1 A;  4K1R B;  3SHQ A;  4DHJ B;  2HE7 A;  1WI0 A;  4NJ7 A;  4E3C A;  4BKS D;  2L0F A;  1I35 A;  3QJZ A;  4J6I A;  4RM9 A;  3TCA A;  2HTH A;  1UBI A;  2FAZ A;  2KJR A;  4HCN B;  3KVF B;  5IA7 A;  2KD0 A;  3QX1 A;  4KV2 A;  4XX5 A;  4AP4 C;  2AEH A;  4GIV A;  3NY5 A;  3M95 A;  1IYF A;  1U4A A;  2M17 A;  1G6J A;  2RD0 A;  2G4S A;  3ZW3 A;  1XD3 B;  3ZDT A;  2DAF A;  2D10 A;  4LDT B;  4DXA B;  2DZK A;  2EMT A;  3SD5 A;  1KLV A;  4CO7 A;  4WJN A;  4W9D A;  2IO3 B;  1KJT A;  2D2Q A;  5AEK B;  3APC A;  1S1Q B;  1ZGU B;  1ZKH A;  5DPT A;  2KWU B;  3RZW C;  4PYZ A;  3AI5 A;  2KQ7 A;  2JZZ A;  3T9L A;  1WZ0 A;  2BYE A;  2IO1 B;  1UD7 A;  3ZNZ B;  4W9F A;  4NQL B;  2WYQ A;  2PE6 B;  4IW0 A;  3ZNH B;  2KWV B;  2XK5 A;  1LQB A;  3TIX A;  1WX7 A;  4GDK B; 
#chains in the Genus database with same CATH topology
 2Z0D B;  4HPL B;  2N7J A;  1PYW D;  2IO2 B;  2K0P A;  2N9L A;  4ACF A;  2MLB A;  3BY4 B;  1IGD A;  3T8M A;  4HVB A;  2JWZ A;  2PVO D;  3A1Q A;  2AQ1 B;  1C9F A;  3Q3N C;  1C4C A;  2KN5 A;  3VR8 B;  2YEP F;  3ECI A;  1CJE A;  2WHI A;  2LXA A;  1Z2M A;  1EUV B;  1V5T A;  1V2Y A;  2KDE B;  2MBE A;  1WR1 A;  1WE6 A;  5MPO A;  3AV8 A;  5G55 A;  2HJ8 A;  3NVV A;  3L10 B;  4WWP A;  3H7P B;  4FAD A;  1SF0 A;  3QHT A;  1TBE A;  4KZ0 A;  2K8C A;  2DWQ A;  2ASQ A;  3L54 A;  4P1B C;  3PV1 A;  1YJ1 A;  3MJW A;  2AQ2 B;  2WXO A;  4PS7 A;  1D3Z A;  1IBX B;  2D3B A;  1DOI A;  2IBI B;  2BYF A;  3PVL A;  1WMH B;  2Y5B B;  1AAR A;  5BMH A;  1RAX A;  3RCZ A;  4DK5 A;  2K9X A;  3N9Y C;  5FKA C;  1LFD A;  2D11 A;  4DDI D;  2BYV E;  3E56 A;  1T0Y A;  2KMA A;  4JL9 A;  2WXG A;  3DVN U;  3UGB B;  5D6J B;  3V60 A;  3EUB 2;  4B95 A;  1GUA B;  2JWU A;  2KQS A;  2ZW1 A;  5AZG A;  3QA8 A;  2AL3 A;  2JQR B;  2V3N A;  4W9H A;  3W2D A;  1KRH A;  2LGS A;  3DQV A;  3KLS X;  2BS3 B;  2MEK A;  4HPP A;  3PS6 A;  3ZRF A;  4AJY B;  4C7Z A;  2KHW B;  2GI9 A;  2M19 A;  3ZUN A;  3OJ3 A;  1J8C A;  2BTE A;  4NJC A;  4CQN A;  1GPX A;  4WH4 A;  2QDF A;  2DZM A;  4PS3 A;  2D3A A;  2IND C;  2KJ6 A;  1WRI A;  2X8X X;  1ENF A;  4JGH B;  3D32 A;  1FD6 A;  4MEL A;  2JT4 B;  3ZNI D;  2ZPY A;  2JRI B;  1S3S G;  1UEL A;  2WXN A;  1WX8 A;  3RYT A;  2NMQ A;  2Z59 B;  3Q8B A;  2WX1 A;  1ET9 A;  1ZDX A;  4EFO A;  2X38 A;  3U52 E;  1FPY A;  3FIL A;  2WQY B;  2EKI A;  5IP4 D;  1F0Z A;  4N58 A;  2LGX A;  2DX5 B;  2QJL A;  3JW0 X;  1UBQ A;  2QHO A;  1WXA A;  1JWS D;  1TYG B;  3IVF A;  1JW9 D;  2DEN B;  1WM3 A;  1YOV B;  4M0W A;  1SB3 C;  3VRA B;  2KC1 A;  4LNF A;  3SR6 A;  3RNE C;  1XLP A;  4W9L A;  1AYF A;  3MTN B;  1KLG D;  2GB1 A;  3ZGZ A;  4YTN B;  1QOG A;  2A5U A;  3DWG C;  1RFK A;  3WA0 A;  4DHJ D;  5G5G A;  1NDD A;  1OQY A;  1X1M A;  2PVG C;  2Q5W D;  2KAN A;  2WGS A;  2KJH B;  4HPM B;  2XN9 C;  4US9 A;  2CR5 A;  4OVU A;  2KN4 A;  3AU5 A;  3S2A A;  3Q8E A;  3HVZ A;  5C2T B;  1WX9 A;  4WWM A;  2LUE A;  4ANX A;  2RMM A;  4A90 A;  2KK8 A;  4GGQ A;  3DBR B;  3PO0 A;  3U7D A;  3B2G A;  4LNI A;  2MHJ A;  1V5O A;  4L23 A;  3NVZ A;  3JYU A;  4ICU A;  2JU6 X;  1JWB D;  1PDX A;  3U30 A;  3P2B A;  3VH3 B;  4RNA A;  4XWT A;  4YWG G;  1FCC C;  2YEP B;  3T3O A;  2Y3A A;  1LXD A;  1CMX B;  1HA5 A;  1I4G A;  3U7Z A;  4BFR A;  4M8M A;  1E8Z A;  5AUI A;  2Y5C A;  3P4R B;  2WU2 B;  4F8C B;  1JRP A;  3WAP A;  3AED B;  2AL6 A;  3IXS A;  4O1N A;  2LVQ A;  1PGA A;  4XDD A;  2MSE D;  3DWM A;  1IUE A;  1FCL A;  4GMV A;  3BK2 A;  1NYR A;  2V9H A;  3NHE B;  4W9G A;  2KX0 A;  5IAA C;  3TL5 A;  2CKH B;  4ZHO A;  1LM8 B;  2HD5 B;  1N6Z A;  2BYT A;  2YVC A;  4OW0 A;  2LD9 A;  5HHD G;  4A9A A;  2K6Q A;  2DYM A;  5LLI A;  3ALB A;  3HUI A;  3V62 A;  2PKO A;  3QAR A;  1Z5S B;  3GE8 C;  1J7C A;  4IC7 B;  3H9D A;  3NVY A;  4HXD A;  1K51 A;  3W1S A;  1K53 A;  3ZJV A;  3GZN B;  1PUT A;  1FFV A;  4GB9 A;  3Q8F A;  3MFG A;  2W54 A;  3BII D;  3NZU A;  4TSS A;  4CHK A;  2NPT A;  4MEM A;  2LEK A;  1ZE3 D;  1SIF A;  3J9C A;  1RFA A;  2KFK A;  3W5V B;  3VTU A;  3P63 A;  1T0Q C;  4ARC A;  4LCD E;  1XEE A;  2R61 A;  1R7S A;  4NZL B;  4C4V A;  2KDM A;  1WGY A;  3KUD B;  2KMC A;  2KOX A;  3AE3 B;  3GE3 C;  2XNA C;  1EU4 A;  4P1C C;  3L08 A;  2V4I B;  1TS3 A;  4GDL B;  1V1P B;  2MBB B;  1TY0 A;  2LWP A;  1IPG A;  4W9K A;  3AEG B;  3PRM B;  4XC2 A;  5BYQ A;  3ZKJ C;  3MC8 A;  5IOI A;  2DYO A;  2TSS A;  4MSQ B;  3C0R B;  3JSV B;  3TJP A;  1C1Y B;  2MH7 A;  3AEB B;  1E8W A;  5E6J A;  4XWW A;  3NS1 A;  3VRB B;  1WF9 A;  1I42 A;  3AB5 A;  3ZLZ A;  1ACC A;  5TR5 A;  4NNJ B;  2QMT A;  1EM7 A;  2N9X A;  2MWS B;  1FRD A;  1KLU D;  2EKE C;  1SXT A;  1V8C A;  2KVZ A;  1L4Z B;  1RWS A;  1YMH E;  4RF0 A;  3RUL A;  1JQ4 A;  5JZE B;  1YIW A;  3PGE A;  1NEK B;  1GB4 A;  2V1Y A;  1E7U A;  4MSM B;  3SHQ A;  2WXL A;  4LNN A;  4XDC A;  2HE7 A;  4NJ7 A;  1I35 A;  1JWA D;  2HTH A;  1UBI A;  1AN8 A;  1WWT A;  3RFZ B;  3AE1 B;  3QX1 A;  5D3D A;  5IN7 A;  3M95 A;  1YN5 A;  1T0R C;  3URY A;  3WCQ A;  2G4S A;  4LDT B;  1KLV A;  1VZ8 A;  3AE9 B;  3ZYY X;  2I2Y A;  2IO3 B;  1F2R I;  2D2Q A;  5AEK B;  2VZK D;  2V0G A;  1ZGU B;  5DPT A;  2KWU B;  3AEC B;  5D3I B;  2L52 A;  3T9L A;  1WZ0 A;  2IO1 B;  4L1B A;  5BMG A;  1YN4 A;  4IW0 A;  2KWV B;  3NJT A;  1YJI A;  4PK1 A;  4HLE A;  4RF1 A;  3NS8 A;  2BGF A;  4D2K A;  4A6Q A;  1M4V A;  1GNU A;  3PZ8 A;  2C7N B;  2JZ3 B;  1ZXI A;  4IWQ A;  3PTF C;  2WDT B;  2WXH A;  1OTR B;  4BKS A;  3V05 A;  2N7E A;  3AE8 B;  1A70 A;  4FN2 A;  1NEN B;  1KOT A;  2BKR B;  2GBN A;  2RR9 A;  2W3S A;  2OOB B;  5AUK A;  2Z0E B;  1VZ6 A;  3X0W A;  4GXB A;  2WXK A;  3Q14 C;  2FNJ B;  4IUM B;  1CK1 A;  2A4Z A;  1Y8R C;  4GDL A;  5KHO A;  1SE9 A;  4WAF A;  4RMA A;  5CHV C;  3MHZ A;  3AEA B;  2IGH A;  4YSZ B;  2O2V B;  3APD A;  4II3 B;  1SE2 A;  1DYQ A;  3QAQ A;  3H6N A;  3L4P A;  4HDQ A;  4RM8 A;  4ANV A;  2WXQ A;  1VCB A;  3KQ4 A;  3Q6B A;  4TKN A;  2WDV B;  2VH1 A;  1WXQ A;  4REZ A;  5LNK 1;  2LHE A;  2E3T A;  3L0W B;  4DHZ B;  3CIR B;  1VLB A;  2PJH A;  4HWI B;  2KTR A;  1KF6 B;  5D94 A;  1HQR D;  3A9J B;  3VUX A;  3I63 C;  3ZRC A;  2LAS A;  3P4S B;  5HKH A;  4JLC A;  1L5P A;  2GBR A;  2I38 A;  4LLG M;  4RGO S;  2L00 B;  3VQI A;  4GLS C;  2JXT A;  1EWY C;  2GLS A;  3B08 A;  3QC8 B;  1XT9 B;  4MH8 A;  2GBK A;  2WDR B;  2JY6 A;  4TQ0 A;  1ZXH A;  1WY8 A;  1L2N A;  1K52 A;  3MHS D;  1BT0 A;  1WSP A;  2N7D A;  1HZ6 A;  1R4N B;  1TKE A;  1V81 A;  2ZPN A;  3KW5 B;  2W9N A;  1RRB A;  3RN9 C;  2MJE A;  4ASW C;  2IO0 B;  5DPW A;  2PPH A;  4HEA 1;  5G2N A;  1TZO A;  2B76 B;  3MC9 A;  3NUH B;  2BBC A;  2LJ5 A;  4K3C A;  4EUT A;  3TBL D;  1QOA A;  3A33 B;  1NBF C;  3RNF C;  1NYQ A;  3DPD A;  1E7P B;  3VDZ A;  2KDI A;  2MRP A;  1N62 A;  2PTL A;  5FR6 A;  3L16 A;  3KH0 A;  1QOF A;  2L83 A;  2HTM E;  2UU7 A;  2WXJ A;  1MPE A;  1T6B X;  5EE1 A;  3RUI B;  1IGC A;  1C3T A;  2CHW A;  3IBE A;  2IY1 B;  2IYD B;  1Q10 A;  4MGI E;  2WDQ B;  3DHG C;  1OFF A;  2JUO A;  2SAK A;  3TSS A;  3RMK C;  1WGD A;  2LGY A;  3HRD D;  3T3N A;  4MGK E;  2M0X A;  1D5X C;  2L76 A;  2KTF A;  1R4M B;  4GU2 A;  1GJZ A;  2PMV A;  1I4H A;  3KYC D;  2I1K A;  2J53 A;  3MC0 B;  4C7Y A;  5EE0 A;  3PSE B;  1WH3 A;  4IG7 B;  1E9M A;  4WJO A;  2WXM A;  3ENE A;  3WAL A;  3IT6 B;  2LZ6 A;  4XYC A;  3VR9 B;  2FCN A;  2L05 A;  3DVN V;  4FUL A;  2MP2 A;  2XK5 B;  2DLB A;  2O2V A;  4KGS A;  3WAN A;  3AE6 B;  2FCM A;  4RCO A;  5CX3 A;  4QAY A;  2N0S B;  1C4P A;  4KKI A;  4NAW B;  1KFY B;  1C76 A;  4F7Z A;  2L1A A;  3TEY A;  2YLM A;  2FID A;  3QCA A;  1SE3 A;  1NI2 A;  1T3Q A;  3EFU A;  4BZA A;  1GG3 A;  1MG4 A;  4WJQ A;  4OVV A;  2ZZP B;  3OAW A;  4ARI A;  2O6V D;  2H88 B;  3ZDM C;  3O65 B;  2LRU A;  4C00 A;  2BWF A;  3DOW A;  4BOS C;  3H7P A;  2LRW A;  3NG0 A;  1HE8 A;  2DZJ A;  1TKY A;  2LHD A;  3DBR I;  3HK0 A;  2KZR A;  4LDT D;  2JYT A;  2NCN A;  1FNV A;  1GC6 A;  1TTN A;  2JRH A;  3I5J C;  4TQ1 A;  4MAC A;  1I4X A;  2K1F A;  1UGJ A;  2MBO A;  4JX1 C;  1Q5W B;  2JZP A;  2MX2 A;  4AS1 A;  3VAW A;  5J18 A;  2DZI A;  2D3G A;  1SJH D;  2MJD A;  4KSL C;  5EDS A;  5J17 A;  3LB8 C;  3GOE A;  4EZL A;  2V3S A;  3EA6 A;  1WFY A;  3QIJ A;  4L2Y A;  2WNM A;  1KH0 A;  1WZ3 A;  4LJO B;  3AN1 A;  2FUH B;  2LXC A;  3QK0 A;  2KAJ A;  1P1A A;  4YL8 A;  3V61 A;  2LVP A;  1TGZ B;  4G3X B;  4NQK E;  4WWN A;  4IDI A;  4B9K A;  4FJV B;  3H7S A;  3ZJU A;  5DPR A;  5AZH A;  2R2Q A;  2ZNV B;  4G11 A;  3BYT B;  2Y5P A;  1IP9 A;  1VJK A;  2J52 A;  3RD2 A;  1MG8 A;  1T5X D;  3TMP B;  2UYZ B;  2KLC A;  4K7W A;  1SJE D;  3UIN B;  2SEB D;  5BYS A;  5GMV A;  3TEX A;  3VHT C;  1MHH E;  1L0V B;  3IFW B;  4HJG E;  2WLB A;  3GZN I;  1FXI A;  1D4B A;  3ZQ4 A;  1OQQ A;  4HKZ E;  1WJN A;  4KVG B;  1WGR A;  3DBS A;  1I4Q A;  1ZOY B;  1E90 A;  2LUM A;  2JX5 A;  1YQB A;  3KUC B;  2DYB A;  2JYE A;  5G5H A;  5KHQ A;  5JH5 C;  3IAM 1;  4FJY A;  2N9P C;  4ZRJ A;  1QT9 A;  4FA6 A;  1I7H A;  4JPS A;  1WXV A;  2N9E B;  1EF1 A;  2N9K A;  2RDB C;  3W9C B;  2WXR A;  4BKS D;  4J6I A;  3KVF B;  4KV2 A;  4AP4 C;  4GIV A;  3NY5 A;  3Q8C A;  2QIE B;  2M17 A;  3ZW3 A;  3PZ7 A;  3ZDT A;  4DXA B;  3SD5 A;  4OZB A;  4PYZ A;  2KQ7 A;  1UWM A;  2IGD A;  4HCP B;  4ITK A;  4YSX B;  1XCT L;  5L95 C;  3I57 A;  2MJ3 A;  1STE A;  2RSU A;  1V9J A;  2J42 A;  4JE3 B;  3B2F A;  4M00 A;  3RNA C;  4G0N B;  4I6L B;  4YTM B;  5AZF A;  2K6D B;  2BW2 A;  2J0K A;  4N59 A;  2K25 A;  2K5P A;  3LDZ E;  3RI7 C;  2MA9 B;  4JWU C;  2FE8 A;  3CST A;  2E6X A;  2L3Z A;  3Q3M C;  1VDV A;  4XZ4 A;  3U8Z A;  4HK2 A;  2ZNV C;  1QF6 A;  5DCN A;  2DNF A;  2AQ3 B;  3VVW B;  1XLQ A;  2BWE S;  4HRS A;  3W1Y A;  2VRR B;  2KQ4 X;  3K9O B;  4DHZ E;  4KGR A;  2N4F A;  2LVO A;  1GC7 A;  4WAA A;  3SFE B;  1MFW A;  3VH4 B;  3GP7 A;  3M3J A;  2ICI A;  4IM0 A;  1Q1O A;  2G4D B;  1WJ6 A;  3ZIM A;  4W9I A;  4TUU A;  2C7H A;  1SEB D;  1E5W A;  1CZP A;  3PRP B;  4IWO A;  4JWS C;  4KKJ A;  4OZC A;  1ZPS A;  1NVI D;  2M8S A;  1V1O A;  2W3R A;  5E6O A;  1ZDV A;  4WWO A;  5EE3 A;  2KT7 A;  2M0A A;  2HDE A;  3VXW A;  3ZXR A;  2LGI A;  3AE2 B;  3A9K B;  1KM7 A;  1DGJ A;  2ZCC A;  3M62 B;  5C1Z A;  4AQ7 A;  2QSD A;  4DDG D;  4WJP A;  5H92 C;  5IKC M;  3ONS A;  1Q0W B;  3O13 A;  2BT6 A;  2WXF A;  3AE5 B;  1D6E C;  2D07 B;  3Q69 A;  1ESF A;  2BPS A;  4P6V F;  3RT3 B;  1C79 A;  4E71 A;  3RNG C;  2D5G A;  1XLN A;  1J19 A;  4II2 B;  2L8J A;  3ZVV A;  3CSF A;  1I4P A;  4I6N B;  4IKG A;  2M1M A;  2C9W B;  3ETR A;  3AEF B;  2KFK B;  2QIL A;  1VR9 A;  1RM6 C;  2WU5 B;  4YT0 B;  3LXF A;  3U4E G;  4BOZ B;  3Q8A A;  3JSV A;  4BKT A;  2MBQ A;  2WXP A;  1V6E A;  3SFD B;  2OHF A;  1N60 A;  4S17 A;  3C19 A;  3IG3 A;  3OWE B;  2C5L C;  1N5X A;  2K8H A;  3AE7 B;  4B6W A;  2GBJ A;  3NOB A;  2OJW A;  4BVU C;  1H8C A;  2ZEQ A;  1OEY A;  3E9S A;  2M56 B;  3VTW A;  4MT5 A;  1FXT B;  3BK1 A;  3L13 A;  2PE9 A;  3R2I A;  1E8X A;  4MGZ E;  1P0R A;  2I1J A;  1TZ1 A;  1HZ5 A;  1SE4 A;  3M63 B;  3GB1 A;  3VUW A;  4R3D A;  2HJ1 A;  1C77 A;  2KVR A;  2L0T A;  4F1S A;  4BBN F;  3CMM B;  3QQ8 B;  1SBB B;  1YN3 A;  4KSK C;  3N1Y C;  1J0G A;  1FMA D;  3NZS A;  2NBW B;  4DBG A;  2NBU A;  4AWJ A;  3PRE A;  1MI0 A;  1XCQ L;  4ANU A;  4AJW A;  3N3K B;  1OEY J;  2RPQ A;  1A5R A;  2BVC A;  3UQB A;  4S0R A;  3A1Q B;  3DVG Y;  1QIL A;  3QWZ B;  1JCK B;  4W9E A;  2GOW A;  5CHF A;  3V6C B;  4X57 B;  1ROE A;  3DBH I;  3A4R A;  4DXG A;  3C8Y A;  1L4D B;  4FLH A;  1SIJ A;  3MJ5 A;  1WRD B;  1K8R B;  3PLV A;  2DAJ A;  2MCN B;  2KYW A;  1L7Y A;  2BF8 B;  4P7I A;  2CU1 A;  1HTQ A;  3PHX B;  2KWD A;  4FHK A;  4P16 A;  1IBX A;  1WIA A;  2RGF A;  2V3P A;  2INC C;  4HDO A;  2GMI C;  4KDL B;  2KO3 A;  2MW5 A;  3KWL A;  4EZJ A;  4ZRK A;  1FRR A;  3PT2 B;  2REX A;  1P3Q U;  3ZTD A;  1AWD A;  3DBH B;  1JRU A;  2H89 B;  4W9J A;  3SDL C;  2IY0 B;  3W5U B;  4DQO C;  1PFD A;  2FUG 1;  4WQM A;  4MM3 B;  1WR6 E;  4BBN C;  1JWM D;  3Q3J A;  3HIZ A;  4A8X C;  4AOF A;  4URK A;  1YD8 U;  3N20 C;  3N30 A;  5H8Y E;  5DPS A;  3B1L X;  2MQJ A;  5E6N A;  4NJ6 A;  4LNO A;  3V3X A;  2K8B A;  3HVD A;  3NZ3 A;  2PLP A;  3FKY A;  2DBY A;  2XEW A;  1P98 A;  3DBL B;  2EMS A;  3SU8 X;  2INP E;  4GOC A;  2J4X A;  4C56 C;  3WAO A;  3HHM A;  2KC2 A;  1ZW7 A;  2PEA A;  3AEE B;  3EEC A;  3KWV A;  1EWC A;  4LJP B;  3A4S C;  4ZHP A;  1WYW B;  4EKU A;  3Q3F A;  4PYU A;  3R2T A;  2J7Q B;  2G9H D;  3CF6 E;  2CS4 A;  1WGH A;  2M4N A;  3MP9 A;  4ZRI A;  4IM2 A;  1FNU A;  5C3J B;  4LTU A;  4ZOH C;  3P4Q B;  2MP2 B;  3N1Z C;  4FXC A;  4NAM A;  2R2O A;  2K22 A;  2LI5 A;  3P42 A;  4MH0 E;  2NR2 A;  1JML A;  3A9J A;  4JIO U;  3EC8 A;  5L83 A;  1E7V A;  5T8I A;  2ZW0 A;  1MHX A;  1WM2 A;  3RNC C;  2LGD A;  1ISN A;  1L0X B;  1ZP0 B;  2V4L A;  5JXV A;  2BB6 A;  1V86 A;  2XBB C;  4CYE A;  3HM6 X;  3KUZ A;  5EE9 A;  1VZ7 A;  3PZD A;  2W82 A;  4XE0 A;  1DOY A;  5HFY A;  1QKZ A;  2IPK D;  4N6E B;  4IWP A;  1D5M C;  1J7B A;  2J0M A;  1HTO A;  2B3A A;  4RH6 A;  2LJI A;  2PIA A;  4JQW C;  1FO4 A;  4A55 A;  4MDK E;  3GS2 A;  4KIK A;  4DHJ B;  1FFU A;  1WI0 A;  2L0F A;  3QJZ A;  3TCA A;  4RM9 A;  2FAZ A;  4HCN B;  1OQR A;  2AEH A;  4YSY B;  4KGT A;  1IYF A;  2RD0 A;  2DAF A;  2D10 A;  2DZK A;  1E0Z A;  3BWU D;  4CO7 A;  4WJN A;  1GOZ A;  1T0S C;  1S1Q B;  3RZW C;  2IJ0 A;  4HKQ A;  3AI5 A;  2JZZ A;  1B9R A;  3ZNZ B;  3BVG A;  4NQL B;  2PE6 B;  3ZNH B;  1EU3 A;  1LQB A;  1WX7 A;  3TUO A;  3L17 A;  4K7U A;  2KDF B;  3TEW A;  1SSN A;  1HXY D;  3DHI C;  3B9J A;  3RPF C;  2VZK B;  3BYY B;  3WIM A;  4WIP A;  4HJK A;  4ANW A;  4A3P A;  5CHW A;  3IT4 B;  1NI3 A;  2CHX A;  3VFK A;  1ET6 A;  4GSW A;  3N1X C;  5FR3 A;  3P1M A;  2ONQ A;  3AH7 A;  2CU3 A;  1XF5 L;  3HM3 A;  4K81 A;  3PPA A;  3FC4 A;  2IZV B;  1E8Y A;  1F9J A;  1UH6 A;  4ZYS A;  1KTK A;  3DDC B;  2G1E A;  2KDB A;  4KZC A;  3I3T B;  1QZE A;  4NAW A;  2AYO B;  1TS4 A;  3AMZ A;  4M0W B;  2JPH A;  1VRA B;  1YQ4 B;  3BVM A;  2G45 B;  4MJS A;  2QC8 A;  3APF A;  1WJ4 A;  4C80 A;  2IDY A;  1CQV A;  3UIP B;  1QLB B;  3NRZ A;  4A3O A;  1YNT E;  2WX0 A;  1TS5 A;  4PT5 A;  2RDG A;  5E6P A;  2NPT B;  1JRO A;  2NTT A;  3EGR A;  1UUP A;  1WE7 A;  2ON8 A;  3R66 C;  2AWT A;  2C60 A;  4MGY E;  3RNB C;  4C4V B;  1TY2 A;  1WGK A;  5CTR C;  2W55 A;  1BUI C;  4K3B A;  1L6U A;  2JVC A;  2N1W A;  3RZF A;  1F1H A;  1H4R A;  3KYD D;  1TT5 B;  4KIK B;  3AUL A;  2EEL A;  3DCG A;  4USA A;  1EF5 A;  1N61 A;  2NBV B;  3CWI A;  2WP9 B;  2OJR A;  3OJ4 B;  4OHJ A;  3K9P B;  1UWX A;  2WXI A;  2WWZ A;  3AU4 A;  4KDI C;  2KXJ A;  2OED A;  1D5Z C;  4DXF A;  4J3O D;  3ZJT A;  1MJD A;  1WGG A;  1V49 A;  3BVZ A;  1YX5 B;  1GAQ B;  2N1V A;  1UGM A;  4FHJ A;  3AE4 B;  4HRO A;  3PLU A;  2D3C A;  3DVG X;  3ZXV A;  1UZX B;  2FIF A;  2ZCB A;  3WAM A;  1E6E B;  1M94 A;  5TSS A;  4I6P A;  1N5W A;  4TMA B;  1SGH A;  2VH2 A;  4ZRP A;  1BML C;  1RLF A;  2QCZ A;  1UNS A;  4RGM A;  3TEZ A;  3Q2A C;  1JAL A;  1UF0 A;  1ZUD 2;  3I9V 1;  4G50 A;  2KWC A;  3ABV B;  2GRI A;  3PRZ A;  4BAX A;  3A9K A;  4UDU C;  3ML8 A;  2O6V A;  2C7M B;  1P9D U;  4Q2J A;  2KLG A;  2K39 A;  3R3M A;  1YX6 B;  2BKF A;  4YXD B;  4H2A A;  5LXI B;  4E74 A;  2KKC A;  2KX3 A;  2NVU I;  2FBW B;  3OLM D;  4RGT A;  1FM0 D;  2RDH A;  4LK0 M;  1V1P A;  3SEB A;  4MJS B;  4RGN A;  3IAS 1;  1E10 A;  2ZVN A;  3R7Q A;  2KAC A;  2CJO A;  2RPV A;  2FCQ A;  4B0M A;  1P7E A;  5LXH A;  5D2M B;  4WUR A;  1TJE A;  4ZDV A;  3R8B A;  5JHA A;  1DOX A;  2JXX A;  1XXG A;  3W1S C;  1RYJ A;  2KNB A;  4ICV A;  5BYR A;  3V6E B;  2CHZ A;  2BS2 B;  3VTV A;  1PQS A;  2J0J A;  1WJU A;  4A20 A;  2ACZ B;  3N32 A;  4DWF A;  1TKG A;  4M01 A;  4GN1 A;  4PS8 A;  3B0A A;  5BO4 B;  1MVK A;  4ZRQ A;  2IGG A;  4ZYN A;  1P7F A;  3DHH C;  2QEJ C;  3UQA A;  4M02 A;  2CJN A;  5GXG B;  2GBM A;  3UIO B;  4EZK A;  3P4P B;  2AX5 A;  1AW7 A;  5I4D A;  4GDK A;  2UWQ A;  3VUY A;  4AUQ C;  4B0E A;  3X23 A;  2FCS A;  2L7R A;  2KMM A;  1XQQ A;  1F2R C;  3Q3O C;  5HG2 A;  2ZJD A;  4FJZ A;  1F52 A;  2NS5 A;  1F77 A;  3PHW B;  4OZA A;  4US8 A;  4NPN A;  4TV3 A;  2BS4 B;  5BMI A;  4FBJ B;  3AXC A;  4KX6 B;  3LJ3 A;  1R4N I;  2KFJ A;  2JSV X;  1L0Y B;  1N63 A;  2KTR B;  4IM3 A;  5J2R A;  4XGA B;  2INN E;  1FXA A;  4RFB A;  2Z8L A;  4IOI E;  4K7S A;  4M8N A;  3ZO5 B;  3IHP C;  3JVZ X;  3NVW A;  2MBH A;  1JWU D;  5C23 A;  2BQQ A;  1TS2 A;  1J7A A;  1PGX A;  1TIF A;  3H1U A;  5IO9 A;  1VD2 A;  3ZTC A;  3ML9 A;  2NTS A;  3ZNG C;  2DHZ A;  1C4A A;  1WMH A;  5D7G A;  3R7R A;  3DBL I;  4BKG A;  2O6V B;  1EO6 A;  4EEW A;  4EE2 A;  2LMC A;  2ZVO A;  4W9C A;  3BIN A;  5JHB A;  4YTP B;  1I4R A;  3UF8 A;  3U2S C;  1WXM A;  4WQO B;  2WS3 B;  1R4M I;  1WYG A;  4MM3 A;  1OGW A;  4OVZ A;  1V80 A;  3EHV A;  1HEZ E;  2G3Q B;  2JF5 A;  4N9F 4;  2K3U A;  1WXS A;  4NY0 A;  1YQ3 B;  1YJJ A;  1Y56 A;  1FEH A;  4EOY A;  4K1R B;  1QOB A;  5FK9 C;  1K50 A;  2BB5 A;  1V97 A;  4E3C A;  3H8H A;  2KJR A;  1FNW A;  1XO3 A;  1PGB A;  5IA7 A;  2PW9 A;  2KD0 A;  4XX5 A;  3BZD B;  5HI1 A;  1L6V A;  3AM9 A;  1U4A A;  2LFI A;  1B1Z A;  1C78 A;  1G6J A;  1LGR A;  3EFC A;  1XD3 B;  2EMT A;  4LNK A;  1LO5 D;  3UI3 A;  4W9D A;  3FAH A;  1KJT A;  3APC A;  1ZKH A;  1GB1 A;  1XLO A;  1BXT A;  2BYE A;  3FIL B;  1UD7 A;  3OG5 A;  1QQR A;  4W9F A;  3LYY A;  2WYQ A;  2L32 A;  1FIQ A;  2XK5 A;  3TIX A;  4GDK B; 
#chains in the Genus database with same CATH homology
 2Z0D B;  4HPL B;  4HLE A;  3NS8 A;  4HCP B;  3L17 A;  4K7U A;  2KDF B;  2BGF A;  2IO2 B;  1GNU A;  2MLB A;  3BY4 B;  2C7N B;  5L95 C;  2JZ3 B;  3T8M A;  4HVB A;  2JWZ A;  3WIM A;  4IWQ A;  4HJK A;  3PTF C;  2WDT B;  2RSU A;  1V9J A;  4ANW A;  4A3P A;  5CHW A;  1OTR B;  4BKS A;  2CHX A;  2N7E A;  3VFK A;  3A1Q A;  4GSW A;  4G0N B;  4I6L B;  4FN2 A;  1KOT A;  5AZF A;  2K6D B;  3HM3 A;  2KN5 A;  2J0K A;  2K25 A;  3LDZ E;  2BKR B;  3ECI A;  2MA9 B;  2GBN A;  3PPA A;  4K81 A;  3CST A;  2RR9 A;  2L3Z A;  2IZV B;  2OOB B;  2LXA A;  1E8Y A;  1Z2M A;  1F9J A;  1EUV B;  1UH6 A;  1V5T A;  1V2Y A;  2KDE B;  2Z0E B;  2MBE A;  1WR1 A;  1WE6 A;  4XZ4 A;  3U8Z A;  4HK2 A;  3X0W A;  2ZNV C;  4GXB A;  2FNJ B;  3DDC B;  5G55 A;  2HJ8 A;  4IUM B;  5DCN A;  2KDB A;  3L10 B;  3H7P B;  3I3T B;  4KZC A;  4WWP A;  3VVW B;  4FAD A;  2BWE S;  1QZE A;  2A4Z A;  1Y8R C;  3QHT A;  4NAW A;  1TBE A;  2VRR B;  4KZ0 A;  3W1Y A;  2K8C A;  2AYO B;  2ASQ A;  3L54 A;  3K9O B;  3PV1 A;  4GDL A;  4DHZ E;  5KHO A;  2N4F A;  2LVO A;  1GC7 A;  1YJ1 A;  3MJW A;  4M0W B;  4WAA A;  4PS7 A;  1SE9 A;  1D3Z A;  3VH4 B;  4RMA A;  3M3J A;  2JPH A;  4IM0 A;  1Q1O A;  5CHV C;  2IBI B;  2G4D B;  1WJ6 A;  3ZIM A;  4W9I A;  2G45 B;  2BYF A;  4TUU A;  2C7H A;  2O2V B;  3APD A;  4II3 B;  1E5W A;  4MJS A;  3PVL A;  1WMH B;  2Y5B B;  1AAR A;  3APF A;  3PRP B;  4IWO A;  1WJ4 A;  3QAQ A;  3H6N A;  4HDQ A;  1RAX A;  4RM8 A;  3RCZ A;  3UIP B;  2M8S A;  4DK5 A;  5E6O A;  4ANV A;  4A3O A;  1VCB A;  4WWO A;  4TKN A;  2WX0 A;  1LFD A;  3VXW A;  2D11 A;  4DDI D;  2BYV E;  3L0W B;  1T0Y A;  3A9K B;  5E6P A;  4DHZ B;  1KM7 A;  2KMA A;  4JL9 A;  3DVN U;  2NPT B;  2ZCC A;  3UGB B;  2PJH A;  5D6J B;  3V60 A;  3M62 B;  4HWI B;  2KTR A;  5C1Z A;  4B95 A;  1GUA B;  5D94 A;  1WE7 A;  2KQS A;  3R66 C;  3A9J B;  5AZG A;  3QA8 A;  2AL3 A;  2AWT A;  3VUX A;  4W9H A;  2C60 A;  3DQV A;  3ZRC A;  4DDG D;  2LAS A;  4MGY E;  4WJP A;  5HKH A;  4JLC A;  5CTR C;  2GBR A;  3ONS A;  1Q0W B;  2L00 B;  3VQI A;  3PS6 A;  3ZRF A;  4AJY B;  2KHW B;  3B08 A;  3QC8 B;  1XT9 B;  2D07 B;  2JVC A;  3ZUN A;  2GBK A;  2N1W A;  2JY6 A;  3RZF A;  4TQ0 A;  1H4R A;  3KYD D;  3OJ3 A;  1J8C A;  4KIK B;  3AUL A;  3DCG A;  1WY8 A;  2BPS A;  1EF5 A;  1L2N A;  3RT3 B;  3MHS D;  2NBV B;  4E71 A;  1BT0 A;  2N7D A;  1V81 A;  2DZM A;  2ZPN A;  2OJR A;  3KW5 B;  2W9N A;  4PS3 A;  3OJ4 B;  1RRB A;  1J19 A;  4II2 B;  2L8J A;  4ASW C;  3ZVV A;  2IO0 B;  3CSF A;  3K9P B;  5DPW A;  2KJ6 A;  4I6N B;  4JGH B;  3D32 A;  2M1M A;  2C9W B;  2PPH A;  2WWZ A;  3AU4 A;  2JT4 B;  4MEL A;  5G2N A;  3ZNI D;  2ZPY A;  2JRI B;  4KDI C;  1S3S G;  2KFK B;  1UEL A;  2KXJ A;  1WX8 A;  3RYT A;  1WGG A;  1V49 A;  4BOZ B;  1YX5 B;  2LJ5 A;  2Z59 B;  4EUT A;  3TBL D;  3JSV A;  2WX1 A;  4BKT A;  3A33 B;  2MBQ A;  1NBF C;  2N1V A;  1UGM A;  1V6E A;  4EFO A;  4FHJ A;  3DPD A;  3IG3 A;  3PLU A;  2C5L C;  3VDZ A;  2K8H A;  2KDI A;  4B6W A;  2MRP A;  2GBJ A;  3DVG X;  3NOB A;  4BVU C;  1H8C A;  2ZEQ A;  1OEY A;  2LGX A;  5FR6 A;  1UZX B;  2DX5 B;  2FIF A;  3VTW A;  3JW0 X;  2ZCB A;  3L16 A;  1FXT B;  1UBQ A;  2QHO A;  3KH0 A;  3WAM A;  1M94 A;  1WXA A;  3L13 A;  3IVF A;  2PE9 A;  1E8X A;  4I6P A;  4MGZ E;  2DEN B;  1P0R A;  1WM3 A;  1SGH A;  2I1J A;  1TZ1 A;  1RLF A;  3M63 B;  2KC1 A;  3VUW A;  3RUI B;  2KVR A;  2L0T A;  3MTN B;  4W9L A;  1C3T A;  2CHW A;  3IBE A;  4F1S A;  2IY1 B;  2IYD B;  4MGI E;  4BBN F;  2JUO A;  3CMM B;  2A5U A;  3QQ8 B;  1WGD A;  4DHJ D;  2LGY A;  4G50 A;  3WA0 A;  4MGK E;  2KWC A;  1NDD A;  1OQY A;  2M0X A;  1X1M A;  4KSK C;  2L76 A;  2KAN A;  3PRZ A;  2KTF A;  1J0G A;  2KJH B;  4HPM B;  3NZS A;  2NBW B;  4DBG A;  2CR5 A;  2NBU A;  3A9K A;  4GU2 A;  1GJZ A;  4AWJ A;  3ML8 A;  2O6V A;  3PRE A;  4OVU A;  4ANU A;  2C7M B;  1P9D U;  4AJW A;  2KLG A;  3AU5 A;  3N3K B;  1OEY J;  2K39 A;  2RPQ A;  3KYC D;  2I1K A;  1A5R A;  3R3M A;  3S2A A;  3UQB A;  3A1Q B;  1YX6 B;  2BKF A;  3DVG Y;  3PSE B;  3QWZ B;  1WX9 A;  1WH3 A;  4IG7 B;  4W9E A;  5LXI B;  2GOW A;  2LUE A;  4ANX A;  4WJO A;  5CHF A;  2KK8 A;  3ENE A;  4GGQ A;  2KKC A;  3V6C B;  4E74 A;  4X57 B;  3WAL A;  2KX3 A;  2LZ6 A;  3U7D A;  3DBH I;  3A4R A;  2FCN A;  2NVU I;  2L05 A;  3OLM D;  3DVN V;  4FUL A;  2MP2 A;  1V5O A;  2XK5 B;  2O2V A;  4MJS B;  3WAN A;  4FLH A;  3JYU A;  2ZVN A;  2FCM A;  3R7Q A;  4ICU A;  1WRD B;  2FCQ A;  1K8R B;  3PLV A;  3U30 A;  5CX3 A;  3P2B A;  3VH3 B;  2DAJ A;  2MCN B;  4NAW B;  5LXH A;  4F7Z A;  1L7Y A;  5D2M B;  2BF8 B;  4P7I A;  2CU1 A;  4ZDV A;  3PHX B;  1LXD A;  1CMX B;  5JHA A;  4BFR A;  2JXX A;  4M8M A;  1E8Z A;  2YLM A;  4FHK A;  2FID A;  3QCA A;  3W1S C;  1WIA A;  2KNB A;  2RGF A;  4HDO A;  4ICV A;  2GMI C;  4KDL B;  2KO3 A;  3V6E B;  1NI2 A;  2CHZ A;  2MW5 A;  3EFU A;  4F8C B;  4EZJ A;  4ZRK A;  3WAP A;  1GG3 A;  2AL6 A;  3PT2 B;  2LVQ A;  3VTV A;  4WJQ A;  2REX A;  4OVV A;  1PQS A;  2J0J A;  1WJU A;  1P3Q U;  2MSE D;  2ZZP B;  3ZTD A;  4A20 A;  3N32 A;  4DWF A;  1JRU A;  3OAW A;  4W9J A;  3SDL C;  2O6V D;  2IY0 B;  4GMV A;  4GN1 A;  3NHE B;  4W9G A;  4PS8 A;  3B0A A;  5BO4 B;  3ZDM C;  1WR6 E;  3O65 B;  2LRU A;  4BBN C;  2KX0 A;  5IAA C;  3TL5 A;  3Q3J A;  2CKH B;  2BWF A;  4ZYN A;  3DOW A;  3HIZ A;  4AOF A;  4BOS C;  4URK A;  1YD8 U;  3H7P A;  1LM8 B;  2LRW A;  3N30 A;  1HE8 A;  2HD5 B;  2DZJ A;  3UQA A;  2YVC A;  2GBM A;  2LD9 A;  3DBR I;  3HK0 A;  5DPS A;  2KZR A;  4LDT D;  2K6Q A;  2MQJ A;  2NCN A;  3B1L X;  1GC6 A;  1TTN A;  2DYM A;  4NJ6 A;  2JRH A;  5E6N A;  3UIO B;  4TQ1 A;  5LLI A;  3ALB A;  4EZK A;  3V62 A;  2K8B A;  3QAR A;  2UWQ A;  1Z5S B;  4GDK A;  3VUY A;  4AUQ C;  4IC7 B;  3X23 A;  2K1F A;  2FCS A;  3H9D A;  2L7R A;  2MBO A;  4HXD A;  1XQQ A;  1Q5W B;  2MX2 A;  2XEW A;  3VAW A;  2ZJD A;  4FJZ A;  5J18 A;  2DZI A;  1P98 A;  3W1S A;  2NS5 A;  2D3G A;  3PHW B;  2EMS A;  4KSL C;  3SU8 X;  4NPN A;  4TV3 A;  4GOC A;  3WAO A;  4FBJ B;  5EDS A;  3AXC A;  3HHM A;  3LJ3 A;  5J17 A;  1R4N I;  2KC2 A;  1ZW7 A;  2KFJ A;  2PEA A;  4GB9 A;  2KTR B;  3GOE A;  4IM3 A;  3NZU A;  5J2R A;  3EEC A;  4CHK A;  4LJP B;  4K7S A;  2NPT A;  4MEM A;  4M8N A;  3ZO5 B;  4EZL A;  2V3S A;  3A4S C;  3IHP C;  3JVZ X;  1SIF A;  1RFA A;  2KFK A;  1WFY A;  3VTU A;  3QIJ A;  1WYW B;  4EKU A;  3Q3F A;  4PYU A;  1WZ3 A;  4LCD E;  4LJO B;  2FUH B;  2LXC A;  3QK0 A;  2J7Q B;  1P1A A;  1WGY A;  3CF6 E;  2CS4 A;  1WGH A;  2MBH A;  2M4N A;  4ZRI A;  5C23 A;  4YL8 A;  3V61 A;  2LVP A;  1TGZ B;  3KUD B;  4G3X B;  2KMC A;  4NQK E;  4IM2 A;  2KOX A;  4WWN A;  4B9K A;  4FJV B;  3H7S A;  3L08 A;  3H1U A;  5DPR A;  2MP2 B;  4GDL B;  5AZH A;  2R2Q A;  2MBB B;  1VD2 A;  2ZNV B;  4G11 A;  3ZTC A;  2LWP A;  1IPG A;  2R2O A;  3ML9 A;  1IP9 A;  4W9K A;  3PRM B;  3RD2 A;  1MG8 A;  2LI5 A;  4XC2 A;  3ZKJ C;  4MH0 E;  2NR2 A;  3TMP B;  3ZNG C;  2UYZ B;  3A9J A;  4JIO U;  2DHZ A;  2KLC A;  4K7W A;  3EC8 A;  3UIN B;  5L83 A;  1E7V A;  1WMH A;  5D7G A;  2DYO A;  5GMV A;  3VHT C;  3IFW B;  4MSQ B;  3R7R A;  1WM2 A;  3DBL I;  2LGD A;  3C0R B;  1ISN A;  4BKG A;  3JSV B;  2O6V B;  1EO6 A;  3GZN I;  4EEW A;  2V4L A;  1C1Y B;  3TJP A;  2ZVO A;  1E8W A;  4W9C A;  1WF9 A;  1V86 A;  2XBB C;  1I42 A;  3BIN A;  5JHB A;  3ZLZ A;  1WJN A;  4KVG B;  5TR5 A;  1WGR A;  3DBS A;  4NNJ B;  3UF8 A;  4CYE A;  1E90 A;  2N9X A;  1WXM A;  3HM6 X;  3KUZ A;  3PZD A;  2MWS B;  1YQB A;  3KUC B;  2DYB A;  4WQO B;  2EKE C;  1R4M I;  5KHQ A;  5JH5 C;  4MM3 A;  1OGW A;  1V80 A;  3EHV A;  2G3Q B;  2JF5 A;  4FJY A;  4N9F 4;  4IWP A;  3RUL A;  2N9P C;  4ZRJ A;  1WXS A;  4FA6 A;  5JZE B;  4NY0 A;  1YIW A;  2J0M A;  3PGE A;  2B3A A;  2V1Y A;  4JQW C;  1E7U A;  4EOY A;  4MDK E;  4MSM B;  1WXV A;  2N9E B;  4KIK A;  1EF1 A;  4K1R B;  3SHQ A;  4DHJ B;  2HE7 A;  1WI0 A;  4NJ7 A;  4E3C A;  4BKS D;  2L0F A;  1I35 A;  3QJZ A;  4J6I A;  4RM9 A;  3TCA A;  2HTH A;  1UBI A;  2FAZ A;  2KJR A;  4HCN B;  3KVF B;  5IA7 A;  2KD0 A;  3QX1 A;  4KV2 A;  4XX5 A;  4AP4 C;  2AEH A;  4GIV A;  3NY5 A;  3M95 A;  1IYF A;  1U4A A;  2M17 A;  1G6J A;  2RD0 A;  2G4S A;  3ZW3 A;  1XD3 B;  3ZDT A;  2DAF A;  2D10 A;  4LDT B;  4DXA B;  2DZK A;  2EMT A;  3SD5 A;  1KLV A;  4CO7 A;  4WJN A;  4W9D A;  2IO3 B;  1KJT A;  2D2Q A;  5AEK B;  3APC A;  1S1Q B;  1ZGU B;  1ZKH A;  5DPT A;  2KWU B;  3RZW C;  4PYZ A;  3AI5 A;  2KQ7 A;  2JZZ A;  3T9L A;  1WZ0 A;  2BYE A;  2IO1 B;  1UD7 A;  3ZNZ B;  4W9F A;  4NQL B;  2WYQ A;  2PE6 B;  4IW0 A;  3ZNH B;  2KWV B;  2XK5 A;  1LQB A;  3TIX A;  1WX7 A;  4GDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...