2DAJA

Solution structure of the novel identified ubiquitin-like domain in the human cobl-like 1 protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
91
structure length
91
Chain Sequence
b'GSSGSSGEKTVRVVINFKKTQKTIVRVSPHASLQELAPIICSKCEFDPLHTLLLKDYQSQEPLDLTKSLNDLGLRELYAMDVNRESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0977 protein
publication title Solution Structure of the Novel Identified Ubiquitin-like Domain in the Human COBL-like 1 Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 8
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dajA00
1T0YA 1WGRA 1E7VA 2WDTB 5L83A 1IYFA 2DAJA 3WAPA 3RT3B 1VD2A 2VRRB 3TL5A 5BO4B 2JWZA 4ZDVA 4KVGB 1WH3A 2BKRB 4KIKA 4AOFA 2MSED 4HWIB 4ANXA 1WXSA 1Q5WB 1WE6A 2KZRA 1UBIA 2CU1A 1S3SG 4WQOB 4FA6A 3RZWC 2D2QA 3WIMA 4AUQC 4EUTA 5LXHA 4KV2A 4F7ZA 2JRIB 4IW0A 5DCNA 4MDKE 3R66C 2MBHA 1WJ6A 4DHZB 3S2AA 2V1YA 2LVQA 2BYVE 4HDQA 2AEHA 2R2OA 5D2MB 4W9FA 4DK5A 4GSWA 1YQBA 3DQVA 3QA8A 1MG8A 4HCNB 2N7DA 4DDID 5CHVC 1F9JA 3M95A 4KSKC 3VTWA 4URKA 3R7RA 5G2NA 2LUEA 4HK2A 5FR6A 1FXTB 2CHZA 2XK5B 4A20A 2J0JA 4ANUA 2JZZA 3VUYA 3TBLD 4I6NB 2D3GA 3L16A 5IA7A 4W9CA 1ZW7A 3ZVVA 4JIOU 2MRPA 4BFRA 2IO3B 1WM3A 2DZIA 2C9WB 2KVRA 3NZSA 2LVPA 2KC1A 3HM6X 2DHZA 4GB9A 3OLMD 4K81A 4BKGA 3CMMB 3CSTA 2EMSA 4FHKA 2GMIC 5JHAA 2I1KA 4DHJD 2ZZPB 1LXDA 4IUMB 1E90A 4MEMA 4RM8A 5DPTA 2BYEA 4MM3A 4LDTB 4PS3A 2NCNA 2O2VB 2KANA 3AU5A 5D94A 2WX1A 4FJZA 3DDCB 3APDA 2DENB 4GDLB 3VTUA 1V5OA 2KJRA 2KQSA 4EZKA 2NBWB 1WI0A 4IM2A 2PEAA 2LI5A 2KFJA 5DPSA 3PT2B 4WWNA 2FIDA 5J2RA 2DZMA 2AL3A 2KFKB 3JSVA 4RM9A 4W9KA 2MBQA 3PSEB 3I3TB 3PLVA 1J0GA 5CX3A 4W9EA 2HE7A 2PJHA 3N3KB 3IG3A 2OOBB 2N1VA 3WANA 2K8BA 4LCDE 3RD2A 2AWTA 3IFWB 1P9DU 2KLCA 2KOXA 3IBEA 3DBSA 3QHTA 3L0WB 3PGEA 4XX5A 2LZ6A 1EF5A 3B1LX 4IM0A 1PQSA 5DPRA 1L2NA 3PHWB 2V3SA 1LM8B 1TTNA 3DBRI 3V6EB 3APFA 3KUCB 2LRUA 1Y8RC 2IO0B 5DPWA 4MELA 2K25A 1WF9A 2XK5A 3U7DA 3EC8A 3Q3JA 1E8ZA 1GUAB 2K39A 4NY0A 2KWVB 4MJSB 4XC2A 3TJPA 2JVCA 4BKSD 2MX2A 3A9JB 3M63B 3W1YA 2C7NB 3AULA 4HXDA 3U8ZA 3VQIA 1C3TA 1V6EA 2MA9B 1XT9B 3X0WA 3JVZX 2ZNVB 4NQKE 2N9EB 2GBMA 2Z0EB 3VVWB 1OEYA 4II2B 1P3QU 1XQQA 2L05A 3H6NA 3N32A 4F1SA 3AXCA 4HJKA 2J0KA 4WJPA 2J0MA 1S1QB 2J7QB 4EZLA 2MBOA 2IBIB 1WJNA 2ZPYA 3ZNZB 2KJ6A 2BPSA 2O2VA 4CO7A 1K8RB 1OTRB 3T8MA 4G11A 1YX6B 2AL6A 4HDOA 5HKHA 3DVNV 2M8SA 4GDLA 4HPMB 2O6VA 2KK8A 3ZRCA 2N9XA 2NS5A 1A5RA 2KLGA 5AZHA 3ML9A 2C7MB 4DHJB 3Q3FA 4I6LB 1EO6A 5C23A 1KOTA 2KFKA 1Q1OA 2N9PC 4FJVB 2CKHB 5J18A 3APCA 2KWUB 2OJRA 4JGHB 3M62B 2LD9A 2GBRA 4GU2A 2KC2A 4ZYNA 3JSVB 1D3ZA 2MW5A 1KJTA 2GBNA 4FHJA 2REXA 2FCNA 4IWPA 4K1RB 2LXCA 2L3ZA 3GZNI 1QZEA 1J8CA 2G4SA 2YLMA 3CSFA 3ZIMA 2NR2A 3OAWA 4G0NB 3SDLC 3ENEA 3KUDB 2CHXA 1LQBA 4BOZB 2JY6A 1Z2MA 4KZCA 3KYCD 4MGKE 4RMAA 5LLIA 3D32A 4M0WB 5CHWA 1VCBA 5JZEB 2IY0B 5C1ZA 1WFYA 2GBKA 4MJSA 2BYFA 5AZFA 1HE8A 4NNJB 2LVOA 3A9JA 1WRDB 3B0AA 3DCGA 1CMXB 2FIFA 1WY8A 2MQJA 4MGYE 2L0FA 2GBJA 2LWPA 2LRWA 3PREA 4BBNF 4EFOA 1V80A 2BF8B 3HM3A 5JH5C 3R7QA 2JF5A 3UINB 2NVUI 1WXMA 4GMVA 4FADA 1NI2A 2FCMA 3QARA 2CS4A 3IHPC 3DVNU 4HVBA 1AARA 2CR5A 2KDEB 3TMPB 4W9IA 1R4MI 1WMHB 3A9KB 1SIFA 2L00B 2I1JA 2D10A 2DX5B 4AP4C 2WWZA 3L10B 4BOSC 2FUHB 3H7PB 4TKNA 3VUWA 3UGBB 4J6IA 2W9NA 4B9KA 2A5UA 1YX5B 3ZO5B 4JLCA 3PRMB 1V2YA 2O6VB 2DYMA 4LJPB 1G6JA 4DWFA 2RSUA 3DVGY 2DYBA 2LASA 2KX0A 2L0TA 3RULA 1H8CA 1IPGA 1WX7A 2UWQA 3W1SA 2K1FA 2PE6B 4NJ6A 2MBBB 2LJ5A 2FNJB 4GGQA 1P0RA 4NQLB 2A4ZA 3WA0A 3LDZE 4FJYA 3EFUA 1GG3A 4G50A 1EUVB 3P2BA 2KMAA 1ISNA 3PRZA 3KVFB 1RAXA 5E6OA 2JRHA 3NY5A 2Y5BB 1V5TA 1WX9A 3QX1A 3IVFA 4GN1A 2FAZA 4EOYA 1JRUA 2PE9A 3UIOB 3RZFA 5D6JB 4ICUA 3H1UA 3QQ8B 2L8JA 2M17A 4MGIE 3C0RB 1WM2A 3PS6A 3ECIA 1GC7A 1NBFC 3VHTC 3AU4A 2K8CA 2ZVOA 4W9DA 3LJ3A 4NAWA 1V49A 2N4FA 1WGYA 5CTRC 2K6DB 3PHXB 3X23A 1GJZA 2RD0A 1E7UA 2MLBA 4HCPB 4NJ7A 4PS7A 2KO3A 1Q0WB 2GOWA 2IO1B 4E74A 4DDGD 3SD5A 3ZNHB 2BWES 1XD3B 4TUUA 1YD8U 4IWQA 2IZVB 1WGGA 2K8HA 4EZJA 3VFKA 1UD7A 4B6WA 4BKSA 3U30A 1WR1A 3WAMA 2RPQA 1WMHA 3PTFC 3A9KA 3QCAA 1WXVA 4IWOA 4JL9A 2M4NA 2LGDA 2MBEA 3VXWA 1KLVA 3O65B 5TR5A 4KDIC 3RUIB 2KHWB 3ALBA 3H7PA 1YIWA 2ZNVC 4EEWA 1GNUA 2IO2B 4BKTA 4W9JA 4II3B 2V4LA 2JPHA 3HIZA 1E8YA 1WGHA 4LDTD 3VH4B 3L54A 2G3QB 1UGMA 2N1WA 3ZTCA 4HLEA 2RGFA 4JQWC 5KHQA 2N7EA 3DBLI 4A3OA 2Z59B 3V61A 3VUXA 2DZKA 4K7UA 4K7WA 4DHZE 2KKCA 3VH3B 2C5LC 2ZJDA 4IG7B 5G55A 4HPLB 3TCAA 2ZVNA 1E5WA 1WXAA 4N9F4 2JUOA 2ZCCA 4PS8A 2MP2B 3MJWA 3ML8A 2NBVB 4GOCA 4MSQB 4GIVA 3JYUA 3ONSA 1WGDA 3VDZA 1OGWA 3QJZA 3QK0A 3WAOA 4G3XB 2NBUA 1YJ1A 4NPNA 2Z0DB 4PYZA 3A33B 3L13A 3W1SC 2LGYA 3PLUA 2IYDB 4ANWA 1UH6A 3NZUA 2WX0A 3DOWA 4W9HA 3UQBA 1OEYJ 3KW5B 3NHEB 3NS8A 3CF6E 3EHVA 1E8XA 4NAWB 3L17A 4ZRIA 4CHKA 4I6PA 4OVVA 4FBJB 1P1AA 4AWJA 4FLHA 3ZNGC 4TQ0A 3UQAA 2KNBA 3SHQA 5AEKB 4FULA 4OVUA 2R2QA 1RRBA 1V81A 2WYQA 4WWOA 5KHOA 2HJ8A 3A4RA 3NOBA 2JZ3B 1V9JA 4PYUA 2BKFA 3RYTA 2D11A 2KDBA 1SE9A 3WALA 1UELA 2KQ7A 4DBGA 3ZNID 1R4NI 3ZW3A 3GOEA 3QWZB 3M3JA 3ZDTA 4WJQA 4W9LA 1WZ0A 4E3CA 4EKUA 2M0XA 1WJ4A 1TZ1A 5JHBA 2KTRB 2KX3A 1UBQA 1LFDA 2D07B 3A4SC 5D7GA 2KWCA 2YVCA 3A1QA 1WJUA 3KUZA 1L7YA 3R3MA 1UZXB 1ZGUB 3SU8X 4F8CB 5LXIB 2DYOA 2EMTA 5E6NA 4XZ4A 3UF8A 2KDIA 3AI5A 3V60A 4BBNC 3EECA 3H9DA 4AJYB 1RFAA 3OJ3A 3ZDMC 1I35A 2MP2A 1WIAA 1V86A 4GDKA 2KXJA 4KDLB 4IM3A 3RCZA 3QAQA 1X1MA 2BWFA 2MWSB 2JXXA 3PZDA 2KTFA 4K7SA 1EF1A 2C60A 3K9OB 4A3PA 2JT4B 1M94A 1SGHA 1KM7A 1P98A 1TGZB 2IY1B 2NPTB 2HD5B 3OJ4B 3ZTDA 4WJOA 3ZRFA 3MHSD 3V62A 3JW0X 3MTNB 1I42A 4CYEA 2BGFA 2M1MA 3PVLA 4P7IA 2AYOB 5GMVA 3VAWA 4FN2A 3VTVA 3ZLZA 4ASWC 4KIKB 1RLFA 4MSMB 3HK0A 1U4AA 3B08A 4GXBA 1OQYA 2PPHA 2G4DB 3DBHI 2XEWA 3N30A 4ZRJA 1WX8A 4DXAB 2ASQA 2UYZB 4M8NA 1IP9A 2L7RA 2LGXA 2LXAA 2KDFB 3PRPB 1TBEA 4TQ1A 2DAFA 2ZPNA 4W9GA 2DZJA 2FCSA 2XBBC 4KZ0A 1GC6A 5EDSA 3KH0A 3ZKJC 2KJHB 5IAAC 5J17A 1WE7A 1WYWB 3BINA 3DVGX 3DPDA 2G45B 1E8WA 2RR9A 3PV1A 4ICVA 4LJOB 4X57B 2EKEC 4WWPA 2KTRA 4YL8A 2MCNB 3K9PB 4TV3A 2CHWA 5CHFA 1NDDA 1WR6E 3KYDD 2KN5A 1Z5SB 2KMCA 2QHOA 1H4RA 5E6PA 2KD0A 4WJNA 4AJWA 1J19A 1BT0A 4MGZE 5L95C 1C1YB 3QIJA 4KSLC 2C7HA 3A1QB 4IC7B 4M8MA 4E71A 2K6QA 1WZ3A 3UIPB 3L08A 3PPAA 2ZCBA 2FCQA 2O6VD 2L76A 3T9LA 1ZKHA 2HTHA 4BVUC 3TIXA 3H7SA 4WAAA 3HHMA 2B3AA 5AZGA 3V6CB 3ZUNA 4B95A 2ZEQA 3QC8B 4GDKB 4ZRKA 4MH0E 2NPTA 3BY4B 4ANVA
chains in the Genus database with same CATH superfamily
1T0YA 2WXPA 1BMLC 2VRRB 2JWZA 4ZDVA 1WH3A 2BKRB 4A6QA 2MSED 2KZRA 4WQOB 1IUEA 2D2QA 3RZWC 1I4QA 5LXHA 2JRIB 4IW0A 1WJ6A 3AEEB 4DHZB 3S2AA 4OZBA 2W82A 3QA8A 4HCNB 5HI1A 1F9JA 3VTWA 3ZXVA 4JE3B 4P6VF 2V3PA 2XK5B 3TBLD 2LUMA 3DBHB 3V3XA 2MRPA 1WGKA 1WM3A 2DZIA 2KVRA 3NZSA 2LVPA 4GB9A 3U4EG 3Q8FA 4K81A 1PFDA 2GMIC 1L0YB 3TEXA 3N20C 2BYEA 4LDTB 4HPPA 2KANA 1HXYD 4GDLB 4LNFA 2KFJA 5DPSA 3PT2B 2BVCA 1EU3A 4ITKA 3JSVA 2ICIA 5IN7A 2MBQA 1J0GA 3PLVA 5IO9A 4W9EA 2PJHA 3IG3A 3RD2A 4LCDE 4IOIE 3IFWB 4C80A 1P9DU 1EM7A 3B1LX 4IM0A 3APFA 3KUCB 1E7PB 3Q8AA 2XK5A 1YN3A 1XLPA 2W55A 1TZOA 3A9JB 3M63B 3J9CA 3U8ZA 3AULA 2MA9B 4NQKE 2N9EB 2Y3AA 1OEYA 2J53A 2L05A 3AXCA 2J7QB 1C4CA 2MBOA 4XDCA 2ZPYA 3P4PB 1K8RB 2RMMA 1YX6B 3IT6B 4GDLA 2N9XA 3ML9A 3AN1A 2AQ1B 4AS1A 1EO6A 1JROA 1TIFA 4QAYA 1C78A 4ZYNA 1JWSD 3Q14C 5FK9C 2LXCA 4LNNA 2YLMA 1WYGA 3KWLA 2NR2A 3OAWA 3SDLC 3ENEA 4KZCA 3NVVA 4M0WB 5CHWA 1VCBA 5C1ZA 2BYFA 4NNJB 3A9JA 3B0AA 2MHJA 1WY8A 4MGYE 1XXGA 2BF8B 5JH5C 4HROA 2NVUI 1F77A 4HKZE 4KGSA 4FADA 1TS4A 2CU3A 3RNBC 2FCMA 3QARA 1TY0A 3IHPC 4CQNA 3NVWA 2CR5A 4XDDA 3BYYB 2BS3B 1P7EA 2L00B 2I1JA 3IAS1 2FUHB 4HRSA 1QT9A 2WDVB 2QJLA 2W9NA 2A5UA 1C79A 2LASA 2IPKD 2UWQA 2FUG1 2PE6B 2LJ5A 2R61A 3AEBB 3BWUD 4GGQA 1QQRA 4WQMA 3LDZE 3PRZA 2QC8A 5E6OA 2JRHA 3QX1A 2FAZA 4EOYA 3RZFA 5D6JB 2M17A 4M0WA 1WM2A 3B9JA 3ECIA 1GC7A 2IGDA 3AU4A 4KKIA 3AEGB 3LJ3A 2BBCA 4NAWA 2N4FA 2K6DB 3X23A 1GJZA 1E7UA 2KQ4X 2KYWA 2GOWA 4E74A 3DHIC 1EWCA 2K22A 5JXVA 2QIEB 4IWQA 1WGGA 2KAJA 1STEA 4B6WA 3U30A 1YJIA 3QCAA 1HZ5A 3VXWA 3CWIA 5TR5A 4KDIC 2OEDA 2KHWB 4L2YA 1GNUA 4II3B 3O13A 2JPHA 3DHGC 3P4SB 2D3BA 2G3QB 1TS5A 1IBXB 4HLEA 5KHQA 4JQWC 4A3OA 4WWMA 4DHZE 2ZJDA 3TCAA 1E5WA 1F2RC 1V8CA 1HQRD 4ZRPA 2XN9C 3LXFA 2ZCCA 3R8BA 3N1YC 1NVID 4XGAB 3JYUA 3QK0A 4KX6B 1YQ4B 4NPNA 3AE5B 1L4DB 3AE8B 2WX0A 5H92C 3SFDB 1OEYJ 1DOIA 4CHKA 4I6PA 2PVGC 4OVVA 5EE0A 4FBJB 4FLHA 3ZNGC 3BIID 2G1EA 1KLGD 2W54A 3SHQA 5AEKB 1V81A 2AX5A 5E6JA 2X38A 4P1CC 1V9JA 2JZ3B 3RYTA 4BZAA 1UELA 1R4NI 3ZW3A 3M3JA 4PK1A 1GAQB 1WZ0A 1WJ4A 3BK2A 2KTRB 1L0VB 2D07B 3A4SC 2KWCA 2YVCA 1IBXA 1VZ7A 3A1QA 1UZXB 3IXSA 3BVZA 5E6NA 1FNVA 3AI5A 2PVOD 3C8YA 3ZDMC 1WIAA 1WRIA 1I4HA 4KKJA 1AN8A 2BWFA 3PZDA 2KTFA 4K7SA 3K9OB 1EF1A 3HVDA 1SSNA 2ON8A 2JT4B 1K51A 1SGHA 1I42A 3PVLA 4JWSC 4RFBA 3UQBA 4GXBA 2LJIA 3DBHI 3P63A 1ZUD2 3Q8CA 1L6UA 2WNMA 3SR6A 2ASQA 2LXAA 1CJEA 4RH6A 4W9GA 3RI7C 2FCSA 4KZ0A 5EDSA 1VDVA 3ZKJC 2G45B 1E8WA 2EKEC 2KTRA 3K9PB 2CHWA 2KN5A 3P1MA 3MHZA 4HEA1 2QHOA 1H4RA 5E6PA 4M8MA 1SE3A 3UI3A 4S17A 2JU6X 3DWGC 1SF0A 2BS2B 2SEBD 3I57A 2O6VD 3B2FA 3H8HA 1ZKHA 4WAAA 3QC8B 4MM3B 4MH0E 3BY4B 4WIPA 3SEBA 4B0MA 2WDTB 4J3OD 1YMHE 4LLGM 1JQ4A 5BO4B 4AOFA 3HVZA 4HWIB 4ANXA 1WXSA 1GB4A 1Q5WB 3C19A 2CU1A 1RWSA 1OFFA 1S3SG 4AUQC 2MBHA 3SFEB 1QLBB 3VRAB 2LVQA 4HDQA 2AEHA 2R2OA 3NVZA 2L83A 4GSWA 3RNEC 1N63A 5FKAC 4DDID 2L52A 3MC8A 5CHVC 4KSKC 1L5PA 3R7RA 3VR8B 4A20A 4ANUA 2J0JA 2JZZA 3PZ7A 4YWGG 2KWDA 4W9CA 5BMGA 4BFRA 2C9WB 3CSTA 3BK1A 4BAXA 4DHJD 1LXDA 4IUMB 2WQYB 4MEMA 4RM8A 5DPTA 4MM3A 4PS3A 1N60A 4FXCA 1RM6C 5D94A 2WX1A 1F0ZA 4Q2JA 2MH7A 2KQSA 2NBWB 1VLBA 4IM2A 2JYTA 2FIDA 5J2RA 1HTQA 4W9KA 5CX3A 2HE7A 2N1VA 3KWVA 2AWTA 1PDXA 1BXTA 4M02A 3QHTA 2LZ6A 1EF5A 2MEKA 1PQSA 1L2NA 1KF6B 5TSSA 4YSYB 1YJJA 5DPWA 4MELA 1FRRA 4ARIA 3U7DA 3R2IA 1E8ZA 1GUAB 4BKSD 3URYA 2C7NB 1T5XD 3VQIA 1XT9B 4OZCA 2Z0EB 4JX1C 1SEBD 2Z8LA 1XQQA 3H6NA 2J0MA 1S1QB 2IBIB 2KJ6A 4G11A 2AL6A 1M4VA 3ZRCA 2WXIA 2VZKD 1KOTA 2N9PC 1Q1OA 2WXHA 2NTSA 2CKHB 1EU4A 1GPXA 4JGHB 2GBRA 3NZ3A 4GU2A 2KC2A 3JSVB 1KJTA 2GBNA 2REXA 2FCNA 4K1RB 1I4RA 1J7CA 3ETRA 3GZNI 2H89B 5C3JB 4HKQA 4G0NB 4MACA 1TS2A 2K5PA 3KUDB 4A90A 4BOZB 4DQOC 2JY6A 1Z2MA 4WURA 4JWUC 4L23A 5LLIA 3D32A 5JZEB 2IY0B 2N9KA 2ZW1A 5AZFA 1HE8A 2LVOA 2N0SB 5EE9A 4MT5A 2LWPA 4BBNF 1E6EB 1V80A 3HM3A 5T8IA 2JF5A 1Y56A 4GMVA 3DVNU 3MC9A 2KDEB 3TMPB 3ZYYX 4RNAA 3TSSA 1T0RC 3A9KB 2WWZA 1HA5A 3VUWA 4JLCA 1V2YA 1ZDXA 4LJPB 4YTNB 3DVGY 3U7ZA 2X8XX 3RULA 1WX7A 2W3SA 2K1FA 2K3UA 4NJ6A 1GB1A 1SXTA 1HTOA 4FJYA 3EFUA 4G50A 3FC4A 1RAXA 3NY5A 2Y5BB 1FFUA 1V5TA 1FXIA 1JRUA 2DBYA 1C77A 3UIOB 4ICUA 3H1UA 3PS6A 1JRPA 1V49A 1WGYA 2JZPA 5CTRC 1WWTA 3L4PA 4YT0B 2MLBA 4HCPB 4NJ7A 1Q0WB 3Q2AC 2PMVA 3SD5A 4RGNA 4TUUA 2PLPA 1YD8U 2WXOA 2WXGA 1MPEA 1KLUD 4OW0A 3Q69A 3PTFC 3A9KA 1WXVA 4IWOA 4JL9A 2M4NA 1MHXA 2MBEA 2QSDA 2NTTA 2IO2B 4LDTD 1UGMA 2N7EA 3U2SC 4K7UA 4K7WA 2E3TA 2ZVNA 1L6VA 4KGTA 1WXAA 1D5ZC 2JUOA 2PTLA 3GP7A 2BS4B 3MJWA 1FEHA 3ML8A 4GOCA 1LO5D 4GIVA 3ONSA 1WGDA 3N9YC 3ZJTA 3QJZA 3P4RB 5G5GA 1FNUA 4G3XB 4ZHOA 3TEYA 2NBUA 4PYZA 3L13A 4W9HA 1KTKA 2LHEA 3KW5B 4NAWB 3CF6E 3EHVA 4AWJA 2KNBA 4NAMA 4PT5A 4OVUA 4C56C 2KDBA 1SE9A 2Y5PA 2I38A 3B2GA 4DBGA 2V9HA 3ZNID 1C4AA 3QWZB 3I9V1 4WJQA 5MPOA 4E3CA 1UBQA 1LFDA 4USAA 1L7YA 2WXNA 1ZGUB 3R3MA 3W9CB 4ZOHC 4XZ4A 1DGJA 3HRDD 2Y5CA 3VR9B 4N58A 3I5JC 4KDLB 4IM3A 3RCZA 3QAQA 1X1MA 2JXXA 1VZ8A 1M94A 1KM7A 2INNE 4N59A 3OG5A 1FRDA 1D5MC 3MTNB 2BB5A 3DBLB 2AYOB 3VAWA 3ZLZA 4KIKB 1QOGA 3B08A 3VRBB 2V0GA 2G4DB 4RGTA 4ZRJA 2YEPB 4M8NA 2LGSA 2L7RA 1FXAA 2KDFB 3GZNB 1TBEA 1PGAA 2DAFA 2DZJA 3KH0A 5IAAC 1WE7A 1WYWB 4WWPA 2MCNB 1FIQA 1MG4A 1ZXIA 5CHFA 1WR6E 3KYDD 4AJWA 2KD0A 1J19A 2PIAA 2KT7A 1C1YB 2ZW0A 3AEDB 4KSLC 2C7HA 3A1QB 3AH7A 2I2YA 2LFIA 5AUIA 3H7SA 5AUKA 5FR3A 2SAKA 2ZEQA 1JWMD 4ZRKA 1I4PA 4ANVA 1FPYA 1T0QC 1WGRA 1E7VA 5H8YE 5L83A 3TEWA 1IYFA 2DAJA 3RT3B 1VD2A 2LMCA 2G9HD 3TL5A 4KIKA 1NYRA 1UWMA 3GE8C 1WE6A 2L1AA 1UBIA 4FA6A 3WIMA 4EUTA 4KV2A 4F7ZA 1TKYA 5DCNA 4MDKE 3R66C 2V1YA 3KLSX 4L1BA 1N62A 1MG8A 5LNK1 2WXRA 2N7DA 1CQVA 2LUEA 4HK2A 2JWUA 5FR6A 2CHZA 4YTMB 2MJEA 3Q3OC 4I6NB 2D3GA 5IA7A 2XNAC 3ZVVA 4JIOU 1VRAB 1ET9A 2DHZA 1AWDA 1QOBA 4BKGA 1EWYC 1UNSA 4FHKA 2ZZPB 4RCOA 1E90A 2V3NA 2D5GA 1D4BA 1XEEA 2NCNA 2O2VB 3AU5A 5BMIA 2KACA 3DDCB 2DENB 5HG2A 4AQ7A 1V5OA 4EZKA 3RNCC 1I4GA 2LI5A 2M56B 2DZMA 5IOIA 2KFKB 3FAHA 3PSEB 3I3TB 3AE9B 4YSZB 2WXJA 3N3KB 3WANA 1CZPA 3IBEA 2KOXA 1UF0A 2WXKA 4XX5A 4REZA 1L0XB 3PHWB 2V3SA 2WU5B 2JYEA 4H2AA 1XLNA 2LRUA 2IO0B 2ACZB 2K25A 2FBWB 3ZGZA 2K39A 1MJDA 2KWVB 4XC2A 3TJPA 2DWQA 1NYQA 2JVCA 4TMAB 2MX2A 2BW2A 1C3TA 1V6EA 2HDEA 3X0WA 1TJEA 3VVWB 2GBMA 1P3QU 3DWMA 3N32A 4F1SA 1ZOYB 4HJKA 2J0KA 4EZLA 1WJNA 5IKCM 2O2VA 3GS2A 4CO7A 3T8MA 4NJCA 4HDOA 2OHFA 3DVNV 2M8SA 2O6VA 2NS5A 1A5RA 1SBBB 5AZHA 2C7MB 4DHJB 1E10A 3Q3FA 5C23A 2KFKA 3PO0A 2LD9A 1D3ZA 2WDRB 1JCKB 2EKIA 4XWWA 3AECB 1DOYA 1QZEA 2G4SA 3ZIMA 3LYYA 3U52E 4ZHPA 2CHXA 4ZRQA 4M00A 3KYCD 4MGKE 4RMAA 3EUB2 3Q3MC 1MI0A 1WFYA 2GBKA 1WSPA 3NRZA 1F2RI 3DCGA 1CMXB 2FIFA 2MQJA 4XE0A 2LRWA 3PREA 5G5HA 5HHDG 1P7FA 2IDYA 1NEKB 4HVBA 3DBRB 4IKGA 3I63C 4UDUC 1R4MI 1SIFA 2GI9A 2D10A 4AP4C 3L10B 4BOSC 4KGRA 2IGHA 4EE2A 4B9KA 1YX5B 3ZO5B 1RFKA 1KFYB 2WXQA 1JW9D 4A55A 2DYMA 2GRIA 1YNTE 2HJ1A 4DWFA 1ZE3D 2RSUA 2FE8A 1G6JA 1FFVA 3W1SA 1N5XA 1P0RA 3GE3C 4US8A 2A4ZA 3WA0A 1GG3A 1EUVB 1ISNA 1T6BX 3W2DA 1WX9A 2KN4A 2PE9A 3QQ8B 3VHTC 2ZVOA 4W9DA 4B0EA 1C76A 2WHIA 4PS7A 4US9A 4DDGD 4MH8A 2WGSA 1XD3B 4HJGE 2OJWA 4EZJA 3MFGA 3E9SA 1UD7A 4BKSA 3WAMA 3W5VB 2LGDA 3O65B 2V4IB 2JXTA 4IDIA 1ENFA 3ALBA 2B76B 2M19A 4EEWA 4W9JA 2V4LA 3ZJVA 3HIZA 3VH4B 1YOVB 3BZDB 3DBLI 2Z59B 3V61A 3VUXA 3Q8EA 3TUOA 1NI3A 2MP2B 2N9LA 1AYFA 2NBVB 1N5WA 1UUPA 1IGCA 3VDZA 1WXQA 1OGWA 1D6EC 2VH1A 1YJ1A 3W1SC 2WXFA 2GLSA 2LGYA 4ANWA 1UH6A 1K52A 3NHEB 1C4PA 3L17A 2QMTA 1B1ZA 1TY2A 3UQAA 3AE6B 4FULA 2R2QA 1RRBA 2WYQA 4WWOA 1YN4A 3T3OA 1K50A 1MFWA 4PYUA 2BKFA 3AE2B 2H88B 4WAFA 3GOEA 1YN5A 3ZDTA 3MJ5A 2M0XA 4M01A 4DXGA 5EE3A 3KUZA 5LXIB 1QOFA 2WDQB 2DYOA 1F1HA 2EMTA 2RPVA 3UF8A 2KDIA 3V60A 3N1ZC 4BBNC 1XO3A 1C9FA 1RFAA 3OJ3A 2MP2A 1TT5B 1V86A 2KXJA 4GDKA 1QILA 3RNFC 4A3PA 1L4ZB 2C60A 5I4DA 1TGZB 3ZTDA 2HD5B 3ZRFA 3MHSD 4LTUA 3JW0X 1OQQA 3P4QB 4D2KA 2BGFA 2M1MA 5GMVA 3VTVA 4ASWC 3CIRB 2RDBC 4O1NA 4MSMB 2K0PA 3HK0A 1U4AA 2XEWA 3AE1B 4DXAB 2UYZB 1IP9A 3IT4B 2AQ2B 3PRPB 2CJOA 4TQ1A 4R3DA 2JSVX 2XBBC 2ONQA 3TEZA 3DHHC 3BYTB 1FD6A 1FNWA 4C7YA 3PV1A 4LJOB 4ICVA 4X57B 2IGGA 4TV3A 3V05A 1Z5SB 3MP9A 2QEJC 5L95C 3ZXRA 3QIJA 1KRHA 2K6QA 5D3DA 3UIPB 3PPAA 4P1BC 5C2TB 2HTHA 4BVUC 1QF6A 3HHMA 1T3QA 2B3AA 1R4MB 3RFZB 4A9AA 1Q10A 1ZP0B 3P42A 4LNOA 4C7ZA 3WAPA 3ZJUA 4KVGB 1D5XC 1DYQA 3EA6A 1SJED 3WCQA 1F52A 1GOZA 1TKEA 2WU2B 2BYVE 5D2MB 4W9FA 1TKGA 1YQBA 3DQVA 1J7BA 3M95A 4URKA 5G2NA 1N61A 1FXTB 3VUYA 3L16A 1ZW7A 2WXLA 2IO3B 3ABVB 2KC1A 2J4XA 3HM6X 3AE7B 1XLQA 1TYGB 3OLMD 1E9MA 3CMMB 2EMSA 1FM0D 2PW9A 1V97A 3HUIA 2I1KA 5JHAA 4OVZA 5HFYA 1T0SC 1TS3A 4FJZA 3APDA 4RF1A 3VTUA 2KJRA 2K9XA 1WI0A 2PEAA 2WS3B 4WWNA 2AL3A 5BYSA 1LGRA 4RM9A 2BB6A 4JPSA 3Q3NC 2OOBB 4ACFA 2K8BA 2KLCA 3DBSA 4YXDB 3L0WB 1XLOA 3PGEA 5DPRA 4LNKA 2LHDA 1LM8B 1TTNA 3DBRI 3V6EB 1Y8RC 2W3RA 1WF9A 3FKYA 3KQ4A 3EC8A 3Q3JA 4NY0A 2GB1A 4MJSB 5BMHA 3W1YA 2DLBA 3E56A 4HXDA 1PGBA 1I7HA 1UWXA 3JVZX 1V1PB 2ZNVB 3BVMA 1SE2A 4II2B 1ET6A 3IAM1 1B9RA 4YTPB 4WJPA 3ZNZB 2BPSA 1OTRB 1QOAA 5HKHA 1AW7A 4HPMB 1HZ6A 2KK8A 2KLGA 1V1OA 4I6LB 4FJVB 4LNIA 5J18A 3APCA 2KWUB 2KMMA 4WH4A 2OJRA 3M62B 2MW5A 4FHJA 4IWPA 2L3ZA 3W5UB 1J8CA 3CSFA 4ZYSA 2INCC 1LQBA 3GB1A 4C4VB 3MC0B 4MJSA 3RNGC 3AEAB 1WRDB 1ZPSA 3N1XC 5EE1A 1FMAD 2L0FA 2GBJA 1V1PA 2EELA 4EFOA 3R7QA 3UINB 1WXMA 1NI2A 1PGXA 4GLSC 1R7SA 2NMQA 2CS4A 2WP9B 1AARA 2L32A 3EFCA 4W9IA 1NENB 1WMHB 2RDHA 3NVYA 2WLBA 4RGMA 2DX5B 1FCCC 1PUTA 3H7PB 4TKNA 2BT6A 3UGBB 4J6IA 1ZXHA 3PRMB 2O6VB 4RGOS 2DYBA 1SB3C 2KX0A 2L0TA 4LK0M 1H8CA 1IPGA 2D3CA 2MBBB 2QCZA 2FNJB 4NQLB 4RF0A 2J52A 3AM9A 3P2BA 2KMAA 3KVFB 3Q6BA 2KVZA 4GN1A 2YEPF 3IVFA 4C4VA 1ACCA 2L8JA 4MGIE 3C0RB 1NBFC 2N7JA 2K8CA 1SIJA 1JALA 4K3BA 3PHXB 2RD0A 2LGIA 2KO3A 2IO1B 1DOXA 1ZDVA 2BWES 3OWEB 3ZNHB 5IP4D 3FILB 2LEKA 3NS1A 3RNAC 2IZVB 2K8HA 1K53A 3VFKA 1RYJA 2J42A 1WR1A 2RPQA 1WMHA 5BYRA 1KLVA 2DNFA 3AV8A 3RUIB 3H7PA 1YIWA 2ZNVC 4BKTA 1KH0A 2Q5WD 3R2TA 1E8YA 1WGHA 3AB5A 1N6ZA 3L54A 4P16A 1SE4A 2N1WA 3ZTCA 2RGFA 4YSXB 3AMZA 2DZKA 2KKCA 3VH3B 4TSSA 2C5LC 4IG7B 5G55A 1YQ3B 4HPLB 4NZLB 4N9F4 2MJ3A 1JWAD 4PS8A 3AE4B 2UU7A 2WXMA 4MSQB 4K3CA 3BVGA 1ROEA 3RPFC 1XF5L 3WAOA 5GXGB 2Z0DB 3A33B 3PLUA 1E0ZA 2IYDB 3NZUA 3DOWA 3AEFB 3LB8C 3NS8A 4DK5A 1E8XA 4ZRIA 1JWBD 4XWTA 1P1AA 2JQRB 3FILA 1MHHE 2VH2A 4TQ0A 4C00A 3RN9C 1VZ6A 1XCQL 1UGJA 1JWUD 5KHOA 2HJ8A 3A4RA 3NOBA 2KDMA 2INDC 2D11A 2E6XA 3WALA 2KQ7A 5D3IB 2QDFA 4W9LA 5JHBA 4OHJA 4EKUA 1TZ1A 2KX3A 5D7GA 3NG0A 1PYWD 1WJUA 1FCLA 2D3AA 3SU8X 4F8CB 1FO4A 3AE3B 2M0AA 3Q8BA 3EECA 3H9DA 5BYQA 4AJYB 2AQ3B 2CJNA 1I35A 2BTEA 2RDGA 1SJHD 2MWSB 2VZKB 1P98A 1MVKA 1BUIC 2IY1B 2NPTB 3OJ4B 4WJOA 3V62A 1OQRA 4CYEA 2JX5A 3T3NA 4P7IA 2IJ0A 4FN2A 1RLFA 2PKOA 4N6EB 1OQYA 2PPHA 1I4XA 4OZAA 4XYCA 3N30A 1WX8A 2BQQA 2LGXA 1IGDA 3EGRA 3RMKC 2BYTA 2ZPNA 3PZ8A 1VR9A 1ESFA 1GC6A 2KJHB 5J17A 3BINA 3DVGX 3DPDA 1JMLA 2TSSA 2RR9A 4YL8A 1HEZE 1NDDA 1XCTL 2KMCA 4DXFA 4WJNA 1BT0A 4MGZE 4IC7B 4E71A 1WZ3A 1QKZA 3L08A 2QILA 3NJTA 4ARCA 2HTME 2ZCBA 2MJDA 4S0RA 2FCQA 2L76A 3T9LA 1A70A 3TIXA 2INPE 3ZQ4A 1CK1A 5AZGA 3V6CB 3ZUNA 1R4NB 4B95A 4GDKB 1VJKA 1J7AA 2NPTA 4A8XC 3NUHB
chains in the Genus database with same CATH topology
1T0YA 1WGRA 1E7VA 2WDTB 5L83A 1IYFA 2DAJA 3WAPA 3RT3B 1VD2A 2VRRB 3TL5A 5BO4B 2JWZA 4ZDVA 4KVGB 1WH3A 2BKRB 4KIKA 4AOFA 2MSED 4HWIB 4ANXA 1WXSA 1Q5WB 1WE6A 2KZRA 1UBIA 2CU1A 1S3SG 4WQOB 4FA6A 3RZWC 2D2QA 3WIMA 4AUQC 4EUTA 5LXHA 4KV2A 4F7ZA 2JRIB 4IW0A 5DCNA 4MDKE 3R66C 2MBHA 1WJ6A 4DHZB 3S2AA 2V1YA 2LVQA 2BYVE 4HDQA 2AEHA 2R2OA 5D2MB 4W9FA 4DK5A 4GSWA 1YQBA 3DQVA 3QA8A 1MG8A 4HCNB 2N7DA 4DDID 5CHVC 1F9JA 3M95A 4KSKC 3VTWA 4URKA 3R7RA 5G2NA 2LUEA 4HK2A 5FR6A 1FXTB 2CHZA 2XK5B 4A20A 2J0JA 4ANUA 2JZZA 3VUYA 3TBLD 4I6NB 2D3GA 3L16A 5IA7A 4W9CA 1ZW7A 3ZVVA 4JIOU 2MRPA 4BFRA 2IO3B 1WM3A 2DZIA 2C9WB 2KVRA 3NZSA 2LVPA 2KC1A 3HM6X 2DHZA 4GB9A 3OLMD 4K81A 4BKGA 3CMMB 3CSTA 2EMSA 4FHKA 2GMIC 5JHAA 2I1KA 4DHJD 2ZZPB 1LXDA 4IUMB 1E90A 4MEMA 4RM8A 5DPTA 2BYEA 4MM3A 4LDTB 4PS3A 2NCNA 2O2VB 2KANA 3AU5A 5D94A 2WX1A 4FJZA 3DDCB 3APDA 2DENB 4GDLB 3VTUA 1V5OA 2KJRA 2KQSA 4EZKA 2NBWB 1WI0A 4IM2A 2PEAA 2LI5A 2KFJA 5DPSA 3PT2B 4WWNA 2FIDA 5J2RA 2DZMA 2AL3A 2KFKB 3JSVA 4RM9A 4W9KA 2MBQA 3PSEB 3I3TB 3PLVA 1J0GA 5CX3A 4W9EA 2HE7A 2PJHA 3N3KB 3IG3A 2OOBB 2N1VA 3WANA 2K8BA 4LCDE 3RD2A 2AWTA 3IFWB 1P9DU 2KLCA 2KOXA 3IBEA 3DBSA 3QHTA 3L0WB 3PGEA 4XX5A 2LZ6A 1EF5A 3B1LX 4IM0A 1PQSA 5DPRA 1L2NA 3PHWB 2V3SA 1LM8B 1TTNA 3DBRI 3V6EB 3APFA 3KUCB 2LRUA 1Y8RC 2IO0B 5DPWA 4MELA 2K25A 1WF9A 2XK5A 3U7DA 3EC8A 3Q3JA 1E8ZA 1GUAB 2K39A 4NY0A 2KWVB 4MJSB 4XC2A 3TJPA 2JVCA 4BKSD 2MX2A 3A9JB 3M63B 3W1YA 2C7NB 3AULA 4HXDA 3U8ZA 3VQIA 1C3TA 1V6EA 2MA9B 1XT9B 3X0WA 3JVZX 2ZNVB 4NQKE 2N9EB 2GBMA 2Z0EB 3VVWB 1OEYA 4II2B 1P3QU 1XQQA 2L05A 3H6NA 3N32A 4F1SA 3AXCA 4HJKA 2J0KA 4WJPA 2J0MA 1S1QB 2J7QB 4EZLA 2MBOA 2IBIB 1WJNA 2ZPYA 3ZNZB 2KJ6A 2BPSA 2O2VA 4CO7A 1K8RB 1OTRB 3T8MA 4G11A 1YX6B 2AL6A 4HDOA 5HKHA 3DVNV 2M8SA 4GDLA 4HPMB 2O6VA 2KK8A 3ZRCA 2N9XA 2NS5A 1A5RA 2KLGA 5AZHA 3ML9A 2C7MB 4DHJB 3Q3FA 4I6LB 1EO6A 5C23A 1KOTA 2KFKA 1Q1OA 2N9PC 4FJVB 2CKHB 5J18A 3APCA 2KWUB 2OJRA 4JGHB 3M62B 2LD9A 2GBRA 4GU2A 2KC2A 4ZYNA 3JSVB 1D3ZA 2MW5A 1KJTA 2GBNA 4FHJA 2REXA 2FCNA 4IWPA 4K1RB 2LXCA 2L3ZA 3GZNI 1QZEA 1J8CA 2G4SA 2YLMA 3CSFA 3ZIMA 2NR2A 3OAWA 4G0NB 3SDLC 3ENEA 3KUDB 2CHXA 1LQBA 4BOZB 2JY6A 1Z2MA 4KZCA 3KYCD 4MGKE 4RMAA 5LLIA 3D32A 4M0WB 5CHWA 1VCBA 5JZEB 2IY0B 5C1ZA 1WFYA 2GBKA 4MJSA 2BYFA 5AZFA 1HE8A 4NNJB 2LVOA 3A9JA 1WRDB 3B0AA 3DCGA 1CMXB 2FIFA 1WY8A 2MQJA 4MGYE 2L0FA 2GBJA 2LWPA 2LRWA 3PREA 4BBNF 4EFOA 1V80A 2BF8B 3HM3A 5JH5C 3R7QA 2JF5A 3UINB 2NVUI 1WXMA 4GMVA 4FADA 1NI2A 2FCMA 3QARA 2CS4A 3IHPC 3DVNU 4HVBA 1AARA 2CR5A 2KDEB 3TMPB 4W9IA 1R4MI 1WMHB 3A9KB 1SIFA 2L00B 2I1JA 2D10A 2DX5B 4AP4C 2WWZA 3L10B 4BOSC 2FUHB 3H7PB 4TKNA 3VUWA 3UGBB 4J6IA 2W9NA 4B9KA 2A5UA 1YX5B 3ZO5B 4JLCA 3PRMB 1V2YA 2O6VB 2DYMA 4LJPB 1G6JA 4DWFA 2RSUA 3DVGY 2DYBA 2LASA 2KX0A 2L0TA 3RULA 1H8CA 1IPGA 1WX7A 2UWQA 3W1SA 2K1FA 2PE6B 4NJ6A 2MBBB 2LJ5A 2FNJB 4GGQA 1P0RA 4NQLB 2A4ZA 3WA0A 3LDZE 4FJYA 3EFUA 1GG3A 4G50A 1EUVB 3P2BA 2KMAA 1ISNA 3PRZA 3KVFB 1RAXA 5E6OA 2JRHA 3NY5A 2Y5BB 1V5TA 1WX9A 3QX1A 3IVFA 4GN1A 2FAZA 4EOYA 1JRUA 2PE9A 3UIOB 3RZFA 5D6JB 4ICUA 3H1UA 3QQ8B 2L8JA 2M17A 4MGIE 3C0RB 1WM2A 3PS6A 3ECIA 1GC7A 1NBFC 3VHTC 3AU4A 2K8CA 2ZVOA 4W9DA 3LJ3A 4NAWA 1V49A 2N4FA 1WGYA 5CTRC 2K6DB 3PHXB 3X23A 1GJZA 2RD0A 1E7UA 2MLBA 4HCPB 4NJ7A 4PS7A 2KO3A 1Q0WB 2GOWA 2IO1B 4E74A 4DDGD 3SD5A 3ZNHB 2BWES 1XD3B 4TUUA 1YD8U 4IWQA 2IZVB 1WGGA 2K8HA 4EZJA 3VFKA 1UD7A 4B6WA 4BKSA 3U30A 1WR1A 3WAMA 2RPQA 1WMHA 3PTFC 3A9KA 3QCAA 1WXVA 4IWOA 4JL9A 2M4NA 2LGDA 2MBEA 3VXWA 1KLVA 3O65B 5TR5A 4KDIC 3RUIB 2KHWB 3ALBA 3H7PA 1YIWA 2ZNVC 4EEWA 1GNUA 2IO2B 4BKTA 4W9JA 4II3B 2V4LA 2JPHA 3HIZA 1E8YA 1WGHA 4LDTD 3VH4B 3L54A 2G3QB 1UGMA 2N1WA 3ZTCA 4HLEA 2RGFA 4JQWC 5KHQA 2N7EA 3DBLI 4A3OA 2Z59B 3V61A 3VUXA 2DZKA 4K7UA 4K7WA 4DHZE 2KKCA 3VH3B 2C5LC 2ZJDA 4IG7B 5G55A 4HPLB 3TCAA 2ZVNA 1E5WA 1WXAA 4N9F4 2JUOA 2ZCCA 4PS8A 2MP2B 3MJWA 3ML8A 2NBVB 4GOCA 4MSQB 4GIVA 3JYUA 3ONSA 1WGDA 3VDZA 1OGWA 3QJZA 3QK0A 3WAOA 4G3XB 2NBUA 1YJ1A 4NPNA 2Z0DB 4PYZA 3A33B 3L13A 3W1SC 2LGYA 3PLUA 2IYDB 4ANWA 1UH6A 3NZUA 2WX0A 3DOWA 4W9HA 3UQBA 1OEYJ 3KW5B 3NHEB 3NS8A 3CF6E 3EHVA 1E8XA 4NAWB 3L17A 4ZRIA 4CHKA 4I6PA 4OVVA 4FBJB 1P1AA 4AWJA 4FLHA 3ZNGC 4TQ0A 3UQAA 2KNBA 3SHQA 5AEKB 4FULA 4OVUA 2R2QA 1RRBA 1V81A 2WYQA 4WWOA 5KHOA 2HJ8A 3A4RA 3NOBA 2JZ3B 1V9JA 4PYUA 2BKFA 3RYTA 2D11A 2KDBA 1SE9A 3WALA 1UELA 2KQ7A 4DBGA 3ZNID 1R4NI 3ZW3A 3GOEA 3QWZB 3M3JA 3ZDTA 4WJQA 4W9LA 1WZ0A 4E3CA 4EKUA 2M0XA 1WJ4A 1TZ1A 5JHBA 2KTRB 2KX3A 1UBQA 1LFDA 2D07B 3A4SC 5D7GA 2KWCA 2YVCA 3A1QA 1WJUA 3KUZA 1L7YA 3R3MA 1UZXB 1ZGUB 3SU8X 4F8CB 5LXIB 2DYOA 2EMTA 5E6NA 4XZ4A 3UF8A 2KDIA 3AI5A 3V60A 4BBNC 3EECA 3H9DA 4AJYB 1RFAA 3OJ3A 3ZDMC 1I35A 2MP2A 1WIAA 1V86A 4GDKA 2KXJA 4KDLB 4IM3A 3RCZA 3QAQA 1X1MA 2BWFA 2MWSB 2JXXA 3PZDA 2KTFA 4K7SA 1EF1A 2C60A 3K9OB 4A3PA 2JT4B 1M94A 1SGHA 1KM7A 1P98A 1TGZB 2IY1B 2NPTB 2HD5B 3OJ4B 3ZTDA 4WJOA 3ZRFA 3MHSD 3V62A 3JW0X 3MTNB 1I42A 4CYEA 2BGFA 2M1MA 3PVLA 4P7IA 2AYOB 5GMVA 3VAWA 4FN2A 3VTVA 3ZLZA 4ASWC 4KIKB 1RLFA 4MSMB 3HK0A 1U4AA 3B08A 4GXBA 1OQYA 2PPHA 2G4DB 3DBHI 2XEWA 3N30A 4ZRJA 1WX8A 4DXAB 2ASQA 2UYZB 4M8NA 1IP9A 2L7RA 2LGXA 2LXAA 2KDFB 3PRPB 1TBEA 4TQ1A 2DAFA 2ZPNA 4W9GA 2DZJA 2FCSA 2XBBC 4KZ0A 1GC6A 5EDSA 3KH0A 3ZKJC 2KJHB 5IAAC 5J17A 1WE7A 1WYWB 3BINA 3DVGX 3DPDA 2G45B 1E8WA 2RR9A 3PV1A 4ICVA 4LJOB 4X57B 2EKEC 4WWPA 2KTRA 4YL8A 2MCNB 3K9PB 4TV3A 2CHWA 5CHFA 1NDDA 1WR6E 3KYDD 2KN5A 1Z5SB 2KMCA 2QHOA 1H4RA 5E6PA 2KD0A 4WJNA 4AJWA 1J19A 1BT0A 4MGZE 5L95C 1C1YB 3QIJA 4KSLC 2C7HA 3A1QB 4IC7B 4M8MA 4E71A 2K6QA 1WZ3A 3UIPB 3L08A 3PPAA 2ZCBA 2FCQA 2O6VD 2L76A 3T9LA 1ZKHA 2HTHA 4BVUC 3TIXA 3H7SA 4WAAA 3HHMA 2B3AA 5AZGA 3V6CB 3ZUNA 4B95A 2ZEQA 3QC8B 4GDKB 4ZRKA 4MH0E 2NPTA 3BY4B 4ANVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Y A;  1WGR A;  1E7V A;  2WDT B;  5L83 A;  1IYF A;  2DAJ A;  3WAP A;  3RT3 B;  1VD2 A;  2VRR B;  3TL5 A;  5BO4 B;  2JWZ A;  4ZDV A;  4KVG B;  1WH3 A;  2BKR B;  4KIK A;  4AOF A;  2MSE D;  4HWI B;  4ANX A;  1WXS A;  1Q5W B;  1WE6 A;  2KZR A;  1UBI A;  2CU1 A;  1S3S G;  4WQO B;  4FA6 A;  3RZW C;  2D2Q A;  3WIM A;  4AUQ C;  4EUT A;  5LXH A;  4KV2 A;  4F7Z A;  2JRI B;  4IW0 A;  5DCN A;  4MDK E;  3R66 C;  2MBH A;  1WJ6 A;  4DHZ B;  3S2A A;  2V1Y A;  2LVQ A;  2BYV E;  4HDQ A;  2AEH A;  2R2O A;  5D2M B;  4W9F A;  4DK5 A;  4GSW A;  1YQB A;  3DQV A;  3QA8 A;  1MG8 A;  4HCN B;  2N7D A;  4DDI D;  5CHV C;  1F9J A;  3M95 A;  4KSK C;  3VTW A;  4URK A;  3R7R A;  5G2N A;  2LUE A;  4HK2 A;  5FR6 A;  1FXT B;  2CHZ A;  2XK5 B;  4A20 A;  2J0J A;  4ANU A;  2JZZ A;  3VUY A;  3TBL D;  4I6N B;  2D3G A;  3L16 A;  5IA7 A;  4W9C A;  1ZW7 A;  3ZVV A;  4JIO U;  2MRP A;  4BFR A;  2IO3 B;  1WM3 A;  2DZI A;  2C9W B;  2KVR A;  3NZS A;  2LVP A;  2KC1 A;  3HM6 X;  2DHZ A;  4GB9 A;  3OLM D;  4K81 A;  4BKG A;  3CMM B;  3CST A;  2EMS A;  4FHK A;  2GMI C;  5JHA A;  2I1K A;  4DHJ D;  2ZZP B;  1LXD A;  4IUM B;  1E90 A;  4MEM A;  4RM8 A;  5DPT A;  2BYE A;  4MM3 A;  4LDT B;  4PS3 A;  2NCN A;  2O2V B;  2KAN A;  3AU5 A;  5D94 A;  2WX1 A;  4FJZ A;  3DDC B;  3APD A;  2DEN B;  4GDL B;  3VTU A;  1V5O A;  2KJR A;  2KQS A;  4EZK A;  2NBW B;  1WI0 A;  4IM2 A;  2PEA A;  2LI5 A;  2KFJ A;  5DPS A;  3PT2 B;  4WWN A;  2FID A;  5J2R A;  2DZM A;  2AL3 A;  2KFK B;  3JSV A;  4RM9 A;  4W9K A;  2MBQ A;  3PSE B;  3I3T B;  3PLV A;  1J0G A;  5CX3 A;  4W9E A;  2HE7 A;  2PJH A;  3N3K B;  3IG3 A;  2OOB B;  2N1V A;  3WAN A;  2K8B A;  4LCD E;  3RD2 A;  2AWT A;  3IFW B;  1P9D U;  2KLC A;  2KOX A;  3IBE A;  3DBS A;  3QHT A;  3L0W B;  3PGE A;  4XX5 A;  2LZ6 A;  1EF5 A;  3B1L X;  4IM0 A;  1PQS A;  5DPR A;  1L2N A;  3PHW B;  2V3S A;  1LM8 B;  1TTN A;  3DBR I;  3V6E B;  3APF A;  3KUC B;  2LRU A;  1Y8R C;  2IO0 B;  5DPW A;  4MEL A;  2K25 A;  1WF9 A;  2XK5 A;  3U7D A;  3EC8 A;  3Q3J A;  1E8Z A;  1GUA B;  2K39 A;  4NY0 A;  2KWV B;  4MJS B;  4XC2 A;  3TJP A;  2JVC A;  4BKS D;  2MX2 A;  3A9J B;  3M63 B;  3W1Y A;  2C7N B;  3AUL A;  4HXD A;  3U8Z A;  3VQI A;  1C3T A;  1V6E A;  2MA9 B;  1XT9 B;  3X0W A;  3JVZ X;  2ZNV B;  4NQK E;  2N9E B;  2GBM A;  2Z0E B;  3VVW B;  1OEY A;  4II2 B;  1P3Q U;  1XQQ A;  2L05 A;  3H6N A;  3N32 A;  4F1S A;  3AXC A;  4HJK A;  2J0K A;  4WJP A;  2J0M A;  1S1Q B;  2J7Q B;  4EZL A;  2MBO A;  2IBI B;  1WJN A;  2ZPY A;  3ZNZ B;  2KJ6 A;  2BPS A;  2O2V A;  4CO7 A;  1K8R B;  1OTR B;  3T8M A;  4G11 A;  1YX6 B;  2AL6 A;  4HDO A;  5HKH A;  3DVN V;  2M8S A;  4GDL A;  4HPM B;  2O6V A;  2KK8 A;  3ZRC A;  2N9X A;  2NS5 A;  1A5R A;  2KLG A;  5AZH A;  3ML9 A;  2C7M B;  4DHJ B;  3Q3F A;  4I6L B;  1EO6 A;  5C23 A;  1KOT A;  2KFK A;  1Q1O A;  2N9P C;  4FJV B;  2CKH B;  5J18 A;  3APC A;  2KWU B;  2OJR A;  4JGH B;  3M62 B;  2LD9 A;  2GBR A;  4GU2 A;  2KC2 A;  4ZYN A;  3JSV B;  1D3Z A;  2MW5 A;  1KJT A;  2GBN A;  4FHJ A;  2REX A;  2FCN A;  4IWP A;  4K1R B;  2LXC A;  2L3Z A;  3GZN I;  1QZE A;  1J8C A;  2G4S A;  2YLM A;  3CSF A;  3ZIM A;  2NR2 A;  3OAW A;  4G0N B;  3SDL C;  3ENE A;  3KUD B;  2CHX A;  1LQB A;  4BOZ B;  2JY6 A;  1Z2M A;  4KZC A;  3KYC D;  4MGK E;  4RMA A;  5LLI A;  3D32 A;  4M0W B;  5CHW A;  1VCB A;  5JZE B;  2IY0 B;  5C1Z A;  1WFY A;  2GBK A;  4MJS A;  2BYF A;  5AZF A;  1HE8 A;  4NNJ B;  2LVO A;  3A9J A;  1WRD B;  3B0A A;  3DCG A;  1CMX B;  2FIF A;  1WY8 A;  2MQJ A;  4MGY E;  2L0F A;  2GBJ A;  2LWP A;  2LRW A;  3PRE A;  4BBN F;  4EFO A;  1V80 A;  2BF8 B;  3HM3 A;  5JH5 C;  3R7Q A;  2JF5 A;  3UIN B;  2NVU I;  1WXM A;  4GMV A;  4FAD A;  1NI2 A;  2FCM A;  3QAR A;  2CS4 A;  3IHP C;  3DVN U;  4HVB A;  1AAR A;  2CR5 A;  2KDE B;  3TMP B;  4W9I A;  1R4M I;  1WMH B;  3A9K B;  1SIF A;  2L00 B;  2I1J A;  2D10 A;  2DX5 B;  4AP4 C;  2WWZ A;  3L10 B;  4BOS C;  2FUH B;  3H7P B;  4TKN A;  3VUW A;  3UGB B;  4J6I A;  2W9N A;  4B9K A;  2A5U A;  1YX5 B;  3ZO5 B;  4JLC A;  3PRM B;  1V2Y A;  2O6V B;  2DYM A;  4LJP B;  1G6J A;  4DWF A;  2RSU A;  3DVG Y;  2DYB A;  2LAS A;  2KX0 A;  2L0T A;  3RUL A;  1H8C A;  1IPG A;  1WX7 A;  2UWQ A;  3W1S A;  2K1F A;  2PE6 B;  4NJ6 A;  2MBB B;  2LJ5 A;  2FNJ B;  4GGQ A;  1P0R A;  4NQL B;  2A4Z A;  3WA0 A;  3LDZ E;  4FJY A;  3EFU A;  1GG3 A;  4G50 A;  1EUV B;  3P2B A;  2KMA A;  1ISN A;  3PRZ A;  3KVF B;  1RAX A;  5E6O A;  2JRH A;  3NY5 A;  2Y5B B;  1V5T A;  1WX9 A;  3QX1 A;  3IVF A;  4GN1 A;  2FAZ A;  4EOY A;  1JRU A;  2PE9 A;  3UIO B;  3RZF A;  5D6J B;  4ICU A;  3H1U A;  3QQ8 B;  2L8J A;  2M17 A;  4MGI E;  3C0R B;  1WM2 A;  3PS6 A;  3ECI A;  1GC7 A;  1NBF C;  3VHT C;  3AU4 A;  2K8C A;  2ZVO A;  4W9D A;  3LJ3 A;  4NAW A;  1V49 A;  2N4F A;  1WGY A;  5CTR C;  2K6D B;  3PHX B;  3X23 A;  1GJZ A;  2RD0 A;  1E7U A;  2MLB A;  4HCP B;  4NJ7 A;  4PS7 A;  2KO3 A;  1Q0W B;  2GOW A;  2IO1 B;  4E74 A;  4DDG D;  3SD5 A;  3ZNH B;  2BWE S;  1XD3 B;  4TUU A;  1YD8 U;  4IWQ A;  2IZV B;  1WGG A;  2K8H A;  4EZJ A;  3VFK A;  1UD7 A;  4B6W A;  4BKS A;  3U30 A;  1WR1 A;  3WAM A;  2RPQ A;  1WMH A;  3PTF C;  3A9K A;  3QCA A;  1WXV A;  4IWO A;  4JL9 A;  2M4N A;  2LGD A;  2MBE A;  3VXW A;  1KLV A;  3O65 B;  5TR5 A;  4KDI C;  3RUI B;  2KHW B;  3ALB A;  3H7P A;  1YIW A;  2ZNV C;  4EEW A;  1GNU A;  2IO2 B;  4BKT A;  4W9J A;  4II3 B;  2V4L A;  2JPH A;  3HIZ A;  1E8Y A;  1WGH A;  4LDT D;  3VH4 B;  3L54 A;  2G3Q B;  1UGM A;  2N1W A;  3ZTC A;  4HLE A;  2RGF A;  4JQW C;  5KHQ A;  2N7E A;  3DBL I;  4A3O A;  2Z59 B;  3V61 A;  3VUX A;  2DZK A;  4K7U A;  4K7W A;  4DHZ E;  2KKC A;  3VH3 B;  2C5L C;  2ZJD A;  4IG7 B;  5G55 A;  4HPL B;  3TCA A;  2ZVN A;  1E5W A;  1WXA A;  4N9F 4;  2JUO A;  2ZCC A;  4PS8 A;  2MP2 B;  3MJW A;  3ML8 A;  2NBV B;  4GOC A;  4MSQ B;  4GIV A;  3JYU A;  3ONS A;  1WGD A;  3VDZ A;  1OGW A;  3QJZ A;  3QK0 A;  3WAO A;  4G3X B;  2NBU A;  1YJ1 A;  4NPN A;  2Z0D B;  4PYZ A;  3A33 B;  3L13 A;  3W1S C;  2LGY A;  3PLU A;  2IYD B;  4ANW A;  1UH6 A;  3NZU A;  2WX0 A;  3DOW A;  4W9H A;  3UQB A;  1OEY J;  3KW5 B;  3NHE B;  3NS8 A;  3CF6 E;  3EHV A;  1E8X A;  4NAW B;  3L17 A;  4ZRI A;  4CHK A;  4I6P A;  4OVV A;  4FBJ B;  1P1A A;  4AWJ A;  4FLH A;  3ZNG C;  4TQ0 A;  3UQA A;  2KNB A;  3SHQ A;  5AEK B;  4FUL A;  4OVU A;  2R2Q A;  1RRB A;  1V81 A;  2WYQ A;  4WWO A;  5KHO A;  2HJ8 A;  3A4R A;  3NOB A;  2JZ3 B;  1V9J A;  4PYU A;  2BKF A;  3RYT A;  2D11 A;  2KDB A;  1SE9 A;  3WAL A;  1UEL A;  2KQ7 A;  4DBG A;  3ZNI D;  1R4N I;  3ZW3 A;  3GOE A;  3QWZ B;  3M3J A;  3ZDT A;  4WJQ A;  4W9L A;  1WZ0 A;  4E3C A;  4EKU A;  2M0X A;  1WJ4 A;  1TZ1 A;  5JHB A;  2KTR B;  2KX3 A;  1UBQ A;  1LFD A;  2D07 B;  3A4S C;  5D7G A;  2KWC A;  2YVC A;  3A1Q A;  1WJU A;  3KUZ A;  1L7Y A;  3R3M A;  1UZX B;  1ZGU B;  3SU8 X;  4F8C B;  5LXI B;  2DYO A;  2EMT A;  5E6N A;  4XZ4 A;  3UF8 A;  2KDI A;  3AI5 A;  3V60 A;  4BBN C;  3EEC A;  3H9D A;  4AJY B;  1RFA A;  3OJ3 A;  3ZDM C;  1I35 A;  2MP2 A;  1WIA A;  1V86 A;  4GDK A;  2KXJ A;  4KDL B;  4IM3 A;  3RCZ A;  3QAQ A;  1X1M A;  2BWF A;  2MWS B;  2JXX A;  3PZD A;  2KTF A;  4K7S A;  1EF1 A;  2C60 A;  3K9O B;  4A3P A;  2JT4 B;  1M94 A;  1SGH A;  1KM7 A;  1P98 A;  1TGZ B;  2IY1 B;  2NPT B;  2HD5 B;  3OJ4 B;  3ZTD A;  4WJO A;  3ZRF A;  3MHS D;  3V62 A;  3JW0 X;  3MTN B;  1I42 A;  4CYE A;  2BGF A;  2M1M A;  3PVL A;  4P7I A;  2AYO B;  5GMV A;  3VAW A;  4FN2 A;  3VTV A;  3ZLZ A;  4ASW C;  4KIK B;  1RLF A;  4MSM B;  3HK0 A;  1U4A A;  3B08 A;  4GXB A;  1OQY A;  2PPH A;  2G4D B;  3DBH I;  2XEW A;  3N30 A;  4ZRJ A;  1WX8 A;  4DXA B;  2ASQ A;  2UYZ B;  4M8N A;  1IP9 A;  2L7R A;  2LGX A;  2LXA A;  2KDF B;  3PRP B;  1TBE A;  4TQ1 A;  2DAF A;  2ZPN A;  4W9G A;  2DZJ A;  2FCS A;  2XBB C;  4KZ0 A;  1GC6 A;  5EDS A;  3KH0 A;  3ZKJ C;  2KJH B;  5IAA C;  5J17 A;  1WE7 A;  1WYW B;  3BIN A;  3DVG X;  3DPD A;  2G45 B;  1E8W A;  2RR9 A;  3PV1 A;  4ICV A;  4LJO B;  4X57 B;  2EKE C;  4WWP A;  2KTR A;  4YL8 A;  2MCN B;  3K9P B;  4TV3 A;  2CHW A;  5CHF A;  1NDD A;  1WR6 E;  3KYD D;  2KN5 A;  1Z5S B;  2KMC A;  2QHO A;  1H4R A;  5E6P A;  2KD0 A;  4WJN A;  4AJW A;  1J19 A;  1BT0 A;  4MGZ E;  5L95 C;  1C1Y B;  3QIJ A;  4KSL C;  2C7H A;  3A1Q B;  4IC7 B;  4M8M A;  4E71 A;  2K6Q A;  1WZ3 A;  3UIP B;  3L08 A;  3PPA A;  2ZCB A;  2FCQ A;  2O6V D;  2L76 A;  3T9L A;  1ZKH A;  2HTH A;  4BVU C;  3TIX A;  3H7S A;  4WAA A;  3HHM A;  2B3A A;  5AZG A;  3V6C B;  3ZUN A;  4B95 A;  2ZEQ A;  3QC8 B;  4GDK B;  4ZRK A;  4MH0 E;  2NPT A;  3BY4 B;  4ANV A; 
#chains in the Genus database with same CATH topology
 1T0Y A;  2WXP A;  1BML C;  2VRR B;  2JWZ A;  4ZDV A;  1WH3 A;  2BKR B;  4A6Q A;  2MSE D;  2KZR A;  4WQO B;  1IUE A;  2D2Q A;  3RZW C;  1I4Q A;  5LXH A;  2JRI B;  4IW0 A;  1WJ6 A;  3AEE B;  4DHZ B;  3S2A A;  4OZB A;  2W82 A;  3QA8 A;  4HCN B;  5HI1 A;  1F9J A;  3VTW A;  3ZXV A;  4JE3 B;  4P6V F;  2V3P A;  2XK5 B;  3TBL D;  2LUM A;  3DBH B;  3V3X A;  2MRP A;  1WGK A;  1WM3 A;  2DZI A;  2KVR A;  3NZS A;  2LVP A;  4GB9 A;  3U4E G;  3Q8F A;  4K81 A;  1PFD A;  2GMI C;  1L0Y B;  3TEX A;  3N20 C;  2BYE A;  4LDT B;  4HPP A;  2KAN A;  1HXY D;  4GDL B;  4LNF A;  2KFJ A;  5DPS A;  3PT2 B;  2BVC A;  1EU3 A;  4ITK A;  3JSV A;  2ICI A;  5IN7 A;  2MBQ A;  1J0G A;  3PLV A;  5IO9 A;  4W9E A;  2PJH A;  3IG3 A;  3RD2 A;  4LCD E;  4IOI E;  3IFW B;  4C80 A;  1P9D U;  1EM7 A;  3B1L X;  4IM0 A;  3APF A;  3KUC B;  1E7P B;  3Q8A A;  2XK5 A;  1YN3 A;  1XLP A;  2W55 A;  1TZO A;  3A9J B;  3M63 B;  3J9C A;  3U8Z A;  3AUL A;  2MA9 B;  4NQK E;  2N9E B;  2Y3A A;  1OEY A;  2J53 A;  2L05 A;  3AXC A;  2J7Q B;  1C4C A;  2MBO A;  4XDC A;  2ZPY A;  3P4P B;  1K8R B;  2RMM A;  1YX6 B;  3IT6 B;  4GDL A;  2N9X A;  3ML9 A;  3AN1 A;  2AQ1 B;  4AS1 A;  1EO6 A;  1JRO A;  1TIF A;  4QAY A;  1C78 A;  4ZYN A;  1JWS D;  3Q14 C;  5FK9 C;  2LXC A;  4LNN A;  2YLM A;  1WYG A;  3KWL A;  2NR2 A;  3OAW A;  3SDL C;  3ENE A;  4KZC A;  3NVV A;  4M0W B;  5CHW A;  1VCB A;  5C1Z A;  2BYF A;  4NNJ B;  3A9J A;  3B0A A;  2MHJ A;  1WY8 A;  4MGY E;  1XXG A;  2BF8 B;  5JH5 C;  4HRO A;  2NVU I;  1F77 A;  4HKZ E;  4KGS A;  4FAD A;  1TS4 A;  2CU3 A;  3RNB C;  2FCM A;  3QAR A;  1TY0 A;  3IHP C;  4CQN A;  3NVW A;  2CR5 A;  4XDD A;  3BYY B;  2BS3 B;  1P7E A;  2L00 B;  2I1J A;  3IAS 1;  2FUH B;  4HRS A;  1QT9 A;  2WDV B;  2QJL A;  2W9N A;  2A5U A;  1C79 A;  2LAS A;  2IPK D;  2UWQ A;  2FUG 1;  2PE6 B;  2LJ5 A;  2R61 A;  3AEB B;  3BWU D;  4GGQ A;  1QQR A;  4WQM A;  3LDZ E;  3PRZ A;  2QC8 A;  5E6O A;  2JRH A;  3QX1 A;  2FAZ A;  4EOY A;  3RZF A;  5D6J B;  2M17 A;  4M0W A;  1WM2 A;  3B9J A;  3ECI A;  1GC7 A;  2IGD A;  3AU4 A;  4KKI A;  3AEG B;  3LJ3 A;  2BBC A;  4NAW A;  2N4F A;  2K6D B;  3X23 A;  1GJZ A;  1E7U A;  2KQ4 X;  2KYW A;  2GOW A;  4E74 A;  3DHI C;  1EWC A;  2K22 A;  5JXV A;  2QIE B;  4IWQ A;  1WGG A;  2KAJ A;  1STE A;  4B6W A;  3U30 A;  1YJI A;  3QCA A;  1HZ5 A;  3VXW A;  3CWI A;  5TR5 A;  4KDI C;  2OED A;  2KHW B;  4L2Y A;  1GNU A;  4II3 B;  3O13 A;  2JPH A;  3DHG C;  3P4S B;  2D3B A;  2G3Q B;  1TS5 A;  1IBX B;  4HLE A;  5KHQ A;  4JQW C;  4A3O A;  4WWM A;  4DHZ E;  2ZJD A;  3TCA A;  1E5W A;  1F2R C;  1V8C A;  1HQR D;  4ZRP A;  2XN9 C;  3LXF A;  2ZCC A;  3R8B A;  3N1Y C;  1NVI D;  4XGA B;  3JYU A;  3QK0 A;  4KX6 B;  1YQ4 B;  4NPN A;  3AE5 B;  1L4D B;  3AE8 B;  2WX0 A;  5H92 C;  3SFD B;  1OEY J;  1DOI A;  4CHK A;  4I6P A;  2PVG C;  4OVV A;  5EE0 A;  4FBJ B;  4FLH A;  3ZNG C;  3BII D;  2G1E A;  1KLG D;  2W54 A;  3SHQ A;  5AEK B;  1V81 A;  2AX5 A;  5E6J A;  2X38 A;  4P1C C;  1V9J A;  2JZ3 B;  3RYT A;  4BZA A;  1UEL A;  1R4N I;  3ZW3 A;  3M3J A;  4PK1 A;  1GAQ B;  1WZ0 A;  1WJ4 A;  3BK2 A;  2KTR B;  1L0V B;  2D07 B;  3A4S C;  2KWC A;  2YVC A;  1IBX A;  1VZ7 A;  3A1Q A;  1UZX B;  3IXS A;  3BVZ A;  5E6N A;  1FNV A;  3AI5 A;  2PVO D;  3C8Y A;  3ZDM C;  1WIA A;  1WRI A;  1I4H A;  4KKJ A;  1AN8 A;  2BWF A;  3PZD A;  2KTF A;  4K7S A;  3K9O B;  1EF1 A;  3HVD A;  1SSN A;  2ON8 A;  2JT4 B;  1K51 A;  1SGH A;  1I42 A;  3PVL A;  4JWS C;  4RFB A;  3UQB A;  4GXB A;  2LJI A;  3DBH I;  3P63 A;  1ZUD 2;  3Q8C A;  1L6U A;  2WNM A;  3SR6 A;  2ASQ A;  2LXA A;  1CJE A;  4RH6 A;  4W9G A;  3RI7 C;  2FCS A;  4KZ0 A;  5EDS A;  1VDV A;  3ZKJ C;  2G45 B;  1E8W A;  2EKE C;  2KTR A;  3K9P B;  2CHW A;  2KN5 A;  3P1M A;  3MHZ A;  4HEA 1;  2QHO A;  1H4R A;  5E6P A;  4M8M A;  1SE3 A;  3UI3 A;  4S17 A;  2JU6 X;  3DWG C;  1SF0 A;  2BS2 B;  2SEB D;  3I57 A;  2O6V D;  3B2F A;  3H8H A;  1ZKH A;  4WAA A;  3QC8 B;  4MM3 B;  4MH0 E;  3BY4 B;  4WIP A;  3SEB A;  4B0M A;  2WDT B;  4J3O D;  1YMH E;  4LLG M;  1JQ4 A;  5BO4 B;  4AOF A;  3HVZ A;  4HWI B;  4ANX A;  1WXS A;  1GB4 A;  1Q5W B;  3C19 A;  2CU1 A;  1RWS A;  1OFF A;  1S3S G;  4AUQ C;  2MBH A;  3SFE B;  1QLB B;  3VRA B;  2LVQ A;  4HDQ A;  2AEH A;  2R2O A;  3NVZ A;  2L83 A;  4GSW A;  3RNE C;  1N63 A;  5FKA C;  4DDI D;  2L52 A;  3MC8 A;  5CHV C;  4KSK C;  1L5P A;  3R7R A;  3VR8 B;  4A20 A;  4ANU A;  2J0J A;  2JZZ A;  3PZ7 A;  4YWG G;  2KWD A;  4W9C A;  5BMG A;  4BFR A;  2C9W B;  3CST A;  3BK1 A;  4BAX A;  4DHJ D;  1LXD A;  4IUM B;  2WQY B;  4MEM A;  4RM8 A;  5DPT A;  4MM3 A;  4PS3 A;  1N60 A;  4FXC A;  1RM6 C;  5D94 A;  2WX1 A;  1F0Z A;  4Q2J A;  2MH7 A;  2KQS A;  2NBW B;  1VLB A;  4IM2 A;  2JYT A;  2FID A;  5J2R A;  1HTQ A;  4W9K A;  5CX3 A;  2HE7 A;  2N1V A;  3KWV A;  2AWT A;  1PDX A;  1BXT A;  4M02 A;  3QHT A;  2LZ6 A;  1EF5 A;  2MEK A;  1PQS A;  1L2N A;  1KF6 B;  5TSS A;  4YSY B;  1YJJ A;  5DPW A;  4MEL A;  1FRR A;  4ARI A;  3U7D A;  3R2I A;  1E8Z A;  1GUA B;  4BKS D;  3URY A;  2C7N B;  1T5X D;  3VQI A;  1XT9 B;  4OZC A;  2Z0E B;  4JX1 C;  1SEB D;  2Z8L A;  1XQQ A;  3H6N A;  2J0M A;  1S1Q B;  2IBI B;  2KJ6 A;  4G11 A;  2AL6 A;  1M4V A;  3ZRC A;  2WXI A;  2VZK D;  1KOT A;  2N9P C;  1Q1O A;  2WXH A;  2NTS A;  2CKH B;  1EU4 A;  1GPX A;  4JGH B;  2GBR A;  3NZ3 A;  4GU2 A;  2KC2 A;  3JSV B;  1KJT A;  2GBN A;  2REX A;  2FCN A;  4K1R B;  1I4R A;  1J7C A;  3ETR A;  3GZN I;  2H89 B;  5C3J B;  4HKQ A;  4G0N B;  4MAC A;  1TS2 A;  2K5P A;  3KUD B;  4A90 A;  4BOZ B;  4DQO C;  2JY6 A;  1Z2M A;  4WUR A;  4JWU C;  4L23 A;  5LLI A;  3D32 A;  5JZE B;  2IY0 B;  2N9K A;  2ZW1 A;  5AZF A;  1HE8 A;  2LVO A;  2N0S B;  5EE9 A;  4MT5 A;  2LWP A;  4BBN F;  1E6E B;  1V80 A;  3HM3 A;  5T8I A;  2JF5 A;  1Y56 A;  4GMV A;  3DVN U;  3MC9 A;  2KDE B;  3TMP B;  3ZYY X;  4RNA A;  3TSS A;  1T0R C;  3A9K B;  2WWZ A;  1HA5 A;  3VUW A;  4JLC A;  1V2Y A;  1ZDX A;  4LJP B;  4YTN B;  3DVG Y;  3U7Z A;  2X8X X;  3RUL A;  1WX7 A;  2W3S A;  2K1F A;  2K3U A;  4NJ6 A;  1GB1 A;  1SXT A;  1HTO A;  4FJY A;  3EFU A;  4G50 A;  3FC4 A;  1RAX A;  3NY5 A;  2Y5B B;  1FFU A;  1V5T A;  1FXI A;  1JRU A;  2DBY A;  1C77 A;  3UIO B;  4ICU A;  3H1U A;  3PS6 A;  1JRP A;  1V49 A;  1WGY A;  2JZP A;  5CTR C;  1WWT A;  3L4P A;  4YT0 B;  2MLB A;  4HCP B;  4NJ7 A;  1Q0W B;  3Q2A C;  2PMV A;  3SD5 A;  4RGN A;  4TUU A;  2PLP A;  1YD8 U;  2WXO A;  2WXG A;  1MPE A;  1KLU D;  4OW0 A;  3Q69 A;  3PTF C;  3A9K A;  1WXV A;  4IWO A;  4JL9 A;  2M4N A;  1MHX A;  2MBE A;  2QSD A;  2NTT A;  2IO2 B;  4LDT D;  1UGM A;  2N7E A;  3U2S C;  4K7U A;  4K7W A;  2E3T A;  2ZVN A;  1L6V A;  4KGT A;  1WXA A;  1D5Z C;  2JUO A;  2PTL A;  3GP7 A;  2BS4 B;  3MJW A;  1FEH A;  3ML8 A;  4GOC A;  1LO5 D;  4GIV A;  3ONS A;  1WGD A;  3N9Y C;  3ZJT A;  3QJZ A;  3P4R B;  5G5G A;  1FNU A;  4G3X B;  4ZHO A;  3TEY A;  2NBU A;  4PYZ A;  3L13 A;  4W9H A;  1KTK A;  2LHE A;  3KW5 B;  4NAW B;  3CF6 E;  3EHV A;  4AWJ A;  2KNB A;  4NAM A;  4PT5 A;  4OVU A;  4C56 C;  2KDB A;  1SE9 A;  2Y5P A;  2I38 A;  3B2G A;  4DBG A;  2V9H A;  3ZNI D;  1C4A A;  3QWZ B;  3I9V 1;  4WJQ A;  5MPO A;  4E3C A;  1UBQ A;  1LFD A;  4USA A;  1L7Y A;  2WXN A;  1ZGU B;  3R3M A;  3W9C B;  4ZOH C;  4XZ4 A;  1DGJ A;  3HRD D;  2Y5C A;  3VR9 B;  4N58 A;  3I5J C;  4KDL B;  4IM3 A;  3RCZ A;  3QAQ A;  1X1M A;  2JXX A;  1VZ8 A;  1M94 A;  1KM7 A;  2INN E;  4N59 A;  3OG5 A;  1FRD A;  1D5M C;  3MTN B;  2BB5 A;  3DBL B;  2AYO B;  3VAW A;  3ZLZ A;  4KIK B;  1QOG A;  3B08 A;  3VRB B;  2V0G A;  2G4D B;  4RGT A;  4ZRJ A;  2YEP B;  4M8N A;  2LGS A;  2L7R A;  1FXA A;  2KDF B;  3GZN B;  1TBE A;  1PGA A;  2DAF A;  2DZJ A;  3KH0 A;  5IAA C;  1WE7 A;  1WYW B;  4WWP A;  2MCN B;  1FIQ A;  1MG4 A;  1ZXI A;  5CHF A;  1WR6 E;  3KYD D;  4AJW A;  2KD0 A;  1J19 A;  2PIA A;  2KT7 A;  1C1Y B;  2ZW0 A;  3AED B;  4KSL C;  2C7H A;  3A1Q B;  3AH7 A;  2I2Y A;  2LFI A;  5AUI A;  3H7S A;  5AUK A;  5FR3 A;  2SAK A;  2ZEQ A;  1JWM D;  4ZRK A;  1I4P A;  4ANV A;  1FPY A;  1T0Q C;  1WGR A;  1E7V A;  5H8Y E;  5L83 A;  3TEW A;  1IYF A;  2DAJ A;  3RT3 B;  1VD2 A;  2LMC A;  2G9H D;  3TL5 A;  4KIK A;  1NYR A;  1UWM A;  3GE8 C;  1WE6 A;  2L1A A;  1UBI A;  4FA6 A;  3WIM A;  4EUT A;  4KV2 A;  4F7Z A;  1TKY A;  5DCN A;  4MDK E;  3R66 C;  2V1Y A;  3KLS X;  4L1B A;  1N62 A;  1MG8 A;  5LNK 1;  2WXR A;  2N7D A;  1CQV A;  2LUE A;  4HK2 A;  2JWU A;  5FR6 A;  2CHZ A;  4YTM B;  2MJE A;  3Q3O C;  4I6N B;  2D3G A;  5IA7 A;  2XNA C;  3ZVV A;  4JIO U;  1VRA B;  1ET9 A;  2DHZ A;  1AWD A;  1QOB A;  4BKG A;  1EWY C;  1UNS A;  4FHK A;  2ZZP B;  4RCO A;  1E90 A;  2V3N A;  2D5G A;  1D4B A;  1XEE A;  2NCN A;  2O2V B;  3AU5 A;  5BMI A;  2KAC A;  3DDC B;  2DEN B;  5HG2 A;  4AQ7 A;  1V5O A;  4EZK A;  3RNC C;  1I4G A;  2LI5 A;  2M56 B;  2DZM A;  5IOI A;  2KFK B;  3FAH A;  3PSE B;  3I3T B;  3AE9 B;  4YSZ B;  2WXJ A;  3N3K B;  3WAN A;  1CZP A;  3IBE A;  2KOX A;  1UF0 A;  2WXK A;  4XX5 A;  4REZ A;  1L0X B;  3PHW B;  2V3S A;  2WU5 B;  2JYE A;  4H2A A;  1XLN A;  2LRU A;  2IO0 B;  2ACZ B;  2K25 A;  2FBW B;  3ZGZ A;  2K39 A;  1MJD A;  2KWV B;  4XC2 A;  3TJP A;  2DWQ A;  1NYQ A;  2JVC A;  4TMA B;  2MX2 A;  2BW2 A;  1C3T A;  1V6E A;  2HDE A;  3X0W A;  1TJE A;  3VVW B;  2GBM A;  1P3Q U;  3DWM A;  3N32 A;  4F1S A;  1ZOY B;  4HJK A;  2J0K A;  4EZL A;  1WJN A;  5IKC M;  2O2V A;  3GS2 A;  4CO7 A;  3T8M A;  4NJC A;  4HDO A;  2OHF A;  3DVN V;  2M8S A;  2O6V A;  2NS5 A;  1A5R A;  1SBB B;  5AZH A;  2C7M B;  4DHJ B;  1E10 A;  3Q3F A;  5C23 A;  2KFK A;  3PO0 A;  2LD9 A;  1D3Z A;  2WDR B;  1JCK B;  2EKI A;  4XWW A;  3AEC B;  1DOY A;  1QZE A;  2G4S A;  3ZIM A;  3LYY A;  3U52 E;  4ZHP A;  2CHX A;  4ZRQ A;  4M00 A;  3KYC D;  4MGK E;  4RMA A;  3EUB 2;  3Q3M C;  1MI0 A;  1WFY A;  2GBK A;  1WSP A;  3NRZ A;  1F2R I;  3DCG A;  1CMX B;  2FIF A;  2MQJ A;  4XE0 A;  2LRW A;  3PRE A;  5G5H A;  5HHD G;  1P7F A;  2IDY A;  1NEK B;  4HVB A;  3DBR B;  4IKG A;  3I63 C;  4UDU C;  1R4M I;  1SIF A;  2GI9 A;  2D10 A;  4AP4 C;  3L10 B;  4BOS C;  4KGR A;  2IGH A;  4EE2 A;  4B9K A;  1YX5 B;  3ZO5 B;  1RFK A;  1KFY B;  2WXQ A;  1JW9 D;  4A55 A;  2DYM A;  2GRI A;  1YNT E;  2HJ1 A;  4DWF A;  1ZE3 D;  2RSU A;  2FE8 A;  1G6J A;  1FFV A;  3W1S A;  1N5X A;  1P0R A;  3GE3 C;  4US8 A;  2A4Z A;  3WA0 A;  1GG3 A;  1EUV B;  1ISN A;  1T6B X;  3W2D A;  1WX9 A;  2KN4 A;  2PE9 A;  3QQ8 B;  3VHT C;  2ZVO A;  4W9D A;  4B0E A;  1C76 A;  2WHI A;  4PS7 A;  4US9 A;  4DDG D;  4MH8 A;  2WGS A;  1XD3 B;  4HJG E;  2OJW A;  4EZJ A;  3MFG A;  3E9S A;  1UD7 A;  4BKS A;  3WAM A;  3W5V B;  2LGD A;  3O65 B;  2V4I B;  2JXT A;  4IDI A;  1ENF A;  3ALB A;  2B76 B;  2M19 A;  4EEW A;  4W9J A;  2V4L A;  3ZJV A;  3HIZ A;  3VH4 B;  1YOV B;  3BZD B;  3DBL I;  2Z59 B;  3V61 A;  3VUX A;  3Q8E A;  3TUO A;  1NI3 A;  2MP2 B;  2N9L A;  1AYF A;  2NBV B;  1N5W A;  1UUP A;  1IGC A;  3VDZ A;  1WXQ A;  1OGW A;  1D6E C;  2VH1 A;  1YJ1 A;  3W1S C;  2WXF A;  2GLS A;  2LGY A;  4ANW A;  1UH6 A;  1K52 A;  3NHE B;  1C4P A;  3L17 A;  2QMT A;  1B1Z A;  1TY2 A;  3UQA A;  3AE6 B;  4FUL A;  2R2Q A;  1RRB A;  2WYQ A;  4WWO A;  1YN4 A;  3T3O A;  1K50 A;  1MFW A;  4PYU A;  2BKF A;  3AE2 B;  2H88 B;  4WAF A;  3GOE A;  1YN5 A;  3ZDT A;  3MJ5 A;  2M0X A;  4M01 A;  4DXG A;  5EE3 A;  3KUZ A;  5LXI B;  1QOF A;  2WDQ B;  2DYO A;  1F1H A;  2EMT A;  2RPV A;  3UF8 A;  2KDI A;  3V60 A;  3N1Z C;  4BBN C;  1XO3 A;  1C9F A;  1RFA A;  3OJ3 A;  2MP2 A;  1TT5 B;  1V86 A;  2KXJ A;  4GDK A;  1QIL A;  3RNF C;  4A3P A;  1L4Z B;  2C60 A;  5I4D A;  1TGZ B;  3ZTD A;  2HD5 B;  3ZRF A;  3MHS D;  4LTU A;  3JW0 X;  1OQQ A;  3P4Q B;  4D2K A;  2BGF A;  2M1M A;  5GMV A;  3VTV A;  4ASW C;  3CIR B;  2RDB C;  4O1N A;  4MSM B;  2K0P A;  3HK0 A;  1U4A A;  2XEW A;  3AE1 B;  4DXA B;  2UYZ B;  1IP9 A;  3IT4 B;  2AQ2 B;  3PRP B;  2CJO A;  4TQ1 A;  4R3D A;  2JSV X;  2XBB C;  2ONQ A;  3TEZ A;  3DHH C;  3BYT B;  1FD6 A;  1FNW A;  4C7Y A;  3PV1 A;  4LJO B;  4ICV A;  4X57 B;  2IGG A;  4TV3 A;  3V05 A;  1Z5S B;  3MP9 A;  2QEJ C;  5L95 C;  3ZXR A;  3QIJ A;  1KRH A;  2K6Q A;  5D3D A;  3UIP B;  3PPA A;  4P1B C;  5C2T B;  2HTH A;  4BVU C;  1QF6 A;  3HHM A;  1T3Q A;  2B3A A;  1R4M B;  3RFZ B;  4A9A A;  1Q10 A;  1ZP0 B;  3P42 A;  4LNO A;  4C7Z A;  3WAP A;  3ZJU A;  4KVG B;  1D5X C;  1DYQ A;  3EA6 A;  1SJE D;  3WCQ A;  1F52 A;  1GOZ A;  1TKE A;  2WU2 B;  2BYV E;  5D2M B;  4W9F A;  1TKG A;  1YQB A;  3DQV A;  1J7B A;  3M95 A;  4URK A;  5G2N A;  1N61 A;  1FXT B;  3VUY A;  3L16 A;  1ZW7 A;  2WXL A;  2IO3 B;  3ABV B;  2KC1 A;  2J4X A;  3HM6 X;  3AE7 B;  1XLQ A;  1TYG B;  3OLM D;  1E9M A;  3CMM B;  2EMS A;  1FM0 D;  2PW9 A;  1V97 A;  3HUI A;  2I1K A;  5JHA A;  4OVZ A;  5HFY A;  1T0S C;  1TS3 A;  4FJZ A;  3APD A;  4RF1 A;  3VTU A;  2KJR A;  2K9X A;  1WI0 A;  2PEA A;  2WS3 B;  4WWN A;  2AL3 A;  5BYS A;  1LGR A;  4RM9 A;  2BB6 A;  4JPS A;  3Q3N C;  2OOB B;  4ACF A;  2K8B A;  2KLC A;  3DBS A;  4YXD B;  3L0W B;  1XLO A;  3PGE A;  5DPR A;  4LNK A;  2LHD A;  1LM8 B;  1TTN A;  3DBR I;  3V6E B;  1Y8R C;  2W3R A;  1WF9 A;  3FKY A;  3KQ4 A;  3EC8 A;  3Q3J A;  4NY0 A;  2GB1 A;  4MJS B;  5BMH A;  3W1Y A;  2DLB A;  3E56 A;  4HXD A;  1PGB A;  1I7H A;  1UWX A;  3JVZ X;  1V1P B;  2ZNV B;  3BVM A;  1SE2 A;  4II2 B;  1ET6 A;  3IAM 1;  1B9R A;  4YTP B;  4WJP A;  3ZNZ B;  2BPS A;  1OTR B;  1QOA A;  5HKH A;  1AW7 A;  4HPM B;  1HZ6 A;  2KK8 A;  2KLG A;  1V1O A;  4I6L B;  4FJV B;  4LNI A;  5J18 A;  3APC A;  2KWU B;  2KMM A;  4WH4 A;  2OJR A;  3M62 B;  2MW5 A;  4FHJ A;  4IWP A;  2L3Z A;  3W5U B;  1J8C A;  3CSF A;  4ZYS A;  2INC C;  1LQB A;  3GB1 A;  4C4V B;  3MC0 B;  4MJS A;  3RNG C;  3AEA B;  1WRD B;  1ZPS A;  3N1X C;  5EE1 A;  1FMA D;  2L0F A;  2GBJ A;  1V1P A;  2EEL A;  4EFO A;  3R7Q A;  3UIN B;  1WXM A;  1NI2 A;  1PGX A;  4GLS C;  1R7S A;  2NMQ A;  2CS4 A;  2WP9 B;  1AAR A;  2L32 A;  3EFC A;  4W9I A;  1NEN B;  1WMH B;  2RDH A;  3NVY A;  2WLB A;  4RGM A;  2DX5 B;  1FCC C;  1PUT A;  3H7P B;  4TKN A;  2BT6 A;  3UGB B;  4J6I A;  1ZXH A;  3PRM B;  2O6V B;  4RGO S;  2DYB A;  1SB3 C;  2KX0 A;  2L0T A;  4LK0 M;  1H8C A;  1IPG A;  2D3C A;  2MBB B;  2QCZ A;  2FNJ B;  4NQL B;  4RF0 A;  2J52 A;  3AM9 A;  3P2B A;  2KMA A;  3KVF B;  3Q6B A;  2KVZ A;  4GN1 A;  2YEP F;  3IVF A;  4C4V A;  1ACC A;  2L8J A;  4MGI E;  3C0R B;  1NBF C;  2N7J A;  2K8C A;  1SIJ A;  1JAL A;  4K3B A;  3PHX B;  2RD0 A;  2LGI A;  2KO3 A;  2IO1 B;  1DOX A;  1ZDV A;  2BWE S;  3OWE B;  3ZNH B;  5IP4 D;  3FIL B;  2LEK A;  3NS1 A;  3RNA C;  2IZV B;  2K8H A;  1K53 A;  3VFK A;  1RYJ A;  2J42 A;  1WR1 A;  2RPQ A;  1WMH A;  5BYR A;  1KLV A;  2DNF A;  3AV8 A;  3RUI B;  3H7P A;  1YIW A;  2ZNV C;  4BKT A;  1KH0 A;  2Q5W D;  3R2T A;  1E8Y A;  1WGH A;  3AB5 A;  1N6Z A;  3L54 A;  4P16 A;  1SE4 A;  2N1W A;  3ZTC A;  2RGF A;  4YSX B;  3AMZ A;  2DZK A;  2KKC A;  3VH3 B;  4TSS A;  2C5L C;  4IG7 B;  5G55 A;  1YQ3 B;  4HPL B;  4NZL B;  4N9F 4;  2MJ3 A;  1JWA D;  4PS8 A;  3AE4 B;  2UU7 A;  2WXM A;  4MSQ B;  4K3C A;  3BVG A;  1ROE A;  3RPF C;  1XF5 L;  3WAO A;  5GXG B;  2Z0D B;  3A33 B;  3PLU A;  1E0Z A;  2IYD B;  3NZU A;  3DOW A;  3AEF B;  3LB8 C;  3NS8 A;  4DK5 A;  1E8X A;  4ZRI A;  1JWB D;  4XWT A;  1P1A A;  2JQR B;  3FIL A;  1MHH E;  2VH2 A;  4TQ0 A;  4C00 A;  3RN9 C;  1VZ6 A;  1XCQ L;  1UGJ A;  1JWU D;  5KHO A;  2HJ8 A;  3A4R A;  3NOB A;  2KDM A;  2IND C;  2D11 A;  2E6X A;  3WAL A;  2KQ7 A;  5D3I B;  2QDF A;  4W9L A;  5JHB A;  4OHJ A;  4EKU A;  1TZ1 A;  2KX3 A;  5D7G A;  3NG0 A;  1PYW D;  1WJU A;  1FCL A;  2D3A A;  3SU8 X;  4F8C B;  1FO4 A;  3AE3 B;  2M0A A;  3Q8B A;  3EEC A;  3H9D A;  5BYQ A;  4AJY B;  2AQ3 B;  2CJN A;  1I35 A;  2BTE A;  2RDG A;  1SJH D;  2MWS B;  2VZK B;  1P98 A;  1MVK A;  1BUI C;  2IY1 B;  2NPT B;  3OJ4 B;  4WJO A;  3V62 A;  1OQR A;  4CYE A;  2JX5 A;  3T3N A;  4P7I A;  2IJ0 A;  4FN2 A;  1RLF A;  2PKO A;  4N6E B;  1OQY A;  2PPH A;  1I4X A;  4OZA A;  4XYC A;  3N30 A;  1WX8 A;  2BQQ A;  2LGX A;  1IGD A;  3EGR A;  3RMK C;  2BYT A;  2ZPN A;  3PZ8 A;  1VR9 A;  1ESF A;  1GC6 A;  2KJH B;  5J17 A;  3BIN A;  3DVG X;  3DPD A;  1JML A;  2TSS A;  2RR9 A;  4YL8 A;  1HEZ E;  1NDD A;  1XCT L;  2KMC A;  4DXF A;  4WJN A;  1BT0 A;  4MGZ E;  4IC7 B;  4E71 A;  1WZ3 A;  1QKZ A;  3L08 A;  2QIL A;  3NJT A;  4ARC A;  2HTM E;  2ZCB A;  2MJD A;  4S0R A;  2FCQ A;  2L76 A;  3T9L A;  1A70 A;  3TIX A;  2INP E;  3ZQ4 A;  1CK1 A;  5AZG A;  3V6C B;  3ZUN A;  1R4N B;  4B95 A;  4GDK B;  1VJK A;  1J7A A;  2NPT A;  4A8X C;  3NUH B; 
#chains in the Genus database with same CATH homology
 1T0Y A;  1WGR A;  1E7V A;  2WDT B;  5L83 A;  1IYF A;  2DAJ A;  3WAP A;  3RT3 B;  1VD2 A;  2VRR B;  3TL5 A;  5BO4 B;  2JWZ A;  4ZDV A;  4KVG B;  1WH3 A;  2BKR B;  4KIK A;  4AOF A;  2MSE D;  4HWI B;  4ANX A;  1WXS A;  1Q5W B;  1WE6 A;  2KZR A;  1UBI A;  2CU1 A;  1S3S G;  4WQO B;  4FA6 A;  3RZW C;  2D2Q A;  3WIM A;  4AUQ C;  4EUT A;  5LXH A;  4KV2 A;  4F7Z A;  2JRI B;  4IW0 A;  5DCN A;  4MDK E;  3R66 C;  2MBH A;  1WJ6 A;  4DHZ B;  3S2A A;  2V1Y A;  2LVQ A;  2BYV E;  4HDQ A;  2AEH A;  2R2O A;  5D2M B;  4W9F A;  4DK5 A;  4GSW A;  1YQB A;  3DQV A;  3QA8 A;  1MG8 A;  4HCN B;  2N7D A;  4DDI D;  5CHV C;  1F9J A;  3M95 A;  4KSK C;  3VTW A;  4URK A;  3R7R A;  5G2N A;  2LUE A;  4HK2 A;  5FR6 A;  1FXT B;  2CHZ A;  2XK5 B;  4A20 A;  2J0J A;  4ANU A;  2JZZ A;  3VUY A;  3TBL D;  4I6N B;  2D3G A;  3L16 A;  5IA7 A;  4W9C A;  1ZW7 A;  3ZVV A;  4JIO U;  2MRP A;  4BFR A;  2IO3 B;  1WM3 A;  2DZI A;  2C9W B;  2KVR A;  3NZS A;  2LVP A;  2KC1 A;  3HM6 X;  2DHZ A;  4GB9 A;  3OLM D;  4K81 A;  4BKG A;  3CMM B;  3CST A;  2EMS A;  4FHK A;  2GMI C;  5JHA A;  2I1K A;  4DHJ D;  2ZZP B;  1LXD A;  4IUM B;  1E90 A;  4MEM A;  4RM8 A;  5DPT A;  2BYE A;  4MM3 A;  4LDT B;  4PS3 A;  2NCN A;  2O2V B;  2KAN A;  3AU5 A;  5D94 A;  2WX1 A;  4FJZ A;  3DDC B;  3APD A;  2DEN B;  4GDL B;  3VTU A;  1V5O A;  2KJR A;  2KQS A;  4EZK A;  2NBW B;  1WI0 A;  4IM2 A;  2PEA A;  2LI5 A;  2KFJ A;  5DPS A;  3PT2 B;  4WWN A;  2FID A;  5J2R A;  2DZM A;  2AL3 A;  2KFK B;  3JSV A;  4RM9 A;  4W9K A;  2MBQ A;  3PSE B;  3I3T B;  3PLV A;  1J0G A;  5CX3 A;  4W9E A;  2HE7 A;  2PJH A;  3N3K B;  3IG3 A;  2OOB B;  2N1V A;  3WAN A;  2K8B A;  4LCD E;  3RD2 A;  2AWT A;  3IFW B;  1P9D U;  2KLC A;  2KOX A;  3IBE A;  3DBS A;  3QHT A;  3L0W B;  3PGE A;  4XX5 A;  2LZ6 A;  1EF5 A;  3B1L X;  4IM0 A;  1PQS A;  5DPR A;  1L2N A;  3PHW B;  2V3S A;  1LM8 B;  1TTN A;  3DBR I;  3V6E B;  3APF A;  3KUC B;  2LRU A;  1Y8R C;  2IO0 B;  5DPW A;  4MEL A;  2K25 A;  1WF9 A;  2XK5 A;  3U7D A;  3EC8 A;  3Q3J A;  1E8Z A;  1GUA B;  2K39 A;  4NY0 A;  2KWV B;  4MJS B;  4XC2 A;  3TJP A;  2JVC A;  4BKS D;  2MX2 A;  3A9J B;  3M63 B;  3W1Y A;  2C7N B;  3AUL A;  4HXD A;  3U8Z A;  3VQI A;  1C3T A;  1V6E A;  2MA9 B;  1XT9 B;  3X0W A;  3JVZ X;  2ZNV B;  4NQK E;  2N9E B;  2GBM A;  2Z0E B;  3VVW B;  1OEY A;  4II2 B;  1P3Q U;  1XQQ A;  2L05 A;  3H6N A;  3N32 A;  4F1S A;  3AXC A;  4HJK A;  2J0K A;  4WJP A;  2J0M A;  1S1Q B;  2J7Q B;  4EZL A;  2MBO A;  2IBI B;  1WJN A;  2ZPY A;  3ZNZ B;  2KJ6 A;  2BPS A;  2O2V A;  4CO7 A;  1K8R B;  1OTR B;  3T8M A;  4G11 A;  1YX6 B;  2AL6 A;  4HDO A;  5HKH A;  3DVN V;  2M8S A;  4GDL A;  4HPM B;  2O6V A;  2KK8 A;  3ZRC A;  2N9X A;  2NS5 A;  1A5R A;  2KLG A;  5AZH A;  3ML9 A;  2C7M B;  4DHJ B;  3Q3F A;  4I6L B;  1EO6 A;  5C23 A;  1KOT A;  2KFK A;  1Q1O A;  2N9P C;  4FJV B;  2CKH B;  5J18 A;  3APC A;  2KWU B;  2OJR A;  4JGH B;  3M62 B;  2LD9 A;  2GBR A;  4GU2 A;  2KC2 A;  4ZYN A;  3JSV B;  1D3Z A;  2MW5 A;  1KJT A;  2GBN A;  4FHJ A;  2REX A;  2FCN A;  4IWP A;  4K1R B;  2LXC A;  2L3Z A;  3GZN I;  1QZE A;  1J8C A;  2G4S A;  2YLM A;  3CSF A;  3ZIM A;  2NR2 A;  3OAW A;  4G0N B;  3SDL C;  3ENE A;  3KUD B;  2CHX A;  1LQB A;  4BOZ B;  2JY6 A;  1Z2M A;  4KZC A;  3KYC D;  4MGK E;  4RMA A;  5LLI A;  3D32 A;  4M0W B;  5CHW A;  1VCB A;  5JZE B;  2IY0 B;  5C1Z A;  1WFY A;  2GBK A;  4MJS A;  2BYF A;  5AZF A;  1HE8 A;  4NNJ B;  2LVO A;  3A9J A;  1WRD B;  3B0A A;  3DCG A;  1CMX B;  2FIF A;  1WY8 A;  2MQJ A;  4MGY E;  2L0F A;  2GBJ A;  2LWP A;  2LRW A;  3PRE A;  4BBN F;  4EFO A;  1V80 A;  2BF8 B;  3HM3 A;  5JH5 C;  3R7Q A;  2JF5 A;  3UIN B;  2NVU I;  1WXM A;  4GMV A;  4FAD A;  1NI2 A;  2FCM A;  3QAR A;  2CS4 A;  3IHP C;  3DVN U;  4HVB A;  1AAR A;  2CR5 A;  2KDE B;  3TMP B;  4W9I A;  1R4M I;  1WMH B;  3A9K B;  1SIF A;  2L00 B;  2I1J A;  2D10 A;  2DX5 B;  4AP4 C;  2WWZ A;  3L10 B;  4BOS C;  2FUH B;  3H7P B;  4TKN A;  3VUW A;  3UGB B;  4J6I A;  2W9N A;  4B9K A;  2A5U A;  1YX5 B;  3ZO5 B;  4JLC A;  3PRM B;  1V2Y A;  2O6V B;  2DYM A;  4LJP B;  1G6J A;  4DWF A;  2RSU A;  3DVG Y;  2DYB A;  2LAS A;  2KX0 A;  2L0T A;  3RUL A;  1H8C A;  1IPG A;  1WX7 A;  2UWQ A;  3W1S A;  2K1F A;  2PE6 B;  4NJ6 A;  2MBB B;  2LJ5 A;  2FNJ B;  4GGQ A;  1P0R A;  4NQL B;  2A4Z A;  3WA0 A;  3LDZ E;  4FJY A;  3EFU A;  1GG3 A;  4G50 A;  1EUV B;  3P2B A;  2KMA A;  1ISN A;  3PRZ A;  3KVF B;  1RAX A;  5E6O A;  2JRH A;  3NY5 A;  2Y5B B;  1V5T A;  1WX9 A;  3QX1 A;  3IVF A;  4GN1 A;  2FAZ A;  4EOY A;  1JRU A;  2PE9 A;  3UIO B;  3RZF A;  5D6J B;  4ICU A;  3H1U A;  3QQ8 B;  2L8J A;  2M17 A;  4MGI E;  3C0R B;  1WM2 A;  3PS6 A;  3ECI A;  1GC7 A;  1NBF C;  3VHT C;  3AU4 A;  2K8C A;  2ZVO A;  4W9D A;  3LJ3 A;  4NAW A;  1V49 A;  2N4F A;  1WGY A;  5CTR C;  2K6D B;  3PHX B;  3X23 A;  1GJZ A;  2RD0 A;  1E7U A;  2MLB A;  4HCP B;  4NJ7 A;  4PS7 A;  2KO3 A;  1Q0W B;  2GOW A;  2IO1 B;  4E74 A;  4DDG D;  3SD5 A;  3ZNH B;  2BWE S;  1XD3 B;  4TUU A;  1YD8 U;  4IWQ A;  2IZV B;  1WGG A;  2K8H A;  4EZJ A;  3VFK A;  1UD7 A;  4B6W A;  4BKS A;  3U30 A;  1WR1 A;  3WAM A;  2RPQ A;  1WMH A;  3PTF C;  3A9K A;  3QCA A;  1WXV A;  4IWO A;  4JL9 A;  2M4N A;  2LGD A;  2MBE A;  3VXW A;  1KLV A;  3O65 B;  5TR5 A;  4KDI C;  3RUI B;  2KHW B;  3ALB A;  3H7P A;  1YIW A;  2ZNV C;  4EEW A;  1GNU A;  2IO2 B;  4BKT A;  4W9J A;  4II3 B;  2V4L A;  2JPH A;  3HIZ A;  1E8Y A;  1WGH A;  4LDT D;  3VH4 B;  3L54 A;  2G3Q B;  1UGM A;  2N1W A;  3ZTC A;  4HLE A;  2RGF A;  4JQW C;  5KHQ A;  2N7E A;  3DBL I;  4A3O A;  2Z59 B;  3V61 A;  3VUX A;  2DZK A;  4K7U A;  4K7W A;  4DHZ E;  2KKC A;  3VH3 B;  2C5L C;  2ZJD A;  4IG7 B;  5G55 A;  4HPL B;  3TCA A;  2ZVN A;  1E5W A;  1WXA A;  4N9F 4;  2JUO A;  2ZCC A;  4PS8 A;  2MP2 B;  3MJW A;  3ML8 A;  2NBV B;  4GOC A;  4MSQ B;  4GIV A;  3JYU A;  3ONS A;  1WGD A;  3VDZ A;  1OGW A;  3QJZ A;  3QK0 A;  3WAO A;  4G3X B;  2NBU A;  1YJ1 A;  4NPN A;  2Z0D B;  4PYZ A;  3A33 B;  3L13 A;  3W1S C;  2LGY A;  3PLU A;  2IYD B;  4ANW A;  1UH6 A;  3NZU A;  2WX0 A;  3DOW A;  4W9H A;  3UQB A;  1OEY J;  3KW5 B;  3NHE B;  3NS8 A;  3CF6 E;  3EHV A;  1E8X A;  4NAW B;  3L17 A;  4ZRI A;  4CHK A;  4I6P A;  4OVV A;  4FBJ B;  1P1A A;  4AWJ A;  4FLH A;  3ZNG C;  4TQ0 A;  3UQA A;  2KNB A;  3SHQ A;  5AEK B;  4FUL A;  4OVU A;  2R2Q A;  1RRB A;  1V81 A;  2WYQ A;  4WWO A;  5KHO A;  2HJ8 A;  3A4R A;  3NOB A;  2JZ3 B;  1V9J A;  4PYU A;  2BKF A;  3RYT A;  2D11 A;  2KDB A;  1SE9 A;  3WAL A;  1UEL A;  2KQ7 A;  4DBG A;  3ZNI D;  1R4N I;  3ZW3 A;  3GOE A;  3QWZ B;  3M3J A;  3ZDT A;  4WJQ A;  4W9L A;  1WZ0 A;  4E3C A;  4EKU A;  2M0X A;  1WJ4 A;  1TZ1 A;  5JHB A;  2KTR B;  2KX3 A;  1UBQ A;  1LFD A;  2D07 B;  3A4S C;  5D7G A;  2KWC A;  2YVC A;  3A1Q A;  1WJU A;  3KUZ A;  1L7Y A;  3R3M A;  1UZX B;  1ZGU B;  3SU8 X;  4F8C B;  5LXI B;  2DYO A;  2EMT A;  5E6N A;  4XZ4 A;  3UF8 A;  2KDI A;  3AI5 A;  3V60 A;  4BBN C;  3EEC A;  3H9D A;  4AJY B;  1RFA A;  3OJ3 A;  3ZDM C;  1I35 A;  2MP2 A;  1WIA A;  1V86 A;  4GDK A;  2KXJ A;  4KDL B;  4IM3 A;  3RCZ A;  3QAQ A;  1X1M A;  2BWF A;  2MWS B;  2JXX A;  3PZD A;  2KTF A;  4K7S A;  1EF1 A;  2C60 A;  3K9O B;  4A3P A;  2JT4 B;  1M94 A;  1SGH A;  1KM7 A;  1P98 A;  1TGZ B;  2IY1 B;  2NPT B;  2HD5 B;  3OJ4 B;  3ZTD A;  4WJO A;  3ZRF A;  3MHS D;  3V62 A;  3JW0 X;  3MTN B;  1I42 A;  4CYE A;  2BGF A;  2M1M A;  3PVL A;  4P7I A;  2AYO B;  5GMV A;  3VAW A;  4FN2 A;  3VTV A;  3ZLZ A;  4ASW C;  4KIK B;  1RLF A;  4MSM B;  3HK0 A;  1U4A A;  3B08 A;  4GXB A;  1OQY A;  2PPH A;  2G4D B;  3DBH I;  2XEW A;  3N30 A;  4ZRJ A;  1WX8 A;  4DXA B;  2ASQ A;  2UYZ B;  4M8N A;  1IP9 A;  2L7R A;  2LGX A;  2LXA A;  2KDF B;  3PRP B;  1TBE A;  4TQ1 A;  2DAF A;  2ZPN A;  4W9G A;  2DZJ A;  2FCS A;  2XBB C;  4KZ0 A;  1GC6 A;  5EDS A;  3KH0 A;  3ZKJ C;  2KJH B;  5IAA C;  5J17 A;  1WE7 A;  1WYW B;  3BIN A;  3DVG X;  3DPD A;  2G45 B;  1E8W A;  2RR9 A;  3PV1 A;  4ICV A;  4LJO B;  4X57 B;  2EKE C;  4WWP A;  2KTR A;  4YL8 A;  2MCN B;  3K9P B;  4TV3 A;  2CHW A;  5CHF A;  1NDD A;  1WR6 E;  3KYD D;  2KN5 A;  1Z5S B;  2KMC A;  2QHO A;  1H4R A;  5E6P A;  2KD0 A;  4WJN A;  4AJW A;  1J19 A;  1BT0 A;  4MGZ E;  5L95 C;  1C1Y B;  3QIJ A;  4KSL C;  2C7H A;  3A1Q B;  4IC7 B;  4M8M A;  4E71 A;  2K6Q A;  1WZ3 A;  3UIP B;  3L08 A;  3PPA A;  2ZCB A;  2FCQ A;  2O6V D;  2L76 A;  3T9L A;  1ZKH A;  2HTH A;  4BVU C;  3TIX A;  3H7S A;  4WAA A;  3HHM A;  2B3A A;  5AZG A;  3V6C B;  3ZUN A;  4B95 A;  2ZEQ A;  3QC8 B;  4GDK B;  4ZRK A;  4MH0 E;  2NPT A;  3BY4 B;  4ANV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...