2DAQA

Solution structure of second pwwp domain of whsc1l1 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
110
structure length
110
Chain Sequence
b'GSSGSSGKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WHSC1L1 protein, isoform long
publication title Solution structure of second PWWP domain of WHSC1L1 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 110
sequence length 110
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2daqA00
2VYTA 3FDRA 2PQWA 4C5IA 3ASKA 2K3YA 1WJRA 3GOXA 2O4XB 4N4IA 2EQJA 4QVZA 5IN1A 2X35A 2RHYA 3E9GA 2DIQA 1N27A 5C0MA 3LH0A 3OB9A 2XDPA 4UC4A 3OY9A 3L2UA 2RHIA 3MEAA 4LD6A 2EQKA 2BKDN 4Z02A 5KCOA 3OS1A 4IKFA 3L2RA 5FROA 3P8DA 4IUVA 3OYNA 4E7JA 2RJDA 3S6WA 3LLRA 2LDMA 2O4XA 2X4XA 3QJ6A 4B9WA 3OA6A 4E7KA 3L2QA 3S3NA 2HQXA 3KUFA 2X4YA 5KCHA 4A4GA 2GF7A 4GY5A 3PMIA 2M16A 2DIGA 4IUQA 2WACA 3ME9A 4L59A 4A4EA 4BDZA 1OZ3A 3OYBA 4E7LA 3MP1A 3LX7A 5KE2A 3OYKA 2L89A 1OYXA 3MEUA 2K3XA 3PFSA 4A4HA 1H3ZA 4HCZA 3OYCA 3OYFA 4IUTA 3M9QA 3H6ZA 2EFIA 5KE3A 1WGSA 4QW2A 3OYIA 5FRMA 3FC3A 1OZ2A 4FU6A 5D6WA 2P0KA 4EDUA 2X4WA 2JZ2A 2MWPA 2GFUA 2XK0A 3OMCA 3QKJA 3OMGA 3OS0A 2MWOA 2LTOA 1SSFA 2L3RA 4FL6A 4C5EA 2JTFA 5D6XA 4BE0A 4CRIA 2QQRA 3F70A 5C6SA 4A4FA 3O8VA 3MO8A 3OQ5A 4Q5WA 3S3MA 3PMTA 4N4GA 4E7HA 2D9TA 2R5AA 2E5QA 3BDLA 5J26A 5M9OA 4BDYA 2CKKA 3E9FA 3OYJA 3ZEHA 2EQMA 3NTIA 3L2VA 1KHCA 5CIUA 3L2WA 1WJSA 2FHDA 1XNIA 2RHXA 3FLGA 1WJQA 4PL6A 2R5MA 3MP8A 2EKOA 5KH6A 2R58A 2NLUA 3DB3A 3Q1JA 3LGFA 4RG2A 2G3RA 2L8DA 1RI0A 5J39A 3OYGA 3NTHA 5FRNA 1OI1A 2RJFA 4ZTFA 3MEWA 2B8AA 4IUUA 4B9XA 2RI2A 2RHZA 4II1A 3MP6A 4C5HA 2LCCA 2HQEA 3LGLA 2LRQA 2LVMA 4PLIA 3UT1A 4BACA 1MHNA 4E7IA 3META 3NTKA 3UWNA 2F5KA 4BE2A 3S3OA 2IG0A 4BD3A 2GFAA 2RI3A 2BUDA 3OYDA 2E6NA 5D6YA 3SD4A 4QQGA 3OYLA 3OYHA 3OS2A 4IURA 2RHUA 4C5GA 4N4HA 3CEYA 2DAQA 2R57A 3OYEA 3P8HA 2M0OA 3QIIA 4QQDA 2RJCA 4OVAA 1G5VA 3QBYA 4PLLA 3C4SA 4ZTJA 2BIVA 4QQ6A 2RI5A 2RJEA 5IAYA 3MEVA 2EQUA 3H8ZA 3L42A 4NS5A 3FEOA 3OYAA 3DB4A 2RO0A 3LYIA 2QQSA 2M1HA 3OYMA 3EAEA 4IUPA 3DLMA 4BE1A 2YRVA 3PNWC 4X34A
chains in the Genus database with same CATH superfamily
4P5NA 1JXMA 3EG0A 2HKQB 1SG5A 4J9IA 1NLPC 4PJOG 1AWJA 3CCRT 2CZ1B 3EFRA 3MEAA 2M02A 3GIBA 1UDLA 1VQ8Q 3P8DA 2O88A 5CCAA 3V7CA 1J3TA 5KCHA 4M7AC 3VUBA 3HSBA 4PFZA 3JCMf 8AT1B 4ZN1A 2DXTA 3LX7A 4C8QB 3OYFA 2PVGB 2QA4T 3GF5A 5CR2A 1VQMT 5IXFA 3CCMT 1K8AU 4R55A 2EYXA 3TEEA 3JAME 4HVWA 1Y96B 4FIBA 3IQLA 2CGHA 4M77F 1LJOA 4ELZC 4EMKB 1CKBA 3BDLA 3ZL7C 1TTHB 2CKKA 2GQIA 3L2VA 5GMKj 3CCEA 2C0TA 4PL6A 2E4HA 2ZZDA 3CCQT 4BI3A 2G3RA 3EG9A 3CC2Q 4F7UG 1VQ5T 1VQLQ 2JJ9A 3RUXA 1AVZC 1JXOA 4II1A 2LQKA 2AZSA 2RI3A 4QT7A 1KQSS 1YJ9Q 4IURA 4EMHA 4M4ZA 3A8LB 2HNIA 5A0GA 2BZYA 4JRIA 1RAGB 3CCLT 2BIVA 3NHNA 2KR3A 3ER0A 3QYGB 1JRIA 1Y7XA 3QDRB 4C5IA 4PNOA 5IHNA 2LX7A 2QAZA 1IGQA 5KYXB 1G3WA 3X28B 2MI6A 3VRZA 1NM7A 1Y0MA 3CCRA 3BY7A 2P0PA 2ZPGB 1X01A 2LJ1A 4PJOB 4XU3A 1PWTA 5GJWB 4B9WA 4M7DC 3VS7A 2E41A 3VKIA 1U06A 2EQIA 2QK0A 2Y4XA 4L59A 4F14A 2PNIA 2LCSA 1JO8A 2L89A 2GNCA 2JM8A 4VUBA 3G71T 3ULRB 2QA4A 1VQMA 2FZKB 1D0XA 1O75A 2DLPA 3JV3A 1KQ1A 2XK0A 4AG2C 4C92E 3CCMA 3QKJA 3OMGA 1BI1A 1M1KU 2YUPA 1Q81C 2SRCA 4A4FA 1Q81R 4E7HA 2OTLT 2IPOB 1K4US 4NOYA 2NUPA 2X9HA 2O01E 5CIUA 1C0MA 2OAWA 4IIOA 2WSCE 1HSQA 3CCQA 2AT1B 3LGFA 1PG5B 1ZQ1A 4M77C 3PTAA 1VQ5A 3TSZA 2DL3A 5GANe 4F7UB 2YLBA 4M75B 5GMKh 3UT1A 1VYVA 2X3XD 2F5KA 4LE9A 3HPWA 3OYDA 1KQSA 3V7RA 4C5GA 1EZZB 1RI9A 2L2PA 4NL2A 1M3BA 2XMFA 4L5GA 2VGNA 3G4SQ 2D0QB 4KH1B 1R8OB 1W2BP 1FXXA 1YI2A 4J9CA 1WHJA 1TH7A 3DKMA 4XTZA 2YRVA 2PVOB 2DVEA 4PKCC 2PQWA 1LPLA 2GGRA 1PD0A 4QVZA 1N27A 2EGCA 1RAAB 5ECAA 4AFZC 3OY9A 5KCOA 2QQAA 3VS3A 4IUVA 2DBMA 9ATCB 1K1ZA 4PFPA 2CS7A 2YLCA 2HQXA 1KC8U 1D0YA 4GY5A 1VA7A 3PIPA 1QVFP 1IO6A 3G71A 1A0NB 4BI8B 2KSSA 4ORZA 2FZGB 1ZSZC 1YCYA 2KROA 2J06A 4Z89A 4EDUA 4EMKA 5GAN6 4DOWA 3MKDA 4M78G 3VYGA 3OS0A 2EJ9A 2LTOA 2L3RA 4JRPA 4ZNXA 1ABOA 1D09B 1OV3A 2G6FX 5CAIA 4L6V5 3OYJA 2DFUA 1IHVA 1UECA 2DPPB 4CI0C 4LXCA 1ZBXA 3EGXB 2R58A 1X6GA 1UGPB 5FRNA 2RJFA 3OSVA 3MJXA 4C92D 3J80E 2V8KA 1Q86U 3EG3A 3JSCA 3CC7T 4Z88A 2RM4A 2DX1A 2E12A 7AT1B 1HD3A 1D1BA 4MMKA 1G2BA 1TWBA 4OVAA 3TQ7P 1G5VA 3M0SA 2EIFA 4M75D 1VQ7Q 2RI5A 3HRSA 5GAN2 2DMOA 4J9HA 3DB4A 2RO0A 2K4YA 3OYMA 1WA7A 4IIMA 4PJOA 4V2SA 3ASKA 2DF6A 4A53A 4M7AD 4J6YA 3I5SA 1JJ2A 1OPKA 3E1SA 4EPCA 1YITQ 3WXMB 1T3LA 3EHQA 2L3SA 4XTXA 2RN8A 2RNAA 2AZVA 2HSPA 4M77E 1WHMA 2DBKA 2K6DA 2K5IA 3JCMP 1F1BB 4E7LA 3JCMc 1T0HA 3NMZC 1N6AA 4J9EA 5EG2A 1BI2A 4FT2A 3CMAT 3JB9D 2FRYA 3C95A 1BI0A 2W10A 4J9BA 1K9MC 5LJ3j 4M78B 1OU8A 4BE0A 1K9MR 3X24B 4XU1A 3SWNA 5DY9A 3RERA 3JB9H 2DXBA 3GNGA 4FM4B 1FMWA 1KHCA 1WJSA 3PVLA 1C1AA 3FLGA 1UGQB 2NUTB 4F7UA 2KY9A 3CCUT 3M0UA 4PJOF 4M75A 1W70A 2LT4A 1NEGA 2IVWA 3NTHA 3RDVA 1OULA 2D8HA 2Z0WA 3UF4A 4J83A 2DL8A 4CC3A 3M54A 3CCVT 1FMKA 4XTUA 2K2VA 2CSIA 2KGTA 3META 3UWNA 4M7AA 3CC7A 4J6WA 4BE2A 2GFAA 2F1LA 1D1AA 2NUZA 1OPLA 1RAIB 2J05A 5GAN8 5LJ5j 2JS0A 3LW5E 3QPHA 3RKXA 3QG1A 1M1FA 2HMAA 4QQDA 1QVGA 2OTJT 2RH2A 4C8QC 1ABQA 1YFNA 3REBB 1YJNQ 4C0DB 3SEMA 4OMNA 3NFCA 1S1NA 4QKUA 1PM3A 4JRKA 3VS6A 1TUCA 1QKWA 4R56A 2YXYA 1E7OA 3RIRA 1QQJA 1WJRA 4M7DD 1PCXA 5IN1A 2A08A 3FJ5A 4EMKC 4KULA 5CKBA 2JOYA 4IKFA 2E10A 1WXBA 5KYWA 1CKAA 4AG1C 4F7UF 4M75F 5GAMf 4E7JA 3A8HB 2CZ6B 3C12A 2VC8A 3CMET 4QVDA 4E7KA 4FYWB 1WXTA 2X4YA 5J3BA 3QWYA 4PFOA 3PMIA 4A4EA 1Q95G 3VV0A 2LCLA 2V1QA 5LJ3d 5KE2A 4JLGA 2LC4A 5I21A 4HCZA 4GBQA 4M7AF 1YWPA 3M57A 5FRMA 4OMPA 1VQ8T 3SFMA 4OF1A 3I56T 3H0IA 1X6BA 2KDSA 2RB6A 3EGXA 2HD0A 2EYYA 3G6EA 1K8AC 4J6XA 2ECZA 2EQMA 3NTIA 4ZGJB 2OAUA 1UE9A 4XTYA 1WJQA 2HZYA 3JCMQ 3CCUA 1BK2A 1UGRB 2KXCA 1YHQQ 1D3BB 5LJ3h 4BB7A 4WF2A 1HK9A 4PJLA 3JCMJ 3JRZA 3CPFA 3CQTA 1WQWA 2B8AA 2QDLA 5GAOm 5LJ5d 1UEBA 4BI4A 4HKEA 1H3HA 1VYTA 1G8XA 3GNFB 2RI2A 1YN8A 2DL4A 4M7DA 4BACA 1MHNA 4PJOC 1Q82U 1MV3A 6AT1B 3UA7A 2ZPEB 1M2VB 2YDLA 4F16A 3CC2T 3CCSA 1VQLT 2DAQA 1NLOC 3OYYA 3OYEA 1AZEA 2OTJA 5IT9E 4FT4A 1AWOA 2A36A 2HDAA 1U3OA 3MEVA 1VQ4T 2KRMA 1SRMA 1T3SA 3GPLA 4DA4A 2QQSA 4X34A 5LJ5h 1AWXA 4RCCA 3DLLA 2VGMA 1YJ9T 3OBWA 2ZAEA 4K11A 2K3YA 2I2LA 4FYXB 1AHJB 1VQOA 2HBPA 3C94A 1G3YA 2VUBA 4KRTA 2RHIA 1MMNA 2EQKA 2BKDN 1RADB 3V8LA 2DD5A 1LNXA 1SKUB 2FL7A 3VS5A 3CMEA 1UGSB 1AEYA 2VWFA 3A8GB 3QSUA 3CBPA 4M78A 4M7DF 4M75C 1H3ZA 4D6WA 5KE3A 3L2ZA 1I4K1 1P92A 2E1HA 1K73U 3VS2A 5GAOn 3I56A 5GAN5 1SSFA 2NUTA 4XTVA 5D6XA 3UDCA 4XU2A 1QKXA 2CT4A 4X1VA 4N4GA 2MYSA 2DKGA 3M0RA 1I5OB 4LD9K 2CT3A 1M1KC 4O5VA 3M59A 2EKOA 5GMKe 2EJGA 4RG2A 3HFNA 5J39A 2P84A 4J9FA 2PUKB 4OB3B 2O9SA 4RTTA 1U5SA 2E3HA 2PVDB 1KSWA 2VXFA 2LVMA 4PLIA 3J81E 4FSSA 1FX7A 2JN0A 4AFSC 3M58A 3I55Q 4HCKA 2RHUA 1UGVA 5GJVB 1S72Q 3CC2A 1VQLA 2LT1A 4M78F 2A0FB 1ZSZA 1UJ0A 2JM9A 1NEBA 1OX9A 1YIJQ 1VQ4A 3BFMA 1YNZA 2KEAA 4DBFA 1KQSP 4N0AA 1YJ9A 2V8JA 2XIDA 1H641 2O4XB 3CCEQ 2RHYA 3E9GA 2KT8A 4ELYC 3LH0A 3JCMb 2DVJA 2WSEE 4OMLA 2A28A 4RKUE 4Z02A 5FU7B 2XICA 3S6WA 2Y4YA 1VYUA 4LUDA 3EFOB 5IHIA 3RBBB 3OW2A 3OYBA 1VQ9T 4FSXA 4PJOE 3EGUA 1KC8C 1WGSA 3OYIA 1KC8R 1TUDA 3BE3A 1SHFA 3QUIA 2ZGWA 5FW9A 4EIKA 3QO3A 2QQRA 5C6SA 5LL6S 4KGVB 3M55A 2CP6A 3JCMd 3HTRA 1UHFA 2DJQA 3A1PA 4MMLA 1W1FA 1NG2A 1BCMA 2FHDA 2FO0A 2RHXA 5L23A 1YJWT 1BBZA 2DETA 1UJYA 3GP8A 2E70A 3MHXA 2EVRA 8ATCB 4OGEA 2NLUA 3UPUA 1RUWA 2L8DA 3G1JA 2EPDA 3CCRQ 1LVKA 1OI1A 3RMSA 1LCKA 1M2VA 2XHCA 3MP6A 4C8QD 1XJWB 1M27C 2QQ9A 1RLPC 2DA9A 1X2KA 2VB6A 5D6YA 3OYHA 1HXDA 1T0JA 3JCMh 3RNJA 1Q86C 2JUFA 2KT1A 2QQBA 1I07A 2DJZA 4F7UE 1Q86R 2ROLA 3CD6Q 4M75E 1NYGA 1Z9QA 2E3IA 2M51A 3I9QA 4OMOA 1RL2A 4BE1A 1GRIA 3M0QA 4J7IA 1ZUUA 3CCJQ 2O9VA 3PGGA 2PU9B 4M78C 5CQYA 1JB0E 4M7AE 4N4IA 2EQJA 1NJIU 2C0OA 2HQHA 1VOMA 3L2UA 2XDDA 5GAN3 4DEYA 1OU9A 2YRCA 1VQ5Q 3CCLA 2YWWA 5GAOl 1VUBA 5CVIA 4RCBA 5GANf 3OS5A 3ZFJA 1VQ9A 1OYXA 3PFSA 1MNEA 4Y91A 1K0XA 1YITT 4YTLA 4QW2A 1JJ2S 1WLPB 2JZ2A 4AT1B 2KVQG 1ZA2B 4FL6A 4C8QA 1I1JA 3EGDB 2BZ8A 1YI2Q 5A2QE 3OQ5A 4JS4A 1MMAA 2E5QA 4C0DC 2DEQA 1BIBA 1Y96A 4GLMA 1YJWA 3V8JA 3A8MB 4PJOD 1VQ6Q 3M4GA 1K76A 1PHTA 2KYBA 2P0QA 4WTOB 4ZTFA 2EYZA 1WZOA 2LQWA 1PSFA 3CBMA 1Q7YC 3VS1A 1MMGA 1Q7YR 4N0AC 5A0DA 1WYXA 2M9UA 1M5Q1 4E6RA 2OTLA 1EFNA 1XTDA 2BUDA 2DRKA 2LQ8A 2C06A 2E6NA 1JBMA 1Y57A 3RESA 3OYLA 2HL5C 2W0ZA 2X51A 2ROTA 2RA2A 4RTYA 1PKTA 3P8HA 2DXUA 2ATCB 4PJJA 2DE0X 1WIEA 1TS9A 3QHSA 2LJ3A 1KIKA 3VJPA 5IAYA 3E2UA 2J6KA 4RTZA 4KT0E 1VQPT 1SSHA 4C8QF 2MF2A 1U1TA 4E2FB 4OP0A 4M7DE 1B3QA 1Q81U 4HVUA 1QCOA 2DIQA 2HSEB 4JZ4A 3EFOA 3GLXA 1YJNT 2MPXC 1QVGS 4OMFB 3I5RA 2GTJA 4HXJA 2X4XA 3KUFA 2CP5A 5KYXA 5LJ3g 1YWOA 3BW1A 4IUQA 4OB0B 3CXCA 1VIEA 2K3BA 1E6GA 2MK5A 1JEGA 2QASA 2K3XA 1XQHA 4A4HA 1YITA 1GCQA 2BE9B 4ZGEB 4FU6A 3KXTA 4D8KA 4JJDA 5I11A 4AFUC 2LP5A 1WPYA 4CRIA 2Y90A 1W2BA 5CO7A 4BUGA 4E7SA 2FPDA 5LJ3e 3E19A 3L1AA 2DTHA 4RUGA 1VQNQ 2QGGA 5GANh 3MP8A 2BE7D 3TU4K 3HL8A 4M78E 1QCFA 5LJ5g 1TUGB 1UG1A 3EH2A 3OYGA 3A98A 5I22A 1MNDA 3SB2A 3A8OB 1WHKA 4HT9A 1RLQC 1KHIA 2MMPA 5I2SA 1QW1A 2LRQA 3VS4A 2X4JA 2BZXA 4E7IA 3S3OA 4BD3A 2DZCA 3R6NA 4JPBW 2DL7A 3HKSA 2D8JA 4QQGA 5CKFA 1IXDA 3OS2A 2LX9A 1QVFA 1BI3A 1Q82C 2RJCA 5I2MA 5LJ5e 1HYOA 4PJMA 1QWEA 2RK1A 1KK7A 1V1CA 3L42A 4NS5A 4FYYB 2K5LA 3RMQA 1M90U 1VQPA 4XK8E 4KGZB 3HRUA 1BKBA 1JQQA 1TU0B 2CH4W 1G3TA 2KI7A 4F17A 2CSQA 2MCNA 3VU3C 1AOJA 1OX8A 3N5BB 1VQKQ 5DLOA 1Y07A 3OYNA 1TSFA 2H3JA 1PRLC 4LDXA 3R6OA 2LMJA 3OBYA 1WHHA 1YCSB 4HCCA 3EGDA 3CC4Q 3KBGA 4BY6B 2E6ZA 2MWPA 2B86A 3QDFA 2JTEA 2GCXA 2V8IA 1RAFB 3EG9B 5GMKl 1K73C 2JS2A 4PJNA 4DEXA 5KYUB 2GTOA 2LNVA 5GAMj 2F69A 4KUIA 3V8KA 2EYWA 3INZA 1NE8A 3CMAA 1RI0A 3JB9J 4KUDK 1BYMA 2KE9A 3X25B 1PC0A 3THKA 4B9XA 1AZGB 2RHZA 1IRXA 5FU7C 4C5HA 1ZX6A 2QI2A 2HQEA 4HT8A 1UTIA 4XQ3A 1I8FA 2QEXQ 3M5AA 4JDSA 1BU1A 1K8AR 3SD4A 4OB2B 3V7SA 2NWMA 4HVVA 4N4HA 2R57A 4RTWA 5FWCA 4M78D 1FYNA 2V26A 2FZCB 2QTVA 2FRWA 5HKCA 2HEQA 3OYAA 1GFCA 4MZMA 3CCVA 1I5LA 3I55T 1MGQA 5CKEA 3G6EQ 1X43A 1S72T 1PNJA 2CH4A 3CBOA 3QJYA 3ZBDA 1GCQC 3EHRA 2XG8D 1X75C 3CCUQ 1UHCA 1YIJT 3SHWA 5FROA 2DO3A 3QZ9B 4FCYA 4LN2A 3QXEB 2F2WA 3S3NA 3EG1A 3CCET 2I0NA 3WVEB 3OYKA 3GBQA 3HFOA 4E7ZA 4OMQA 2AIRB 2DD4A 2CZ7B 1I81A 3CCSQ 3VS0A 1KD1U 2GFUA 4WCIA 5FLXE 2MAMA 2RF0A 2D1XA 5GAMd 1IGUA 3JCMg 1KG1A 4LUEA 1Y71A 1QCNA 2D9TA 4XU0A 1WXUA 3OW2S 2QG9B 4BDYA 5IH2A 2P4TA 3JCMV 2FPFA 4J9GA 4RTUA 2LNHB 1QVPA 1WI7A 1VQOQ 1D1CA 3DB3A 2KYMA 1VQ8A 2DZ9A 2K79A 2K7AA 2ZPHB 2X3WD 4KH0B 3JCMe 4O6JA 4C8QE 2CDTA 4NL3A 1O9SA 5GAMh 3NTKA 2VVKA 1NBEB 2IG0A 4RMOA 1M1KR 2LZ6B 2LQNA 4C0ZA 2A3LA 1JU5C 2CP0A 2OI3A 1I0CA 5HK3A 4ZTJA 1OOTA 3VUZA 5AYFA 2EKHA 3EH1A 3H8ZA 3I56Q 4JJBA 1R0CB 3EFSA 3RKWA 2M1HA 4LDVA 4E47A 2ENMA 2COYA 3I55A 2VASA 2OJ2A 4JJCA 1BB9A 1S72A 2OX7A 3URGA 3CD6T 1M1GA 1N8RU 1BIAA 2QYZA 5HY6A 4LDYA 1YIJA 2J7IA 4C92G 2DK3A 1G3SA 4CC4B 1NJIC 1ZA1B 2LDMA 3C0CA 3CCJT 2KAFA 3CPWA 1ARKA 1NJIR 2AHJB 5DLQE 2YRDA 2HAXA 4DQ2A 2FPEA 1NZ9A 1AT1B 4MZTA 1OZ3A 3QWXX 1IHWA 3OYCA 1UFFA 1M4ZA 4IUTA 2YUOA 1MMDA 3M9QA 5GAN4 2P0KA 3G4ST 2VKNA 4JRQA 4M75G 5KYUA 1FWZA 3EG2A 1H8KA 4LDUA 1WQ7A 5FU6B 3O8VA 2RMOA 1VQ4Q 5J26A 5M9OA 4KGXB 2DXCA 1GBQA 3RR6A 2FEIA 4M7AG 5KYNA 2K57A 5KH6A 3J7AF 2DYBA 2D6FA 1EIFA 4FW1A 4LDWA 3M4YA 3TSWA 1YI2T 4X9CA 1B07A 5GAOr 2JVVA 1SPKA 5CQXA 2BTTA 3PT9A 1NYFA 2H8HA 1D3BA 1ACMB 2IIMA 1SRLA 3VYHB 1BCOA 1K0SA 1VQ6T 2JTMA 1M8MA 3CEYA 3AT1B 3JB9G 1GCPA 3RKYA 2EGEA 4KBMB 1GXIE 3H0FA 2HL3A 3H0HA 2EQUA 1OQKA 2ZPFB 1R0BG 4IUPA 4RTXA 4MZPA 1QLYA 1ZHIA 2FVUA 2YUNA 2KXDA 2X35A 1QP2A 3CD6A 1B34B 1V29B 1TG0A 4UC4A 2DERA 3FJPA 2QA4Q 1RABB 3HRTA 1KFZA 1VQMQ 2E64A 2O31A 1M3AA 2AKKA 4ATOA 4EMGA 2ZPIB 5GANg 3LH5A 1PD1A 3CCMQ 4OMMA 3CCJA 2J6OA 1R77A 1KJWA 4C92B 5GMKm 4AFQC 3ME9A 3UATA 2XDBA 5CKDA 3MEUA 2PZ1A 1WHLA 2HBWA 2EFIA 3SWNB 5AT1B 3FC3A 1OZ2A 3M0PA 1RACB 4AMCA 3G4SA 2L3QA 4QVCA 1VQ7T 3CCQQ 2JMAA 2DTIA 3OSSC 2GBQA 3NGPA 2JTFA 3CXCP 2JNGA 2FB7A 3TVTA 3F70A 4C0GA 2QXFA 3JB9I 3MPUB 3FIFA 3CXCS 3ZEHA 4JUVA 4M7DG 1JJ2P 1M3CA 4HA8A 2PTKA 1D0ZA 1WDXA 2O2OA 3Q1JA 1U1SA 2L3PA 4M7AB 4F04B 1N9SA 5GANj 2C0IA 2KMTA 3MEWA 4RG8A 2A7YA 4XTWA 3CCLQ 1X2QA 2LCCA 3LGLA 1W2BS 2ESWA 1B7TA 4MDWA 1VQNT 2M0YA 2EAYA 4A54A 1VQ9Q 2SEMA 1VQ6A 2VV5A 3M56A 5FWBA 5HCKA 2F2XA 4C0FA 1TXQA 5IHKA 3PE0A 4BY6C 1QWFA 2L0AA 2CP2A 3EAEA 5CKHA 3JCMX 4M77G 5KYWB 3LWIA 4DBHA 4DBRA 2VXEA 2YHTA 4MDXA 2RPNA 1WX6A 1TOVA 1PRMC 3FB9A 1QVFS 1M90C 1X69A 1YJWQ 1XOVA 3VRYA 3G71Q 1ZUYA 3OB9A 4LD6A 5EC7A 3OS1A 1M90R 1QP3A 1UUEA 2K2MA 1AWWA 3LLRA 2O4XA 2RQRA 2GF7A 2XI9A 2RQWA 2F2VA 4HCBA 2AK5A 2OTLQ 1VQKT 1QVGP 4JS5A 4RTVA 3TCJA 2CP3A 5D6WA 3MCAB 2LJ0A 4J7FA 1VQ7A 3SDZA 4CC7A 1N5ZA 2K5FA 2KNBB 5IXBA 4DOVA 3MO8A 4OGCA 3S3MA 1ZUKA 5GANd 1SEMA 2DRMA 5KYYB 3CC4T 3LWHA 2KQWA 3REAB 2J6FA 2CUBA 1IREB 2MOXA 4A4KA 2RK2A 2ED0A 4M7DB 3UA6A 5GAN7 1UB4A 1ZSGA 4Z8AA 4B6MA 3QZ5B 2COWA 5CK9A 3BDUA 2JXBA 2YUQA 2DM1A 1M8VA 2DNUA 4CC2A 1WFWA 2JT4A 1FMVA 1VQNA 1QMCA 2YT6A 1SF9A 4JZ3A 3QIIA 2JW4A 3M0TA 2ZCFB 3QBYA 4Y92A 4QQ6A 3I35A 1LOJA 3FEOA 1B34A 2QEXT 2F5TX 3DLMA 3PNWC 1K9AA 1IB8A 3FRNA 1WHGA 2VYTA 1YP5A 5LJ3f 4M77B 3JCMW 1YHQT 4DBQA 5C0MA 5D7UA 4C92A 4R0KA 3QYHB 2EJFA 3H41A 3L2RA 2DTOA 1Q82R 2RJDA 2QDYB 2GQVA 3OA6A 2DL5A 2ZPBB 1M9SA 2CYZB 4A4GA 3G6ET 1MV0B 3PIOA 2YSQA 4BDZA 1MUZA 3MP1A 3PVQA 3X26B 2NYSA 4JLIA 1VQKA 2FG0A 1VIFA 2EYQA 1Q7YU 1NPRA 3A5ZB 3H6ZA 4J5YA 1U8RA 2L5QA 5GAOp 1E6HA 5GAMg 5DM7R 2K9GA 1YJNA 2MWOA 5LJ5f 4J9DA 2AKLA 1ZLMA 1KQ2A 4A63B 4XAXB 1IZ6A 2DEUA 4Q5WA 3PMTA 1KD1C 2R5AA 2QGFB 1VQPQ 2CUDA 1KD1R 3CC4A 2ABLA 1XNIA 3CC7Q 2JMCA 3CCST 1ZBJA 2PUOB 1CSKA 4FYVB 1PKSA 5GAMe 4ESRA 2DYIA 4LNPA 4C92F 2KRSA 2P4RA 2EWNA 4IUUA 2EGAA 1ZSZB 2HCKA 4ME7A 1GL5A 2RQTA 1K73R 3WVDB 1VQOT 1SHGA 3T9NA 3NPFA 2M0OA 4ZGDB 3KFVA 4JJNK 2KBTA 2RJEA 2CP7A 2D0NA 3LYIA 1AD5A 2QTXA 1W6XA 2QEXA 2RD1A 2MIOA 1YBYA 3FDRA 4J8OA 3GOXA 4FW2A 5FU6C 2XD0A 4PK4A 1YHQA 2XDPA 5HK0A 3TREA 1H92A 3CMAQ 3QJ6A 1V76A 3M53A 3L2QA 4OB1B 4M77D 4C8QG 2M16A 1N8RC 2DIGA 2WACA 1C6VX 1N8RR 1EX4A 3HP9A 4X9DA 1K9MU 2HKNA 2KRNA 1X6OA 1PSEA 3JB9F 2X4WA 5A0LA 5KYYA 4ZN3A 3CPWP 3OMCA 3X20B 2A37A 2CZ0B 4C5EA 2V1RA 1W4SA 3CPWS 5L8RE 1HJDA 3CCVQ 5GAOq 3E9FA 3L2WA 2XU8A 1Z9ZA 2R5MA 2EW3A 2ED1A 1OEBA 1M2OA 2EBPA 1WNLA 2COZA 2NUPB 3H9NA 2OTJQ 4Y28E 3OW2P 2FYKA 4ANJA 3G7ZA 2WSFE 1M30A 1RAEB 1GFDA 3AHUA 3P8BB 3D7SB 2RQUA 3U23A 2DILA 4D8DA 1N9RA 4C92C 4TVRA 3O5ZA 2KK4A 2RQVA 4GLKA 1NPPA 2E65A 4PLLA 1X27A 3C4SA 5GMKi 1DJ7B 1RAHB 4M77A 2XKOC 3SWNC 2CREA 1GBRA 1G83A 2H3EB 3HHTB 2E5KA 3CMEQ
chains in the Genus database with same CATH topology
4MZPA 4P5NA 4OP0A 4M7DE 3RIRA 1WJRA 1ZHIA 2FVUA 4M7DD 1Q81U 5IN1A 2X35A 2DIQA 1QP2A 4EMKC 4PJOG 3CD6A 1B34B 1V29B 3CCRT 3GLXA 1YJNT 4UC4A 4KULA 2CZ1B 3EFRA 3MEAA 2JOYA 3FJPA 5CKBA 2E10A 3HRTA 1QVGS 4IKFA 3GIBA 2E64A 4F7UF 4ATOA 4M75F 3P8DA 4EMGA 2ZPIB 4OMFB 5GAMf 5GANg 4E7JA 3A8HB 2CZ6B 5CCAA 3C12A 2VC8A 2X4XA 3CMET 4QVDA 4E7KA 3V7CA 3KUFA 2X4YA 5KCHA 5LJ3g 3CCJA 5J3BA 3VUBA 4M7AC 4C92B 3HSBA 3PMIA 5GMKm 3BW1A 4IUQA 3JCMf 3ME9A 4A4EA 4OB0B 3CXCA 2XDBA 4ZN1A 1VIEA 2DXTA 2LCLA 3VV0A 5CKDA 3LX7A 5LJ3d 5KE2A 4C8QB 3MEUA 2K3XA 1XQHA 4JLGA 2LC4A 4A4HA 5I21A 4HCZA 3OYFA 2PVGB 2QA4T 3GF5A 4M7AF 2EFIA 5CR2A 1VQMT 3M57A 1YITA 5FRMA 3SWNB 1VQ8T 4ZGEB 3FC3A 1OZ2A 4FU6A 3KXTA 3G4SA 3CCMT 4QVCA 1K8AU 1VQ7T 3SFMA 4R55A 4OF1A 3I56T 3TEEA 3JAME 2DTIA 3OSSC 1Y96B 1WPYA 2JTFA 2KDSA 4FIBA 2JNGA 2FB7A 2Y90A 2RB6A 4CRIA 3F70A 2HD0A 1W2BA 2CGHA 4M77F 1LJOA 2QXFA 5CO7A 4BUGA 4C0GA 3JB9I 5LJ3e 4ELZC 3E19A 4EMKB 3BDLA 3G6EA 3FIFA 1K8AC 3L1AA 4J6XA 3CXCS 2CKKA 3ZEHA 2EQMA 2DTHA 3NTIA 4JUVA 4ZGJB 3L2VA 2OAUA 5GMKj 3CCEA 4M7DG 4XTYA 1WJQA 4PL6A 5GANh 4HA8A 3MP8A 3JCMQ 3TU4K 2ZZDA 3CCQT 3CCUA 3HL8A 1UGRB 4M78E 3Q1JA 1U1SA 5LJ5g 4BI3A 1D3BB 5LJ3h 4BB7A 4WF2A 1HK9A 2G3RA 4M7AB 3JCMJ 1N9SA 3JRZA 3OYGA 3CPFA 4F7UG 5GANj 1VQ5T 2KMTA 3MEWA 1WQWA 2B8AA 3RUXA 5GAOm 4RG8A 3SB2A 1UEBA 2A7YA 3A8OB 4BI4A 5LJ5d 4HKEA 4HT9A 3GNFB 2RI2A 4XTWA 4II1A 1KHIA 2MMPA 2LCCA 5I2SA 1QW1A 2LRQA 3LGLA 1W2BS 2LQKA 4MDWA 2X4JA 4BACA 1MHNA 4E7IA 1VQNT 4M7DA 1Q82U 4PJOC 3S3OA 2EAYA 4BD3A 2RI3A 2DZCA 2ZPEB 1KQSS 3HKSA 4QQGA 4A54A 5CKFA 3OS2A 2LX9A 1VQ6A 1QVFA 4IURA 2VV5A 3M56A 3CC2T 3CCSA 4EMHA 1BI3A 4C0FA 2DAQA 3A8LB 1VQLT 2HNIA 3OYYA 3OYEA 5A0GA 1Q82C 2RJCA 5I2MA 2OTJA 5LJ5e 5IT9E 4FT4A 4JRIA 3CCLT 2BIVA 2RK1A 3MEVA 4BY6C 3L42A 4NS5A 3RMQA 1VQ4T 2K5LA 3GPLA 4DA4A 2QQSA 1M90U 3ER0A 3EAEA 5CKHA 3JCMX 4M77G 1VQPA 4X34A 4XK8E 3QYGB 1JRIA 5LJ5h 3LWIA 4RCCA 2VXEA 2YHTA 4MDXA 3HRUA 3DLLA 1Y7XA 2VGMA 3QDRB 1YJ9T 3OBWA 4C5IA 4PNOA 1BKBA 2K3YA 1G3TA 2I2LA 1AHJB 3VU3C 3FB9A 2HBPA 1VQOA 1QVFS 1G3WA 3X28B 3C94A 2MI6A 1M90C 3N5BB 1XOVA 1G3YA 3OB9A 2VUBA 3CCRA 2RHIA 4LD6A 5DLOA 2EQKA 2BKDN 3BY7A 2P0PA 3OS1A 1Y07A 1QP3A 1X01A 2ZPGB 3V8LA 2DD5A 4PJOB 4XU3A 3OYNA 1LNXA 2H3JA 3LLRA 2O4XA 2FL7A 4B9WA 4M7DC 3CMEA 2E41A 3VKIA 4LDXA 3R6OA 1UGSB 2GF7A 3OBYA 2XI9A 2Y4XA 4L59A 4HCBA 3A8GB 2L89A 3QSUA 4VUBA 3G71T 4HCCA 3CBPA 4M78A 1VQKT 4M75C 4M7DF 1H3ZA 3KBGA 4JS5A 2QA4A 4D6WA 5KE3A 3TCJA 3L2ZA 1VQMA 4BY6B 1I4K1 1P92A 1O75A 5D6WA 2E1HA 3MCAB 1KQ1A 2E6ZA 2MWPA 2XK0A 1K73U 4C92E 3CCMA 4J7FA 1VQ7A 3QKJA 3OMGA 5GAOn 3SDZA 3I56A 1BI1A 5GAN5 1SSFA 1M1KU 2K5FA 4XTVA 5D6XA 1Q81C 2GCXA 2V8IA 3UDCA 4XU2A 4DOVA 4A4FA 3MO8A 4OGCA 3S3MA 4N4GA 5GANd 4E7HA 5GMKl 2OTLT 2DKGA 1K73C 3CC4T 3LWHA 4LD9K 4NOYA 2KQWA 2O01E 1M1KC 5CIUA 4O5VA 2LNVA 5GAMj 2WSCE 2F69A 1IREB 3M59A 2EKOA 4A4KA 2RK2A 4KUIA 3CCQA 5GMKe 2EJGA 4M7DB 3V8KA 3LGFA 4RG2A 3INZA 1NE8A 5GAN7 1RI0A 3HFNA 5J39A 1UB4A 1ZQ1A 4M77C 3CMAA 3JB9J 4KUDK 2PUKB 4OB3B 3PTAA 1VQ5A 1BYMA 3QZ5B 5CK9A 3BDUA 3X25B 4B9XA 5GANe 2PVDB 2RHZA 5FU7C 4C5HA 2VXFA 4F7UB 2YLBA 1M8VA 4M75B 2QI2A 2HQEA 5GMKh 2LVMA 4PLIA 3UT1A 3J81E 4HT8A 1FX7A 1I8FA 4XQ3A 2F5KA 1VQNA 2JN0A 3M5AA 4JDSA 3M58A 3HPWA 3OYDA 1KQSA 3SD4A 4OB2B 3V7SA 3V7RA 2RHUA 4C5GA 4N4HA 3CC2A 4NL2A 1VQLA 2LT1A 2R57A 3QIIA 4M78F 4L5GA 2ZCFB 4M78D 3QBYA 2VGNA 2D0QB 1R8OB 1FXXA 4QQ6A 1YI2A 1TH7A 5HKCA 1LOJA 1VQ4A 3FEOA 3OYAA 3DKMA 1B34A 4MZMA 3BFMA 2QEXT 2F5TX 3CCVA 4XTZA 3DLMA 2YRVA 3PNWC 1I5LA 2PVOB 3I55T 3FRNA 1MGQA 5CKEA 4N0AA 2DVEA 2VYTA 4PKCC 5LJ3f 2PQWA 1YJ9A 1S72T 2V8JA 3CBOA 2XIDA 3QJYA 4M77B 1H641 2O4XB 3JCMW 3ZBDA 4QVZA 1YHQT 2RHYA 3E9GA 1N27A 5C0MA 2XG8D 4C92A 4ELYC 3LH0A 1X75C 3JCMb 2WSEE 3OY9A 4RKUE 4Z02A 5FU7B 3QYHB 5KCOA 2XICA 2EJFA 3L2RA 1YIJT 2QQAA 2DTOA 5FROA 2DO3A 4IUVA 2RJDA 3S6WA 3QZ9B 2QDYB 3QXEB 2GQVA 3OA6A 2ZPBB 2CS7A 2Y4YA 1M9SA 2HQXA 2YLCA 3S3NA 1KC8U 4PJOE 2CYZB 4GY5A 4A4GA 3G6ET 3PIOA 3OW2A 3PIPA 4BDZA 3OYBA 3CCET 3MP1A 1VQ9T 3WVEB 3OYKA 4FSXA 3X26B 4JLIA 3HFOA 3G71A 1VQKA 2EYQA 1VIFA 4BI8B 1Q7YU 2KSSA 1NPRA 3A5ZB 3H6ZA 4J5YA 1U8RA 1WGSA 3OYIA 2DD4A 1YCYA 2CZ7B 2L5QA 5GAMg 5GAOp 1I81A 4EDUA 4EMKA 5GAN6 5DM7R 4DOWA 4M78G 1YJNA 2GFUA 5FLXE 3QUIA 3VYGA 2MAMA 1KD1U 2ZGWA 5GAMd 2EJ9A 2MWOA 2LTOA 5LJ5f 2L3RA 3OS0A 3QO3A 3JCMg 1KG1A 1KQ2A 2QQRA 4XAXB 1Y71A 5C6SA 1IZ6A 5LL6S 3M55A 4Q5WA 4JRPA 3PMTA 1KD1C 2D9TA 2R5AA 4XU0A 3JCMd 3OW2S 5CAIA 4BDYA 4L6V5 4MMLA 3OYJA 2P4TA 3CC4A 3JCMV 2DPPB 4CI0C 2FHDA 1XNIA 2RHXA 1YJWT 3CCST 3GP8A 2E70A 2PUOB 1ZBXA 1QVPA 3MHXA 2R58A 4OGEA 2NLUA 3DB3A 3UPUA 1UGPB 5GAMe 2L8DA 1VQ8A 2DZ9A 5FRNA 1OI1A 2RJFA 3OSVA 3RMSA 4C92F 4C92D 3J80E 2XHCA 2EWNA 2ZPHB 2V8KA 4IUUA 3MP6A 3JCMe 4O6JA 4C8QE 1Q86U 4NL3A 3JSCA 4C8QD 1KC8C 1O9SA 5GAMh 3NTKA 3CC7T 2QQ9A 2IG0A 4ME7A 2RM4A 4RMOA 3WVDB 1VQOT 5D6YA 2E12A 1HXDA 3OYHA 3T9NA 3JCMh 4C0ZA 1Q86C 2A3LA 4MMKA 2JUFA 2QQBA 2M0OA 2DJZA 4F7UE 4ZGDB 4OVAA 1G5VA 4M75E 5HK3A 2EIFA 4M75D 4JJNK 4ZTJA 2RI5A 2RJEA 3HRSA 5AYFA 3VUZA 5GAN2 3H8ZA 3DB4A 1RL2A 2RO0A 3EFSA 3LYIA 2K4YA 2M1HA 2QTXA 4LDVA 3RKWA 4E47A 2RD1A 3OYMA 4J7IA 2QEXA 4BE1A 1YBYA 3PGGA 3I55A 2PU9B 4PJOA 4V2SA 4M78C 3FDRA 4J8OA 3ASKA 5CQYA 1JB0E 3GOXA 1S72A 4M7AE 3URGA 4N4IA 2EQJA 5FU6C 2XD0A 4A53A 1NJIU 4M7AD 4J6YA 3CD6T 1YHQA 1M1GA 1JJ2A 2XDPA 5HK0A 3L2UA 3TREA 1N8RU 1BIAA 3E1SA 4EPCA 5HY6A 3WXMB 2XDDA 4LDYA 1YIJA 4C92G 2DK3A 5GAN3 1G3SA 4XTXA 3QJ6A 2LDMA 1NJIC 5GAOl 3CCLA 1VUBA 3M53A 2KAFA 3L2QA 3CCJT 4OB1B 5CVIA 4M77E 3CPWA 2AHJB 5DLQE 2K5IA 4RCBA 4M77D 4C8QG 2M16A 4DQ2A 5GANf 3JCMP 1N8RC 2DIGA 2HAXA 2WACA 3OS5A 1NZ9A 4MZTA 3ZFJA 1OZ3A 4E7LA 3JCMc 3HP9A 1VQ9A 1N6AA 1OYXA 3PFSA 5EG2A 4X9DA 3OYCA 1K9MU 1M4ZA 4IUTA 1X6OA 3M9QA 4Y91A 1BI2A 1YITT 1PSEA 4QW2A 4YTLA 4FT2A 3CMAT 1JJ2S 5GAN4 3JB9F 2P0KA 3G4ST 2X4WA 5A0LA 2JZ2A 4JRQA 3JB9D 2KVQG 4ZN3A 3C95A 1BI0A 3OMCA 4M75G 3X20B 1FWZA 4FL6A 4C8QA 1K9MC 2CZ0B 4C5EA 5LJ3j 4M78B 4LDUA 4BE0A 1W4SA 3CPWS 5L8RE 1WQ7A 5A2QE 5FU6B 3O8VA 3OQ5A 3X24B 4XU1A 3SWNA 4JS4A 5DY9A 3RERA 3JB9H 2DXBA 2E5QA 5J26A 2DEQA 3GNGA 4C0DC 5M9OA 5GAOq 2DXCA 3E9FA 4FM4B 1BIBA 1KHCA 3L2WA 1WJSA 1Y96A 3FLGA 1UGQB 2XU8A 1YJWA 4M7AG 2R5MA 4F7UA 2K57A 2KY9A 3CCUT 4PJOF 5KH6A 4M75A 3V8JA 3J7AF 3A8MB 4PJOD 2D6FA 1EIFA 2LT4A 3M4GA 4LDWA 2P0QA 2IVWA 3NTHA 3M4YA 1WNLA 4ZTFA 1YI2T 4J83A 4Y28E 4X9CA 3M54A 3CCVT 5GAOr 1PSFA 2JVVA 3CBMA 4XTUA 1Q7YC 5CQXA 2K2VA 2FYKA 3PT9A 3G7ZA 4N0AC 2WSFE 1D3BA 3META 3UWNA 5A0DA 4M7AA 3CC7A 4J6WA 4BE2A 3AHUA 2M9UA 1M5Q1 2GFAA 2OTLA 3P8BB 1XTDA 3VYHB 2BUDA 2LQ8A 2C06A 2E6NA 1JBMA 3RESA 1N9RA 5GAN8 3OYLA 1VQ6T 4C92C 4TVRA 5LJ5j 2KK4A 2JTMA 2RA2A 3LW5E 3QPHA 3CEYA 4GLKA 3QG1A 3RKXA 3JB9G 1M1FA 3P8HA 1NPPA 4QQDA 1QVGA 2OTJT 2RH2A 2DXUA 4C8QC 2E65A 4PLLA 5GMKi 3C4SA 3RKYA 1DJ7B 4C0DB 3QHSA 4KBMB 4M77A 1GXIE 3VJPA 5IAYA 2XKOC 2EQUA 3SWNC 2ZPFB 3NFCA 4KT0E 4JRKA 1VQPT 4IUPA 3HHTB 4C8QF 2MF2A 1U1TA 4R56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYT A;  3FDR A;  2PQW A;  4C5I A;  3ASK A;  2K3Y A;  1WJR A;  3GOX A;  2O4X B;  4N4I A;  2EQJ A;  4QVZ A;  5IN1 A;  2X35 A;  2RHY A;  3E9G A;  2DIQ A;  1N27 A;  5C0M A;  3LH0 A;  3OB9 A;  2XDP A;  4UC4 A;  3OY9 A;  3L2U A;  2RHI A;  3MEA A;  4LD6 A;  2EQK A;  2BKD N;  4Z02 A;  5KCO A;  3OS1 A;  4IKF A;  3L2R A;  5FRO A;  3P8D A;  4IUV A;  3OYN A;  4E7J A;  2RJD A;  3S6W A;  3LLR A;  2LDM A;  2O4X A;  2X4X A;  3QJ6 A;  4B9W A;  3OA6 A;  4E7K A;  3L2Q A;  3S3N A;  2HQX A;  3KUF A;  2X4Y A;  5KCH A;  4A4G A;  2GF7 A;  4GY5 A;  3PMI A;  2M16 A;  2DIG A;  4IUQ A;  2WAC A;  3ME9 A;  4L59 A;  4A4E A;  4BDZ A;  1OZ3 A;  3OYB A;  4E7L A;  3MP1 A;  3LX7 A;  5KE2 A;  3OYK A;  2L89 A;  1OYX A;  3MEU A;  2K3X A;  3PFS A;  4A4H A;  1H3Z A;  4HCZ A;  3OYC A;  3OYF A;  4IUT A;  3M9Q A;  3H6Z A;  2EFI A;  5KE3 A;  1WGS A;  4QW2 A;  3OYI A;  5FRM A;  3FC3 A;  1OZ2 A;  4FU6 A;  5D6W A;  2P0K A;  4EDU A;  2X4W A;  2JZ2 A;  2MWP A;  2GFU A;  2XK0 A;  3OMC A;  3QKJ A;  3OMG A;  3OS0 A;  2MWO A;  2LTO A;  1SSF A;  2L3R A;  4FL6 A;  4C5E A;  2JTF A;  5D6X A;  4BE0 A;  4CRI A;  2QQR A;  3F70 A;  5C6S A;  4A4F A;  3O8V A;  3MO8 A;  3OQ5 A;  4Q5W A;  3S3M A;  3PMT A;  4N4G A;  4E7H A;  2D9T A;  2R5A A;  2E5Q A;  3BDL A;  5J26 A;  5M9O A;  4BDY A;  2CKK A;  3E9F A;  3OYJ A;  3ZEH A;  2EQM A;  3NTI A;  3L2V A;  1KHC A;  5CIU A;  3L2W A;  1WJS A;  2FHD A;  1XNI A;  2RHX A;  3FLG A;  1WJQ A;  4PL6 A;  2R5M A;  3MP8 A;  2EKO A;  5KH6 A;  2R58 A;  2NLU A;  3DB3 A;  3Q1J A;  3LGF A;  4RG2 A;  2G3R A;  2L8D A;  1RI0 A;  5J39 A;  3OYG A;  3NTH A;  5FRN A;  1OI1 A;  2RJF A;  4ZTF A;  3MEW A;  2B8A A;  4IUU A;  4B9X A;  2RI2 A;  2RHZ A;  4II1 A;  3MP6 A;  4C5H A;  2LCC A;  2HQE A;  3LGL A;  2LRQ A;  2LVM A;  4PLI A;  3UT1 A;  4BAC A;  1MHN A;  4E7I A;  3MET A;  3NTK A;  3UWN A;  2F5K A;  4BE2 A;  3S3O A;  2IG0 A;  4BD3 A;  2GFA A;  2RI3 A;  2BUD A;  3OYD A;  2E6N A;  5D6Y A;  3SD4 A;  4QQG A;  3OYL A;  3OYH A;  3OS2 A;  4IUR A;  2RHU A;  4C5G A;  4N4H A;  3CEY A;  2DAQ A;  2R57 A;  3OYE A;  3P8H A;  2M0O A;  3QII A;  4QQD A;  2RJC A;  4OVA A;  1G5V A;  3QBY A;  4PLL A;  3C4S A;  4ZTJ A;  2BIV A;  4QQ6 A;  2RI5 A;  2RJE A;  5IAY A;  3MEV A;  2EQU A;  3H8Z A;  3L42 A;  4NS5 A;  3FEO A;  3OYA A;  3DB4 A;  2RO0 A;  3LYI A;  2QQS A;  2M1H A;  3OYM A;  3EAE A;  4IUP A;  3DLM A;  4BE1 A;  2YRV A;  3PNW C;  4X34 A; 
#chains in the Genus database with same CATH topology
 4P5N A;  1JXM A;  3EG0 A;  2HKQ B;  1SG5 A;  4J9I A;  1NLP C;  4PJO G;  1AWJ A;  3CCR T;  2CZ1 B;  3EFR A;  3MEA A;  2M02 A;  3GIB A;  1UDL A;  1VQ8 Q;  3P8D A;  2O88 A;  5CCA A;  3V7C A;  1J3T A;  5KCH A;  4M7A C;  3VUB A;  3HSB A;  4PFZ A;  3JCM f;  8AT1 B;  4ZN1 A;  2DXT A;  3LX7 A;  4C8Q B;  3OYF A;  2PVG B;  2QA4 T;  3GF5 A;  5CR2 A;  1VQM T;  5IXF A;  3CCM T;  1K8A U;  4R55 A;  2EYX A;  3TEE A;  3JAM E;  4HVW A;  1Y96 B;  4FIB A;  3IQL A;  2CGH A;  4M77 F;  1LJO A;  4ELZ C;  4EMK B;  1CKB A;  3BDL A;  3ZL7 C;  1TTH B;  2CKK A;  2GQI A;  3L2V A;  5GMK j;  3CCE A;  2C0T A;  4PL6 A;  2E4H A;  2ZZD A;  3CCQ T;  4BI3 A;  2G3R A;  3EG9 A;  3CC2 Q;  4F7U G;  1VQ5 T;  1VQL Q;  2JJ9 A;  3RUX A;  1AVZ C;  1JXO A;  4II1 A;  2LQK A;  2AZS A;  2RI3 A;  4QT7 A;  1KQS S;  1YJ9 Q;  4IUR A;  4EMH A;  4M4Z A;  3A8L B;  2HNI A;  5A0G A;  2BZY A;  4JRI A;  1RAG B;  3CCL T;  2BIV A;  3NHN A;  2KR3 A;  3ER0 A;  3QYG B;  1JRI A;  1Y7X A;  3QDR B;  4C5I A;  4PNO A;  5IHN A;  2LX7 A;  2QAZ A;  1IGQ A;  5KYX B;  1G3W A;  3X28 B;  2MI6 A;  3VRZ A;  1NM7 A;  1Y0M A;  3CCR A;  3BY7 A;  2P0P A;  2ZPG B;  1X01 A;  2LJ1 A;  4PJO B;  4XU3 A;  1PWT A;  5GJW B;  4B9W A;  4M7D C;  3VS7 A;  2E41 A;  3VKI A;  1U06 A;  2EQI A;  2QK0 A;  2Y4X A;  4L59 A;  4F14 A;  2PNI A;  2LCS A;  1JO8 A;  2L89 A;  2GNC A;  2JM8 A;  4VUB A;  3G71 T;  3ULR B;  2QA4 A;  1VQM A;  2FZK B;  1D0X A;  1O75 A;  2DLP A;  3JV3 A;  1KQ1 A;  2XK0 A;  4AG2 C;  4C92 E;  3CCM A;  3QKJ A;  3OMG A;  1BI1 A;  1M1K U;  2YUP A;  1Q81 C;  2SRC A;  4A4F A;  1Q81 R;  4E7H A;  2OTL T;  2IPO B;  1K4U S;  4NOY A;  2NUP A;  2X9H A;  2O01 E;  5CIU A;  1C0M A;  2OAW A;  4IIO A;  2WSC E;  1HSQ A;  3CCQ A;  2AT1 B;  3LGF A;  1PG5 B;  1ZQ1 A;  4M77 C;  3PTA A;  1VQ5 A;  3TSZ A;  2DL3 A;  5GAN e;  4F7U B;  2YLB A;  4M75 B;  5GMK h;  3UT1 A;  1VYV A;  2X3X D;  2F5K A;  4LE9 A;  3HPW A;  3OYD A;  1KQS A;  3V7R A;  4C5G A;  1EZZ B;  1RI9 A;  2L2P A;  4NL2 A;  1M3B A;  2XMF A;  4L5G A;  2VGN A;  3G4S Q;  2D0Q B;  4KH1 B;  1R8O B;  1W2B P;  1FXX A;  1YI2 A;  4J9C A;  1WHJ A;  1TH7 A;  3DKM A;  4XTZ A;  2YRV A;  2PVO B;  2DVE A;  4PKC C;  2PQW A;  1LPL A;  2GGR A;  1PD0 A;  4QVZ A;  1N27 A;  2EGC A;  1RAA B;  5ECA A;  4AFZ C;  3OY9 A;  5KCO A;  2QQA A;  3VS3 A;  4IUV A;  2DBM A;  9ATC B;  1K1Z A;  4PFP A;  2CS7 A;  2YLC A;  2HQX A;  1KC8 U;  1D0Y A;  4GY5 A;  1VA7 A;  3PIP A;  1QVF P;  1IO6 A;  3G71 A;  1A0N B;  4BI8 B;  2KSS A;  4ORZ A;  2FZG B;  1ZSZ C;  1YCY A;  2KRO A;  2J06 A;  4Z89 A;  4EDU A;  4EMK A;  5GAN 6;  4DOW A;  3MKD A;  4M78 G;  3VYG A;  3OS0 A;  2EJ9 A;  2LTO A;  2L3R A;  4JRP A;  4ZNX A;  1ABO A;  1D09 B;  1OV3 A;  2G6F X;  5CAI A;  4L6V 5;  3OYJ A;  2DFU A;  1IHV A;  1UEC A;  2DPP B;  4CI0 C;  4LXC A;  1ZBX A;  3EGX B;  2R58 A;  1X6G A;  1UGP B;  5FRN A;  2RJF A;  3OSV A;  3MJX A;  4C92 D;  3J80 E;  2V8K A;  1Q86 U;  3EG3 A;  3JSC A;  3CC7 T;  4Z88 A;  2RM4 A;  2DX1 A;  2E12 A;  7AT1 B;  1HD3 A;  1D1B A;  4MMK A;  1G2B A;  1TWB A;  4OVA A;  3TQ7 P;  1G5V A;  3M0S A;  2EIF A;  4M75 D;  1VQ7 Q;  2RI5 A;  3HRS A;  5GAN 2;  2DMO A;  4J9H A;  3DB4 A;  2RO0 A;  2K4Y A;  3OYM A;  1WA7 A;  4IIM A;  4PJO A;  4V2S A;  3ASK A;  2DF6 A;  4A53 A;  4M7A D;  4J6Y A;  3I5S A;  1JJ2 A;  1OPK A;  3E1S A;  4EPC A;  1YIT Q;  3WXM B;  1T3L A;  3EHQ A;  2L3S A;  4XTX A;  2RN8 A;  2RNA A;  2AZV A;  2HSP A;  4M77 E;  1WHM A;  2DBK A;  2K6D A;  2K5I A;  3JCM P;  1F1B B;  4E7L A;  3JCM c;  1T0H A;  3NMZ C;  1N6A A;  4J9E A;  5EG2 A;  1BI2 A;  4FT2 A;  3CMA T;  3JB9 D;  2FRY A;  3C95 A;  1BI0 A;  2W10 A;  4J9B A;  1K9M C;  5LJ3 j;  4M78 B;  1OU8 A;  4BE0 A;  1K9M R;  3X24 B;  4XU1 A;  3SWN A;  5DY9 A;  3RER A;  3JB9 H;  2DXB A;  3GNG A;  4FM4 B;  1FMW A;  1KHC A;  1WJS A;  3PVL A;  1C1A A;  3FLG A;  1UGQ B;  2NUT B;  4F7U A;  2KY9 A;  3CCU T;  3M0U A;  4PJO F;  4M75 A;  1W70 A;  2LT4 A;  1NEG A;  2IVW A;  3NTH A;  3RDV A;  1OUL A;  2D8H A;  2Z0W A;  3UF4 A;  4J83 A;  2DL8 A;  4CC3 A;  3M54 A;  3CCV T;  1FMK A;  4XTU A;  2K2V A;  2CSI A;  2KGT A;  3MET A;  3UWN A;  4M7A A;  3CC7 A;  4J6W A;  4BE2 A;  2GFA A;  2F1L A;  1D1A A;  2NUZ A;  1OPL A;  1RAI B;  2J05 A;  5GAN 8;  5LJ5 j;  2JS0 A;  3LW5 E;  3QPH A;  3RKX A;  3QG1 A;  1M1F A;  2HMA A;  4QQD A;  1QVG A;  2OTJ T;  2RH2 A;  4C8Q C;  1ABQ A;  1YFN A;  3REB B;  1YJN Q;  4C0D B;  3SEM A;  4OMN A;  3NFC A;  1S1N A;  4QKU A;  1PM3 A;  4JRK A;  3VS6 A;  1TUC A;  1QKW A;  4R56 A;  2YXY A;  1E7O A;  3RIR A;  1QQJ A;  1WJR A;  4M7D D;  1PCX A;  5IN1 A;  2A08 A;  3FJ5 A;  4EMK C;  4KUL A;  5CKB A;  2JOY A;  4IKF A;  2E10 A;  1WXB A;  5KYW A;  1CKA A;  4AG1 C;  4F7U F;  4M75 F;  5GAM f;  4E7J A;  3A8H B;  2CZ6 B;  3C12 A;  2VC8 A;  3CME T;  4QVD A;  4E7K A;  4FYW B;  1WXT A;  2X4Y A;  5J3B A;  3QWY A;  4PFO A;  3PMI A;  4A4E A;  1Q95 G;  3VV0 A;  2LCL A;  2V1Q A;  5LJ3 d;  5KE2 A;  4JLG A;  2LC4 A;  5I21 A;  4HCZ A;  4GBQ A;  4M7A F;  1YWP A;  3M57 A;  5FRM A;  4OMP A;  1VQ8 T;  3SFM A;  4OF1 A;  3I56 T;  3H0I A;  1X6B A;  2KDS A;  2RB6 A;  3EGX A;  2HD0 A;  2EYY A;  3G6E A;  1K8A C;  4J6X A;  2ECZ A;  2EQM A;  3NTI A;  4ZGJ B;  2OAU A;  1UE9 A;  4XTY A;  1WJQ A;  2HZY A;  3JCM Q;  3CCU A;  1BK2 A;  1UGR B;  2KXC A;  1YHQ Q;  1D3B B;  5LJ3 h;  4BB7 A;  4WF2 A;  1HK9 A;  4PJL A;  3JCM J;  3JRZ A;  3CPF A;  3CQT A;  1WQW A;  2B8A A;  2QDL A;  5GAO m;  5LJ5 d;  1UEB A;  4BI4 A;  4HKE A;  1H3H A;  1VYT A;  1G8X A;  3GNF B;  2RI2 A;  1YN8 A;  2DL4 A;  4M7D A;  4BAC A;  1MHN A;  4PJO C;  1Q82 U;  1MV3 A;  6AT1 B;  3UA7 A;  2ZPE B;  1M2V B;  2YDL A;  4F16 A;  3CC2 T;  3CCS A;  1VQL T;  2DAQ A;  1NLO C;  3OYY A;  3OYE A;  1AZE A;  2OTJ A;  5IT9 E;  4FT4 A;  1AWO A;  2A36 A;  2HDA A;  1U3O A;  3MEV A;  1VQ4 T;  2KRM A;  1SRM A;  1T3S A;  3GPL A;  4DA4 A;  2QQS A;  4X34 A;  5LJ5 h;  1AWX A;  4RCC A;  3DLL A;  2VGM A;  1YJ9 T;  3OBW A;  2ZAE A;  4K11 A;  2K3Y A;  2I2L A;  4FYX B;  1AHJ B;  1VQO A;  2HBP A;  3C94 A;  1G3Y A;  2VUB A;  4KRT A;  2RHI A;  1MMN A;  2EQK A;  2BKD N;  1RAD B;  3V8L A;  2DD5 A;  1LNX A;  1SKU B;  2FL7 A;  3VS5 A;  3CME A;  1UGS B;  1AEY A;  2VWF A;  3A8G B;  3QSU A;  3CBP A;  4M78 A;  4M7D F;  4M75 C;  1H3Z A;  4D6W A;  5KE3 A;  3L2Z A;  1I4K 1;  1P92 A;  2E1H A;  1K73 U;  3VS2 A;  5GAO n;  3I56 A;  5GAN 5;  1SSF A;  2NUT A;  4XTV A;  5D6X A;  3UDC A;  4XU2 A;  1QKX A;  2CT4 A;  4X1V A;  4N4G A;  2MYS A;  2DKG A;  3M0R A;  1I5O B;  4LD9 K;  2CT3 A;  1M1K C;  4O5V A;  3M59 A;  2EKO A;  5GMK e;  2EJG A;  4RG2 A;  3HFN A;  5J39 A;  2P84 A;  4J9F A;  2PUK B;  4OB3 B;  2O9S A;  4RTT A;  1U5S A;  2E3H A;  2PVD B;  1KSW A;  2VXF A;  2LVM A;  4PLI A;  3J81 E;  4FSS A;  1FX7 A;  2JN0 A;  4AFS C;  3M58 A;  3I55 Q;  4HCK A;  2RHU A;  1UGV A;  5GJV B;  1S72 Q;  3CC2 A;  1VQL A;  2LT1 A;  4M78 F;  2A0F B;  1ZSZ A;  1UJ0 A;  2JM9 A;  1NEB A;  1OX9 A;  1YIJ Q;  1VQ4 A;  3BFM A;  1YNZ A;  2KEA A;  4DBF A;  1KQS P;  4N0A A;  1YJ9 A;  2V8J A;  2XID A;  1H64 1;  2O4X B;  3CCE Q;  2RHY A;  3E9G A;  2KT8 A;  4ELY C;  3LH0 A;  3JCM b;  2DVJ A;  2WSE E;  4OML A;  2A28 A;  4RKU E;  4Z02 A;  5FU7 B;  2XIC A;  3S6W A;  2Y4Y A;  1VYU A;  4LUD A;  3EFO B;  5IHI A;  3RBB B;  3OW2 A;  3OYB A;  1VQ9 T;  4FSX A;  4PJO E;  3EGU A;  1KC8 C;  1WGS A;  3OYI A;  1KC8 R;  1TUD A;  3BE3 A;  1SHF A;  3QUI A;  2ZGW A;  5FW9 A;  4EIK A;  3QO3 A;  2QQR A;  5C6S A;  5LL6 S;  4KGV B;  3M55 A;  2CP6 A;  3JCM d;  3HTR A;  1UHF A;  2DJQ A;  3A1P A;  4MML A;  1W1F A;  1NG2 A;  1BCM A;  2FHD A;  2FO0 A;  2RHX A;  5L23 A;  1YJW T;  1BBZ A;  2DET A;  1UJY A;  3GP8 A;  2E70 A;  3MHX A;  2EVR A;  8ATC B;  4OGE A;  2NLU A;  3UPU A;  1RUW A;  2L8D A;  3G1J A;  2EPD A;  3CCR Q;  1LVK A;  1OI1 A;  3RMS A;  1LCK A;  1M2V A;  2XHC A;  3MP6 A;  4C8Q D;  1XJW B;  1M27 C;  2QQ9 A;  1RLP C;  2DA9 A;  1X2K A;  2VB6 A;  5D6Y A;  3OYH A;  1HXD A;  1T0J A;  3JCM h;  3RNJ A;  1Q86 C;  2JUF A;  2KT1 A;  2QQB A;  1I07 A;  2DJZ A;  4F7U E;  1Q86 R;  2ROL A;  3CD6 Q;  4M75 E;  1NYG A;  1Z9Q A;  2E3I A;  2M51 A;  3I9Q A;  4OMO A;  1RL2 A;  4BE1 A;  1GRI A;  3M0Q A;  4J7I A;  1ZUU A;  3CCJ Q;  2O9V A;  3PGG A;  2PU9 B;  4M78 C;  5CQY A;  1JB0 E;  4M7A E;  4N4I A;  2EQJ A;  1NJI U;  2C0O A;  2HQH A;  1VOM A;  3L2U A;  2XDD A;  5GAN 3;  4DEY A;  1OU9 A;  2YRC A;  1VQ5 Q;  3CCL A;  2YWW A;  5GAO l;  1VUB A;  5CVI A;  4RCB A;  5GAN f;  3OS5 A;  3ZFJ A;  1VQ9 A;  1OYX A;  3PFS A;  1MNE A;  4Y91 A;  1K0X A;  1YIT T;  4YTL A;  4QW2 A;  1JJ2 S;  1WLP B;  2JZ2 A;  4AT1 B;  2KVQ G;  1ZA2 B;  4FL6 A;  4C8Q A;  1I1J A;  3EGD B;  2BZ8 A;  1YI2 Q;  5A2Q E;  3OQ5 A;  4JS4 A;  1MMA A;  2E5Q A;  4C0D C;  2DEQ A;  1BIB A;  1Y96 A;  4GLM A;  1YJW A;  3V8J A;  3A8M B;  4PJO D;  1VQ6 Q;  3M4G A;  1K76 A;  1PHT A;  2KYB A;  2P0Q A;  4WTO B;  4ZTF A;  2EYZ A;  1WZO A;  2LQW A;  1PSF A;  3CBM A;  1Q7Y C;  3VS1 A;  1MMG A;  1Q7Y R;  4N0A C;  5A0D A;  1WYX A;  2M9U A;  1M5Q 1;  4E6R A;  2OTL A;  1EFN A;  1XTD A;  2BUD A;  2DRK A;  2LQ8 A;  2C06 A;  2E6N A;  1JBM A;  1Y57 A;  3RES A;  3OYL A;  2HL5 C;  2W0Z A;  2X51 A;  2ROT A;  2RA2 A;  4RTY A;  1PKT A;  3P8H A;  2DXU A;  2ATC B;  4PJJ A;  2DE0 X;  1WIE A;  1TS9 A;  3QHS A;  2LJ3 A;  1KIK A;  3VJP A;  5IAY A;  3E2U A;  2J6K A;  4RTZ A;  4KT0 E;  1VQP T;  1SSH A;  4C8Q F;  2MF2 A;  1U1T A;  4E2F B;  4OP0 A;  4M7D E;  1B3Q A;  1Q81 U;  4HVU A;  1QCO A;  2DIQ A;  2HSE B;  4JZ4 A;  3EFO A;  3GLX A;  1YJN T;  2MPX C;  1QVG S;  4OMF B;  3I5R A;  2GTJ A;  4HXJ A;  2X4X A;  3KUF A;  2CP5 A;  5KYX A;  5LJ3 g;  1YWO A;  3BW1 A;  4IUQ A;  4OB0 B;  3CXC A;  1VIE A;  2K3B A;  1E6G A;  2MK5 A;  1JEG A;  2QAS A;  2K3X A;  1XQH A;  4A4H A;  1YIT A;  1GCQ A;  2BE9 B;  4ZGE B;  4FU6 A;  3KXT A;  4D8K A;  4JJD A;  5I11 A;  4AFU C;  2LP5 A;  1WPY A;  4CRI A;  2Y90 A;  1W2B A;  5CO7 A;  4BUG A;  4E7S A;  2FPD A;  5LJ3 e;  3E19 A;  3L1A A;  2DTH A;  4RUG A;  1VQN Q;  2QGG A;  5GAN h;  3MP8 A;  2BE7 D;  3TU4 K;  3HL8 A;  4M78 E;  1QCF A;  5LJ5 g;  1TUG B;  1UG1 A;  3EH2 A;  3OYG A;  3A98 A;  5I22 A;  1MND A;  3SB2 A;  3A8O B;  1WHK A;  4HT9 A;  1RLQ C;  1KHI A;  2MMP A;  5I2S A;  1QW1 A;  2LRQ A;  3VS4 A;  2X4J A;  2BZX A;  4E7I A;  3S3O A;  4BD3 A;  2DZC A;  3R6N A;  4JPB W;  2DL7 A;  3HKS A;  2D8J A;  4QQG A;  5CKF A;  1IXD A;  3OS2 A;  2LX9 A;  1QVF A;  1BI3 A;  1Q82 C;  2RJC A;  5I2M A;  5LJ5 e;  1HYO A;  4PJM A;  1QWE A;  2RK1 A;  1KK7 A;  1V1C A;  3L42 A;  4NS5 A;  4FYY B;  2K5L A;  3RMQ A;  1M90 U;  1VQP A;  4XK8 E;  4KGZ B;  3HRU A;  1BKB A;  1JQQ A;  1TU0 B;  2CH4 W;  1G3T A;  2KI7 A;  4F17 A;  2CSQ A;  2MCN A;  3VU3 C;  1AOJ A;  1OX8 A;  3N5B B;  1VQK Q;  5DLO A;  1Y07 A;  3OYN A;  1TSF A;  2H3J A;  1PRL C;  4LDX A;  3R6O A;  2LMJ A;  3OBY A;  1WHH A;  1YCS B;  4HCC A;  3EGD A;  3CC4 Q;  3KBG A;  4BY6 B;  2E6Z A;  2MWP A;  2B86 A;  3QDF A;  2JTE A;  2GCX A;  2V8I A;  1RAF B;  3EG9 B;  5GMK l;  1K73 C;  2JS2 A;  4PJN A;  4DEX A;  5KYU B;  2GTO A;  2LNV A;  5GAM j;  2F69 A;  4KUI A;  3V8K A;  2EYW A;  3INZ A;  1NE8 A;  3CMA A;  1RI0 A;  3JB9 J;  4KUD K;  1BYM A;  2KE9 A;  3X25 B;  1PC0 A;  3THK A;  4B9X A;  1AZG B;  2RHZ A;  1IRX A;  5FU7 C;  4C5H A;  1ZX6 A;  2QI2 A;  2HQE A;  4HT8 A;  1UTI A;  4XQ3 A;  1I8F A;  2QEX Q;  3M5A A;  4JDS A;  1BU1 A;  1K8A R;  3SD4 A;  4OB2 B;  3V7S A;  2NWM A;  4HVV A;  4N4H A;  2R57 A;  4RTW A;  5FWC A;  4M78 D;  1FYN A;  2V26 A;  2FZC B;  2QTV A;  2FRW A;  5HKC A;  2HEQ A;  3OYA A;  1GFC A;  4MZM A;  3CCV A;  1I5L A;  3I55 T;  1MGQ A;  5CKE A;  3G6E Q;  1X43 A;  1S72 T;  1PNJ A;  2CH4 A;  3CBO A;  3QJY A;  3ZBD A;  1GCQ C;  3EHR A;  2XG8 D;  1X75 C;  3CCU Q;  1UHC A;  1YIJ T;  3SHW A;  5FRO A;  2DO3 A;  3QZ9 B;  4FCY A;  4LN2 A;  3QXE B;  2F2W A;  3S3N A;  3EG1 A;  3CCE T;  2I0N A;  3WVE B;  3OYK A;  3GBQ A;  3HFO A;  4E7Z A;  4OMQ A;  2AIR B;  2DD4 A;  2CZ7 B;  1I81 A;  3CCS Q;  3VS0 A;  1KD1 U;  2GFU A;  4WCI A;  5FLX E;  2MAM A;  2RF0 A;  2D1X A;  5GAM d;  1IGU A;  3JCM g;  1KG1 A;  4LUE A;  1Y71 A;  1QCN A;  2D9T A;  4XU0 A;  1WXU A;  3OW2 S;  2QG9 B;  4BDY A;  5IH2 A;  2P4T A;  3JCM V;  2FPF A;  4J9G A;  4RTU A;  2LNH B;  1QVP A;  1WI7 A;  1VQO Q;  1D1C A;  3DB3 A;  2KYM A;  1VQ8 A;  2DZ9 A;  2K79 A;  2K7A A;  2ZPH B;  2X3W D;  4KH0 B;  3JCM e;  4O6J A;  4C8Q E;  2CDT A;  4NL3 A;  1O9S A;  5GAM h;  3NTK A;  2VVK A;  1NBE B;  2IG0 A;  4RMO A;  1M1K R;  2LZ6 B;  2LQN A;  4C0Z A;  2A3L A;  1JU5 C;  2CP0 A;  2OI3 A;  1I0C A;  5HK3 A;  4ZTJ A;  1OOT A;  3VUZ A;  5AYF A;  2EKH A;  3EH1 A;  3H8Z A;  3I56 Q;  4JJB A;  1R0C B;  3EFS A;  3RKW A;  2M1H A;  4LDV A;  4E47 A;  2ENM A;  2COY A;  3I55 A;  2VAS A;  2OJ2 A;  4JJC A;  1BB9 A;  1S72 A;  2OX7 A;  3URG A;  3CD6 T;  1M1G A;  1N8R U;  1BIA A;  2QYZ A;  5HY6 A;  4LDY A;  1YIJ A;  2J7I A;  4C92 G;  2DK3 A;  1G3S A;  4CC4 B;  1NJI C;  1ZA1 B;  2LDM A;  3C0C A;  3CCJ T;  2KAF A;  3CPW A;  1ARK A;  1NJI R;  2AHJ B;  5DLQ E;  2YRD A;  2HAX A;  4DQ2 A;  2FPE A;  1NZ9 A;  1AT1 B;  4MZT A;  1OZ3 A;  3QWX X;  1IHW A;  3OYC A;  1UFF A;  1M4Z A;  4IUT A;  2YUO A;  1MMD A;  3M9Q A;  5GAN 4;  2P0K A;  3G4S T;  2VKN A;  4JRQ A;  4M75 G;  5KYU A;  1FWZ A;  3EG2 A;  1H8K A;  4LDU A;  1WQ7 A;  5FU6 B;  3O8V A;  2RMO A;  1VQ4 Q;  5J26 A;  5M9O A;  4KGX B;  2DXC A;  1GBQ A;  3RR6 A;  2FEI A;  4M7A G;  5KYN A;  2K57 A;  5KH6 A;  3J7A F;  2DYB A;  2D6F A;  1EIF A;  4FW1 A;  4LDW A;  3M4Y A;  3TSW A;  1YI2 T;  4X9C A;  1B07 A;  5GAO r;  2JVV A;  1SPK A;  5CQX A;  2BTT A;  3PT9 A;  1NYF A;  2H8H A;  1D3B A;  1ACM B;  2IIM A;  1SRL A;  3VYH B;  1BCO A;  1K0S A;  1VQ6 T;  2JTM A;  1M8M A;  3CEY A;  3AT1 B;  3JB9 G;  1GCP A;  3RKY A;  2EGE A;  4KBM B;  1GXI E;  3H0F A;  2HL3 A;  3H0H A;  2EQU A;  1OQK A;  2ZPF B;  1R0B G;  4IUP A;  4RTX A;  4MZP A;  1QLY A;  1ZHI A;  2FVU A;  2YUN A;  2KXD A;  2X35 A;  1QP2 A;  3CD6 A;  1B34 B;  1V29 B;  1TG0 A;  4UC4 A;  2DER A;  3FJP A;  2QA4 Q;  1RAB B;  3HRT A;  1KFZ A;  1VQM Q;  2E64 A;  2O31 A;  1M3A A;  2AKK A;  4ATO A;  4EMG A;  2ZPI B;  5GAN g;  3LH5 A;  1PD1 A;  3CCM Q;  4OMM A;  3CCJ A;  2J6O A;  1R77 A;  1KJW A;  4C92 B;  5GMK m;  4AFQ C;  3ME9 A;  3UAT A;  2XDB A;  5CKD A;  3MEU A;  2PZ1 A;  1WHL A;  2HBW A;  2EFI A;  3SWN B;  5AT1 B;  3FC3 A;  1OZ2 A;  3M0P A;  1RAC B;  4AMC A;  3G4S A;  2L3Q A;  4QVC A;  1VQ7 T;  3CCQ Q;  2JMA A;  2DTI A;  3OSS C;  2GBQ A;  3NGP A;  2JTF A;  3CXC P;  2JNG A;  2FB7 A;  3TVT A;  3F70 A;  4C0G A;  2QXF A;  3JB9 I;  3MPU B;  3FIF A;  3CXC S;  3ZEH A;  4JUV A;  4M7D G;  1JJ2 P;  1M3C A;  4HA8 A;  2PTK A;  1D0Z A;  1WDX A;  2O2O A;  3Q1J A;  1U1S A;  2L3P A;  4M7A B;  4F04 B;  1N9S A;  5GAN j;  2C0I A;  2KMT A;  3MEW A;  4RG8 A;  2A7Y A;  4XTW A;  3CCL Q;  1X2Q A;  2LCC A;  3LGL A;  1W2B S;  2ESW A;  1B7T A;  4MDW A;  1VQN T;  2M0Y A;  2EAY A;  4A54 A;  1VQ9 Q;  2SEM A;  1VQ6 A;  2VV5 A;  3M56 A;  5FWB A;  5HCK A;  2F2X A;  4C0F A;  1TXQ A;  5IHK A;  3PE0 A;  4BY6 C;  1QWF A;  2L0A A;  2CP2 A;  3EAE A;  5CKH A;  3JCM X;  4M77 G;  5KYW B;  3LWI A;  4DBH A;  4DBR A;  2VXE A;  2YHT A;  4MDX A;  2RPN A;  1WX6 A;  1TOV A;  1PRM C;  3FB9 A;  1QVF S;  1M90 C;  1X69 A;  1YJW Q;  1XOV A;  3VRY A;  3G71 Q;  1ZUY A;  3OB9 A;  4LD6 A;  5EC7 A;  3OS1 A;  1M90 R;  1QP3 A;  1UUE A;  2K2M A;  1AWW A;  3LLR A;  2O4X A;  2RQR A;  2GF7 A;  2XI9 A;  2RQW A;  2F2V A;  4HCB A;  2AK5 A;  2OTL Q;  1VQK T;  1QVG P;  4JS5 A;  4RTV A;  3TCJ A;  2CP3 A;  5D6W A;  3MCA B;  2LJ0 A;  4J7F A;  1VQ7 A;  3SDZ A;  4CC7 A;  1N5Z A;  2K5F A;  2KNB B;  5IXB A;  4DOV A;  3MO8 A;  4OGC A;  3S3M A;  1ZUK A;  5GAN d;  1SEM A;  2DRM A;  5KYY B;  3CC4 T;  3LWH A;  2KQW A;  3REA B;  2J6F A;  2CUB A;  1IRE B;  2MOX A;  4A4K A;  2RK2 A;  2ED0 A;  4M7D B;  3UA6 A;  5GAN 7;  1UB4 A;  1ZSG A;  4Z8A A;  4B6M A;  3QZ5 B;  2COW A;  5CK9 A;  3BDU A;  2JXB A;  2YUQ A;  2DM1 A;  1M8V A;  2DNU A;  4CC2 A;  1WFW A;  2JT4 A;  1FMV A;  1VQN A;  1QMC A;  2YT6 A;  1SF9 A;  4JZ3 A;  3QII A;  2JW4 A;  3M0T A;  2ZCF B;  3QBY A;  4Y92 A;  4QQ6 A;  3I35 A;  1LOJ A;  3FEO A;  1B34 A;  2QEX T;  2F5T X;  3DLM A;  3PNW C;  1K9A A;  1IB8 A;  3FRN A;  1WHG A;  2VYT A;  1YP5 A;  5LJ3 f;  4M77 B;  3JCM W;  1YHQ T;  4DBQ A;  5C0M A;  5D7U A;  4C92 A;  4R0K A;  3QYH B;  2EJF A;  3H41 A;  3L2R A;  2DTO A;  1Q82 R;  2RJD A;  2QDY B;  2GQV A;  3OA6 A;  2DL5 A;  2ZPB B;  1M9S A;  2CYZ B;  4A4G A;  3G6E T;  1MV0 B;  3PIO A;  2YSQ A;  4BDZ A;  1MUZ A;  3MP1 A;  3PVQ A;  3X26 B;  2NYS A;  4JLI A;  1VQK A;  2FG0 A;  1VIF A;  2EYQ A;  1Q7Y U;  1NPR A;  3A5Z B;  3H6Z A;  4J5Y A;  1U8R A;  2L5Q A;  5GAO p;  1E6H A;  5GAM g;  5DM7 R;  2K9G A;  1YJN A;  2MWO A;  5LJ5 f;  4J9D A;  2AKL A;  1ZLM A;  1KQ2 A;  4A63 B;  4XAX B;  1IZ6 A;  2DEU A;  4Q5W A;  3PMT A;  1KD1 C;  2R5A A;  2QGF B;  1VQP Q;  2CUD A;  1KD1 R;  3CC4 A;  2ABL A;  1XNI A;  3CC7 Q;  2JMC A;  3CCS T;  1ZBJ A;  2PUO B;  1CSK A;  4FYV B;  1PKS A;  5GAM e;  4ESR A;  2DYI A;  4LNP A;  4C92 F;  2KRS A;  2P4R A;  2EWN A;  4IUU A;  2EGA A;  1ZSZ B;  2HCK A;  4ME7 A;  1GL5 A;  2RQT A;  1K73 R;  3WVD B;  1VQO T;  1SHG A;  3T9N A;  3NPF A;  2M0O A;  4ZGD B;  3KFV A;  4JJN K;  2KBT A;  2RJE A;  2CP7 A;  2D0N A;  3LYI A;  1AD5 A;  2QTX A;  1W6X A;  2QEX A;  2RD1 A;  2MIO A;  1YBY A;  3FDR A;  4J8O A;  3GOX A;  4FW2 A;  5FU6 C;  2XD0 A;  4PK4 A;  1YHQ A;  2XDP A;  5HK0 A;  3TRE A;  1H92 A;  3CMA Q;  3QJ6 A;  1V76 A;  3M53 A;  3L2Q A;  4OB1 B;  4M77 D;  4C8Q G;  2M16 A;  1N8R C;  2DIG A;  2WAC A;  1C6V X;  1N8R R;  1EX4 A;  3HP9 A;  4X9D A;  1K9M U;  2HKN A;  2KRN A;  1X6O A;  1PSE A;  3JB9 F;  2X4W A;  5A0L A;  5KYY A;  4ZN3 A;  3CPW P;  3OMC A;  3X20 B;  2A37 A;  2CZ0 B;  4C5E A;  2V1R A;  1W4S A;  3CPW S;  5L8R E;  1HJD A;  3CCV Q;  5GAO q;  3E9F A;  3L2W A;  2XU8 A;  1Z9Z A;  2R5M A;  2EW3 A;  2ED1 A;  1OEB A;  1M2O A;  2EBP A;  1WNL A;  2COZ A;  2NUP B;  3H9N A;  2OTJ Q;  4Y28 E;  3OW2 P;  2FYK A;  4ANJ A;  3G7Z A;  2WSF E;  1M30 A;  1RAE B;  1GFD A;  3AHU A;  3P8B B;  3D7S B;  2RQU A;  3U23 A;  2DIL A;  4D8D A;  1N9R A;  4C92 C;  4TVR A;  3O5Z A;  2KK4 A;  2RQV A;  4GLK A;  1NPP A;  2E65 A;  4PLL A;  1X27 A;  3C4S A;  5GMK i;  1DJ7 B;  1RAH B;  4M77 A;  2XKO C;  3SWN C;  2CRE A;  1GBR A;  1G83 A;  2H3E B;  3HHT B;  2E5K A;  3CME Q; 
#chains in the Genus database with same CATH homology
 4MZP A;  4P5N A;  4OP0 A;  4M7D E;  3RIR A;  1WJR A;  1ZHI A;  2FVU A;  4M7D D;  1Q81 U;  5IN1 A;  2X35 A;  2DIQ A;  1QP2 A;  4EMK C;  4PJO G;  3CD6 A;  1B34 B;  1V29 B;  3CCR T;  3GLX A;  1YJN T;  4UC4 A;  4KUL A;  2CZ1 B;  3EFR A;  3MEA A;  2JOY A;  3FJP A;  5CKB A;  2E10 A;  3HRT A;  1QVG S;  4IKF A;  3GIB A;  2E64 A;  4F7U F;  4ATO A;  4M75 F;  3P8D A;  4EMG A;  2ZPI B;  4OMF B;  5GAM f;  5GAN g;  4E7J A;  3A8H B;  2CZ6 B;  5CCA A;  3C12 A;  2VC8 A;  2X4X A;  3CME T;  4QVD A;  4E7K A;  3V7C A;  3KUF A;  2X4Y A;  5KCH A;  5LJ3 g;  3CCJ A;  5J3B A;  3VUB A;  4M7A C;  4C92 B;  3HSB A;  3PMI A;  5GMK m;  3BW1 A;  4IUQ A;  3JCM f;  3ME9 A;  4A4E A;  4OB0 B;  3CXC A;  2XDB A;  4ZN1 A;  1VIE A;  2DXT A;  2LCL A;  3VV0 A;  5CKD A;  3LX7 A;  5LJ3 d;  5KE2 A;  4C8Q B;  3MEU A;  2K3X A;  1XQH A;  4JLG A;  2LC4 A;  4A4H A;  5I21 A;  4HCZ A;  3OYF A;  2PVG B;  2QA4 T;  3GF5 A;  4M7A F;  2EFI A;  5CR2 A;  1VQM T;  3M57 A;  1YIT A;  5FRM A;  3SWN B;  1VQ8 T;  4ZGE B;  3FC3 A;  1OZ2 A;  4FU6 A;  3KXT A;  3G4S A;  3CCM T;  4QVC A;  1K8A U;  1VQ7 T;  3SFM A;  4R55 A;  4OF1 A;  3I56 T;  3TEE A;  3JAM E;  2DTI A;  3OSS C;  1Y96 B;  1WPY A;  2JTF A;  2KDS A;  4FIB A;  2JNG A;  2FB7 A;  2Y90 A;  2RB6 A;  4CRI A;  3F70 A;  2HD0 A;  1W2B A;  2CGH A;  4M77 F;  1LJO A;  2QXF A;  5CO7 A;  4BUG A;  4C0G A;  3JB9 I;  5LJ3 e;  4ELZ C;  3E19 A;  4EMK B;  3BDL A;  3G6E A;  3FIF A;  1K8A C;  3L1A A;  4J6X A;  3CXC S;  2CKK A;  3ZEH A;  2EQM A;  2DTH A;  3NTI A;  4JUV A;  4ZGJ B;  3L2V A;  2OAU A;  5GMK j;  3CCE A;  4M7D G;  4XTY A;  1WJQ A;  4PL6 A;  5GAN h;  4HA8 A;  3MP8 A;  3JCM Q;  3TU4 K;  2ZZD A;  3CCQ T;  3CCU A;  3HL8 A;  1UGR B;  4M78 E;  3Q1J A;  1U1S A;  5LJ5 g;  4BI3 A;  1D3B B;  5LJ3 h;  4BB7 A;  4WF2 A;  1HK9 A;  2G3R A;  4M7A B;  3JCM J;  1N9S A;  3JRZ A;  3OYG A;  3CPF A;  4F7U G;  5GAN j;  1VQ5 T;  2KMT A;  3MEW A;  1WQW A;  2B8A A;  3RUX A;  5GAO m;  4RG8 A;  3SB2 A;  1UEB A;  2A7Y A;  3A8O B;  4BI4 A;  5LJ5 d;  4HKE A;  4HT9 A;  3GNF B;  2RI2 A;  4XTW A;  4II1 A;  1KHI A;  2MMP A;  2LCC A;  5I2S A;  1QW1 A;  2LRQ A;  3LGL A;  1W2B S;  2LQK A;  4MDW A;  2X4J A;  4BAC A;  1MHN A;  4E7I A;  1VQN T;  4M7D A;  1Q82 U;  4PJO C;  3S3O A;  2EAY A;  4BD3 A;  2RI3 A;  2DZC A;  2ZPE B;  1KQS S;  3HKS A;  4QQG A;  4A54 A;  5CKF A;  3OS2 A;  2LX9 A;  1VQ6 A;  1QVF A;  4IUR A;  2VV5 A;  3M56 A;  3CC2 T;  3CCS A;  4EMH A;  1BI3 A;  4C0F A;  2DAQ A;  3A8L B;  1VQL T;  2HNI A;  3OYY A;  3OYE A;  5A0G A;  1Q82 C;  2RJC A;  5I2M A;  2OTJ A;  5LJ5 e;  5IT9 E;  4FT4 A;  4JRI A;  3CCL T;  2BIV A;  2RK1 A;  3MEV A;  4BY6 C;  3L42 A;  4NS5 A;  3RMQ A;  1VQ4 T;  2K5L A;  3GPL A;  4DA4 A;  2QQS A;  1M90 U;  3ER0 A;  3EAE A;  5CKH A;  3JCM X;  4M77 G;  1VQP A;  4X34 A;  4XK8 E;  3QYG B;  1JRI A;  5LJ5 h;  3LWI A;  4RCC A;  2VXE A;  2YHT A;  4MDX A;  3HRU A;  3DLL A;  1Y7X A;  2VGM A;  3QDR B;  1YJ9 T;  3OBW A;  4C5I A;  4PNO A;  1BKB A;  2K3Y A;  1G3T A;  2I2L A;  1AHJ B;  3VU3 C;  3FB9 A;  2HBP A;  1VQO A;  1QVF S;  1G3W A;  3X28 B;  3C94 A;  2MI6 A;  1M90 C;  3N5B B;  1XOV A;  1G3Y A;  3OB9 A;  2VUB A;  3CCR A;  2RHI A;  4LD6 A;  5DLO A;  2EQK A;  2BKD N;  3BY7 A;  2P0P A;  3OS1 A;  1Y07 A;  1QP3 A;  1X01 A;  2ZPG B;  3V8L A;  2DD5 A;  4PJO B;  4XU3 A;  3OYN A;  1LNX A;  2H3J A;  3LLR A;  2O4X A;  2FL7 A;  4B9W A;  4M7D C;  3CME A;  2E41 A;  3VKI A;  4LDX A;  3R6O A;  1UGS B;  2GF7 A;  3OBY A;  2XI9 A;  2Y4X A;  4L59 A;  4HCB A;  3A8G B;  2L89 A;  3QSU A;  4VUB A;  3G71 T;  4HCC A;  3CBP A;  4M78 A;  1VQK T;  4M75 C;  4M7D F;  1H3Z A;  3KBG A;  4JS5 A;  2QA4 A;  4D6W A;  5KE3 A;  3TCJ A;  3L2Z A;  1VQM A;  4BY6 B;  1I4K 1;  1P92 A;  1O75 A;  5D6W A;  2E1H A;  3MCA B;  1KQ1 A;  2E6Z A;  2MWP A;  2XK0 A;  1K73 U;  4C92 E;  3CCM A;  4J7F A;  1VQ7 A;  3QKJ A;  3OMG A;  5GAO n;  3SDZ A;  3I56 A;  1BI1 A;  5GAN 5;  1SSF A;  1M1K U;  2K5F A;  4XTV A;  5D6X A;  1Q81 C;  2GCX A;  2V8I A;  3UDC A;  4XU2 A;  4DOV A;  4A4F A;  3MO8 A;  4OGC A;  3S3M A;  4N4G A;  5GAN d;  4E7H A;  5GMK l;  2OTL T;  2DKG A;  1K73 C;  3CC4 T;  3LWH A;  4LD9 K;  4NOY A;  2KQW A;  2O01 E;  1M1K C;  5CIU A;  4O5V A;  2LNV A;  5GAM j;  2WSC E;  2F69 A;  1IRE B;  3M59 A;  2EKO A;  4A4K A;  2RK2 A;  4KUI A;  3CCQ A;  5GMK e;  2EJG A;  4M7D B;  3V8K A;  3LGF A;  4RG2 A;  3INZ A;  1NE8 A;  5GAN 7;  1RI0 A;  3HFN A;  5J39 A;  1UB4 A;  1ZQ1 A;  4M77 C;  3CMA A;  3JB9 J;  4KUD K;  2PUK B;  4OB3 B;  3PTA A;  1VQ5 A;  1BYM A;  3QZ5 B;  5CK9 A;  3BDU A;  3X25 B;  4B9X A;  5GAN e;  2PVD B;  2RHZ A;  5FU7 C;  4C5H A;  2VXF A;  4F7U B;  2YLB A;  1M8V A;  4M75 B;  2QI2 A;  2HQE A;  5GMK h;  2LVM A;  4PLI A;  3UT1 A;  3J81 E;  4HT8 A;  1FX7 A;  1I8F A;  4XQ3 A;  2F5K A;  1VQN A;  2JN0 A;  3M5A A;  4JDS A;  3M58 A;  3HPW A;  3OYD A;  1KQS A;  3SD4 A;  4OB2 B;  3V7S A;  3V7R A;  2RHU A;  4C5G A;  4N4H A;  3CC2 A;  4NL2 A;  1VQL A;  2LT1 A;  2R57 A;  3QII A;  4M78 F;  4L5G A;  2ZCF B;  4M78 D;  3QBY A;  2VGN A;  2D0Q B;  1R8O B;  1FXX A;  4QQ6 A;  1YI2 A;  1TH7 A;  5HKC A;  1LOJ A;  1VQ4 A;  3FEO A;  3OYA A;  3DKM A;  1B34 A;  4MZM A;  3BFM A;  2QEX T;  2F5T X;  3CCV A;  4XTZ A;  3DLM A;  2YRV A;  3PNW C;  1I5L A;  2PVO B;  3I55 T;  3FRN A;  1MGQ A;  5CKE A;  4N0A A;  2DVE A;  2VYT A;  4PKC C;  5LJ3 f;  2PQW A;  1YJ9 A;  1S72 T;  2V8J A;  3CBO A;  2XID A;  3QJY A;  4M77 B;  1H64 1;  2O4X B;  3JCM W;  3ZBD A;  4QVZ A;  1YHQ T;  2RHY A;  3E9G A;  1N27 A;  5C0M A;  2XG8 D;  4C92 A;  4ELY C;  3LH0 A;  1X75 C;  3JCM b;  2WSE E;  3OY9 A;  4RKU E;  4Z02 A;  5FU7 B;  3QYH B;  5KCO A;  2XIC A;  2EJF A;  3L2R A;  1YIJ T;  2QQA A;  2DTO A;  5FRO A;  2DO3 A;  4IUV A;  2RJD A;  3S6W A;  3QZ9 B;  2QDY B;  3QXE B;  2GQV A;  3OA6 A;  2ZPB B;  2CS7 A;  2Y4Y A;  1M9S A;  2HQX A;  2YLC A;  3S3N A;  1KC8 U;  4PJO E;  2CYZ B;  4GY5 A;  4A4G A;  3G6E T;  3PIO A;  3OW2 A;  3PIP A;  4BDZ A;  3OYB A;  3CCE T;  3MP1 A;  1VQ9 T;  3WVE B;  3OYK A;  4FSX A;  3X26 B;  4JLI A;  3HFO A;  3G71 A;  1VQK A;  2EYQ A;  1VIF A;  4BI8 B;  1Q7Y U;  2KSS A;  1NPR A;  3A5Z B;  3H6Z A;  4J5Y A;  1U8R A;  1WGS A;  3OYI A;  2DD4 A;  1YCY A;  2CZ7 B;  2L5Q A;  5GAM g;  5GAO p;  1I81 A;  4EDU A;  4EMK A;  5GAN 6;  5DM7 R;  4DOW A;  4M78 G;  1YJN A;  2GFU A;  5FLX E;  3QUI A;  3VYG A;  2MAM A;  1KD1 U;  2ZGW A;  5GAM d;  2EJ9 A;  2MWO A;  2LTO A;  5LJ5 f;  2L3R A;  3OS0 A;  3QO3 A;  3JCM g;  1KG1 A;  1KQ2 A;  2QQR A;  4XAX B;  1Y71 A;  5C6S A;  1IZ6 A;  5LL6 S;  3M55 A;  4Q5W A;  4JRP A;  3PMT A;  1KD1 C;  2D9T A;  2R5A A;  4XU0 A;  3JCM d;  3OW2 S;  5CAI A;  4BDY A;  4L6V 5;  4MML A;  3OYJ A;  2P4T A;  3CC4 A;  3JCM V;  2DPP B;  4CI0 C;  2FHD A;  1XNI A;  2RHX A;  1YJW T;  3CCS T;  3GP8 A;  2E70 A;  2PUO B;  1ZBX A;  1QVP A;  3MHX A;  2R58 A;  4OGE A;  2NLU A;  3DB3 A;  3UPU A;  1UGP B;  5GAM e;  2L8D A;  1VQ8 A;  2DZ9 A;  5FRN A;  1OI1 A;  2RJF A;  3OSV A;  3RMS A;  4C92 F;  4C92 D;  3J80 E;  2XHC A;  2EWN A;  2ZPH B;  2V8K A;  4IUU A;  3MP6 A;  3JCM e;  4O6J A;  4C8Q E;  1Q86 U;  4NL3 A;  3JSC A;  4C8Q D;  1KC8 C;  1O9S A;  5GAM h;  3NTK A;  3CC7 T;  2QQ9 A;  2IG0 A;  4ME7 A;  2RM4 A;  4RMO A;  3WVD B;  1VQO T;  5D6Y A;  2E12 A;  1HXD A;  3OYH A;  3T9N A;  3JCM h;  4C0Z A;  1Q86 C;  2A3L A;  4MMK A;  2JUF A;  2QQB A;  2M0O A;  2DJZ A;  4F7U E;  4ZGD B;  4OVA A;  1G5V A;  4M75 E;  5HK3 A;  2EIF A;  4M75 D;  4JJN K;  4ZTJ A;  2RI5 A;  2RJE A;  3HRS A;  5AYF A;  3VUZ A;  5GAN 2;  3H8Z A;  3DB4 A;  1RL2 A;  2RO0 A;  3EFS A;  3LYI A;  2K4Y A;  2M1H A;  2QTX A;  4LDV A;  3RKW A;  4E47 A;  2RD1 A;  3OYM A;  4J7I A;  2QEX A;  4BE1 A;  1YBY A;  3PGG A;  3I55 A;  2PU9 B;  4PJO A;  4V2S A;  4M78 C;  3FDR A;  4J8O A;  3ASK A;  5CQY A;  1JB0 E;  3GOX A;  1S72 A;  4M7A E;  3URG A;  4N4I A;  2EQJ A;  5FU6 C;  2XD0 A;  4A53 A;  1NJI U;  4M7A D;  4J6Y A;  3CD6 T;  1YHQ A;  1M1G A;  1JJ2 A;  2XDP A;  5HK0 A;  3L2U A;  3TRE A;  1N8R U;  1BIA A;  3E1S A;  4EPC A;  5HY6 A;  3WXM B;  2XDD A;  4LDY A;  1YIJ A;  4C92 G;  2DK3 A;  5GAN 3;  1G3S A;  4XTX A;  3QJ6 A;  2LDM A;  1NJI C;  5GAO l;  3CCL A;  1VUB A;  3M53 A;  2KAF A;  3L2Q A;  3CCJ T;  4OB1 B;  5CVI A;  4M77 E;  3CPW A;  2AHJ B;  5DLQ E;  2K5I A;  4RCB A;  4M77 D;  4C8Q G;  2M16 A;  4DQ2 A;  5GAN f;  3JCM P;  1N8R C;  2DIG A;  2HAX A;  2WAC A;  3OS5 A;  1NZ9 A;  4MZT A;  3ZFJ A;  1OZ3 A;  4E7L A;  3JCM c;  3HP9 A;  1VQ9 A;  1N6A A;  1OYX A;  3PFS A;  5EG2 A;  4X9D A;  3OYC A;  1K9M U;  1M4Z A;  4IUT A;  1X6O A;  3M9Q A;  4Y91 A;  1BI2 A;  1YIT T;  1PSE A;  4QW2 A;  4YTL A;  4FT2 A;  3CMA T;  1JJ2 S;  5GAN 4;  3JB9 F;  2P0K A;  3G4S T;  2X4W A;  5A0L A;  2JZ2 A;  4JRQ A;  3JB9 D;  2KVQ G;  4ZN3 A;  3C95 A;  1BI0 A;  3OMC A;  4M75 G;  3X20 B;  1FWZ A;  4FL6 A;  4C8Q A;  1K9M C;  2CZ0 B;  4C5E A;  5LJ3 j;  4M78 B;  4LDU A;  4BE0 A;  1W4S A;  3CPW S;  5L8R E;  1WQ7 A;  5A2Q E;  5FU6 B;  3O8V A;  3OQ5 A;  3X24 B;  4XU1 A;  3SWN A;  4JS4 A;  5DY9 A;  3RER A;  3JB9 H;  2DXB A;  2E5Q A;  5J26 A;  2DEQ A;  3GNG A;  4C0D C;  5M9O A;  5GAO q;  2DXC A;  3E9F A;  4FM4 B;  1BIB A;  1KHC A;  3L2W A;  1WJS A;  1Y96 A;  3FLG A;  1UGQ B;  2XU8 A;  1YJW A;  4M7A G;  2R5M A;  4F7U A;  2K57 A;  2KY9 A;  3CCU T;  4PJO F;  5KH6 A;  4M75 A;  3V8J A;  3J7A F;  3A8M B;  4PJO D;  2D6F A;  1EIF A;  2LT4 A;  3M4G A;  4LDW A;  2P0Q A;  2IVW A;  3NTH A;  3M4Y A;  1WNL A;  4ZTF A;  1YI2 T;  4J83 A;  4Y28 E;  4X9C A;  3M54 A;  3CCV T;  5GAO r;  1PSF A;  2JVV A;  3CBM A;  4XTU A;  1Q7Y C;  5CQX A;  2K2V A;  2FYK A;  3PT9 A;  3G7Z A;  4N0A C;  2WSF E;  1D3B A;  3MET A;  3UWN A;  5A0D A;  4M7A A;  3CC7 A;  4J6W A;  4BE2 A;  3AHU A;  2M9U A;  1M5Q 1;  2GFA A;  2OTL A;  3P8B B;  1XTD A;  3VYH B;  2BUD A;  2LQ8 A;  2C06 A;  2E6N A;  1JBM A;  3RES A;  1N9R A;  5GAN 8;  3OYL A;  1VQ6 T;  4C92 C;  4TVR A;  5LJ5 j;  2KK4 A;  2JTM A;  2RA2 A;  3LW5 E;  3QPH A;  3CEY A;  4GLK A;  3QG1 A;  3RKX A;  3JB9 G;  1M1F A;  3P8H A;  1NPP A;  4QQD A;  1QVG A;  2OTJ T;  2RH2 A;  2DXU A;  4C8Q C;  2E65 A;  4PLL A;  5GMK i;  3C4S A;  3RKY A;  1DJ7 B;  4C0D B;  3QHS A;  4KBM B;  4M77 A;  1GXI E;  3VJP A;  5IAY A;  2XKO C;  2EQU A;  3SWN C;  2ZPF B;  3NFC A;  4KT0 E;  4JRK A;  1VQP T;  4IUP A;  3HHT B;  4C8Q F;  2MF2 A;  1U1T A;  4R56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...