2DB2A

Solution structure of the double-stranded rna binding domain in kiaa0890 protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
GSSGSSGASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0890 protein
publication title Solution structure of the double-stranded RNA binding domain in KIAA0890 protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 22
structure length 119
sequence length 119
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2db2A01
2CPNA 1FKAE 4DV0E 4NXME 1PKPA 4DR2E 2E5LE 2UUBE 2NUGA 2B7TA 1N32E 1RQ0A 1WHQA 2VQFE 3P1XA 4DV3E 4DR4E 4LF5E 3ADGA 1XMQE 2LTRA 4X8WA 4OX9E 2N3GA 4LF4E 1UHZA 4GKKE 1X48A 2UUCE 2L3JA 2NUFA 4JI3E 2VQEE 2YT4A 4YY3E 3ADLA 2JVAA 4DKKA 3T1YE 4B3TE 2UU9E 4M2ZA 1N36E 3LLHA 4LF6E 4JI0E 2EZ6A 1J26A 1T4NA 1WHNA 3VYXA 1IBKE 2L2NA 1DI2A 4YHHE 1O0WA 1J5EE 4GKJE 2B3TB 1XMOE 4AQYE 2HHHE 4LF9E 4X62E 1N34E 4DR6E 4X65E 4DR3E 4JYAE 2ZM6E 2LJHA 1STUA 2RS7A 1YYWA 4LFCE 3OTOE 4JI1E 1QU6A 2NUEA 4DR7E 4KHPE 2KHXA 4JV5E 4JI7E 4DR1E 1HR0E 4OOGC 1RC7A 4M30A 1IBLE 1GQEA 3HTXA 1N33E 1HNXE 2LUQA 5CFFE 1FJGE 2DB2A 2JY9A 4NXNE 4DV4E 1X49A 2F4VE 4K0KE 4LFAE 4DR5E 4B3ME 2UXDE 5IWAE 2DMYA 2B7VA 2LTSA 4DUYE 4X64E 4LF7E 2N3HA 4WFTA 1YYKA 2UXCE 1I94E 1YYOA 2LBSB 5LMUE 4JI4E 1EKZA 4DV7E 3J7Yp 1XNQE 4LF8E 1HNZE 3C4BA 1YZ9A 4JI6E 4DUZE 2UXBE 4JI2E 4X66E 3T1HE 2L2KB 2NA2A 2MDRA 4B3SE 1XNRE 1ZBTA 1HNWE 5LMNE 2IHR1 2RTXA 2LUPB 5BR8E 4LFBE 3VYYA 2DIXA 2L3CA 4DV6E 4DV2E 4B3RE 2L33A 1T4LB 3ADJA 4DV5E 2L2MA 1X47A 2RS6A 1IBME 2UUAE 4DV1E 4JI5E 4JI8E 2RSMA 3C4TA 4WYQB 2LRSA 1UILA 1T4OA 3ADIA
chains in the Genus database with same CATH superfamily
1FKAE 4M9VC 2G7HA 4NXME 1PJTA 4DR2E 4L8NA 2UUBE 2NUGA 3HPZA 4L5NC 2EPRA 2EJ4A 2FGGA 2EN2A 2EPPA 3ECRA 4HTGA 5KL6A 1T38A 4OX9E 1IQOA 1YUJA 1X48A 3J7AG 2L3JA 1IQSA 2GHFA 5DNYA 2E72A 4R2SA 4ZYGA 5KL2A 3JU0A 2VE7C 4MLVA 2YTNA 4WXCA 2WCC3 4JI0E 2EZ6A 3VYXA 2L2NA 2HGHA 1O0WA 2YTQA 4GKJE 1TN9A 2B3TB 1XMOE 5FLXC 2EMXA 4X62E 4X65E 4DR3E 5KL3A 5A6BD 4HEIA 4R2RA 1YUIA 5KL7A 3KZZA 2BB8A 4BHCA 2ENAA 3J80C 2NUEA 4O5GA 2JXPA 4DR7E 2YTDA 5IXMB 2EL4A 3EPHA 2ODRC 2JOXA 2WBTA 4JI7E 3H09A 2EOFA 4M30A 1IBLE 1GQEA 1Z1BA 2PRTA 5CFFE 2LO3A 1X6FA 2EOJA 2I9IA 3LMLA 4WPYA 1X49A 2YPNA 4MLQA 4LFAE 1ZR9A 3VK6A 2UXDE 2EPNA 5IWAE 2M4IA 3F6GA 2B7VA 4R2PA 3DF6A 2N3HA 1X5WA 5TSEA 2LBSB 3IWBA 1YZ9A 2JOBA 3TQMA 1HNZE 3C4BA 4ZYDA 2UXBE 1GZ6A 2HC5A 2V85A 2L2KB 2MDRA 1XNRE 1ZBTA 3UK3C 3BF2A 1HNWE 1B69A 2RTXA 1YSAC 4BMJA 4F6MA 1X6EA 4KZSA 2L33A 2MKNA 3ADIA 1GTKA 1T4LB 1SR9A 1JK2A 2EOQA 2I13A 2M7QA 2YRHA 2L8TA 2EPZA 2R76A 4JI5E 2YTIA 1UILA 2EE8A 2EM9A 4DV0E 1QNTA 2EM7A 1PKPA 2E5LE 2EPUA 2EM2A 5IT9C 1WHQA 2WZOA 2M9AA 4KWYA 3P1XA 4O4KA 2EPLX 1XMQE 2EMZA 4LF4E 2EPAA 2NUFA 2LE2A 4X9JA 4R2CA 2JPAA 1DGCA 3MHSC 3ADLA 3T1YE 3LLHA 4LF6E 4GZNC 1J26A 2EMLA 2V88A 2JWOA 2LMZA 1BB8A 1WHNA 3THOB 1DI2A 2GPIA 4BC7A 4DR6E 4AQYE 1N34E 2JP9A 5AASA 2EPCA 5A6JA 2EOOA 1L4SA 2ZM6E 2D9HA 2DSYA 2LJHA 2GLIA 4LFCE 2KOUA 4JI1E 1QU6A 4RH8A 4F9BB 1AH5A 3C6KA 2KHXA 3HQ1A 2V86A 5AE1A 2YU8A 2MKDA 3EPLA 5AC4A 2YRMA 2WBUA 1N33E 4WXDA 4F2JC 1A1KA 2DB2A 1KYQA 5T6JA 3AUZA 3RMPA 4F6NA 2J7JA 2YWQA 2DLQA 4BC9A 4NZVA 3HXLA 4DUYE 4LF7E 2DMIA 4WFTA 2EOYA 4DV7E 4BHBA 1YPNA 2EMIA 4BS9A 3THNA 3KWRA 4B3SE 3ZOQB 4BCAA 4R03A 1A1GA 2DRPA 2R1FA 1PDAA 2JYAA 3ADJA 4DV5E 2RS6A 3C6MA 1IBME 1MEYC 4ZYEA 2UUAE 4F9AB 2EMCA 1KJKA 4WYQB 2EQ0A 5A69A 2CPNA 2EPKX 3IWCA 2VRDA 2EMFA 2B7TA 1N32E 1A1LA 3MHHC 3BGHA 1BBOA 5A2QC 2VQFE 4DV3E 2WBSA 2LTRA 2M1SA 2N3GA 2CT1A 4Q35B 2EM4A 2EM6A 2EN3A 2UUCE 1A1FA 2KONA 2NABA 2ENHA 2YT4A 4YY3E 2JR1A 3AV0A 4B3TE 4M2ZA 1N36E 2LV2A 5AC5A 2ELYA 1UN6B 2YTPA 2ELZA 1IBKE 4YHHE 1YFHA 1J5EE 2EOEA 4LU9A 2HHHE 2EPOA 2EMWA 4R8OA 4JYAE 1DQ3A 1STUA 2RS7A 2YTEA 3OTOE 2EL6A 2CSHA 1IMUA 4R2QA 4FK5C 4P7DA 4O24A 2EMAA 4OOGC 2YZTA 2LCEA 2V8QB 3HTXA 2F8BA 1HNXE 2LUQA 1FJGE 2JY9A 4NXNE 2YSOA 3JTZA 1F2IG 4DV4E 4B3ME 2K4VA 2DMYA 2YRKA 2LTSA 4X64E 1G2DC 3OMLA 1YYKA 2UXCE 1EH6A 4RHBB 1YYOA 5LMUE 2EOZA 3MSWA 1EKZA 1XNQE 2RQLA 2EN6A 4DUZE 4JI2E 2VF1A 4GEQB 2NA2A 5KL5A 2EWLA 3M99B 2EOIA 4O43A 2IHR1 2FV4B 5BR8E 2EMKA 1JK1A 2YTGA 2DIXA 3K6QA 2L3CA 4DV2E 4DV6E 4B3RE 1RMDA 5A6AA 2YTOA 4TUGA 2EN7A 2L92A 5AE3A 1X47A 4J8ZA 2EN1A 4R2DA 2EOXA 4DV1E 1ZAAC 1BBGA 2RSMA 3F6HA 3T1HE 4ZYHA 2E1MA 5F3WA 2EPXA 4DMIA 2EP3A 3BBGA 1PJQA 4Q28A 1RQ0A 2ADRA 3KZYA 4NHRA 2RPCA 4DR4E 4LF5E 3ADGA 4X8WA 1UHZA 4GKKE 2CTDA 4WSPA 4JI3E 2VQEE 4R2EA 1P47A 5IV8B 1UBDC 3JAMC 4I8OA 2EMYA 2JVAA 2V87A 4DKKA 2EN4A 2UU9E 5LL6R 4N4RB 1T39A 1PJSA 1X6HA 2EMHA 1EH7A 2ODRD 2K7IA 1T4NA 5A6KA 4WX9A 1NEIA 2ENCA 2EMGA 4LF9E 4P78A 2N8XA 1ZBQA 2EM3A 2EORA 4M0VA 3EPKA 1YYWA 5AE2A 3L00A 1SFEA 2MC5A 3DJWA 2V83A 4KHPE 1AAYA 4JV5E 2HJJA 4DR1E 1HR0E 1LLMC 4TUIA 5ADZA 1RC7A 2RSIA 2BBGA 2YSPA 2EPMX 1MGTA 2F4VE 2L6MA 4R2AA 1ZU1A 2FTXB 4K0KE 1N3GA 1A1JA 4BBYA 2EL5A 4DR5E 3VHTB 5KL4A 1WRJA 4IS1C 2EMBA 2EN8A 3EQ1A 2YTFA 1NCSA 2LJUA 2B9DA 2EM5A 1I94E 1A1IA 3IWDA 4JI4E 2EQ1A 2YTJA 4LTYA 3J7Yp 3J81C 1A1HA 4LF8E 4JI6E 1G2FC 4X66E 1EH8A 3EPJA 2MC6A 2EOSA 5LMNE 2LUPB 1X3CA 2EM0A 2EM8A 4LFBE 2EQ3A 3FIGA 3VYYA 2DGCA 2EOHA 2H36X 5LLQA 1WXRA 2L2MA 2A25A 2LT7A 2EOMA 1TF6A 2DLKA 1WJPA 2YU5A 3QG5C 2Q8UA 3BIDA 1TF3A 2V89A 4IJDA 2LVHA 4F9CB 4F54A 4JI8E 3HPSA 3C4TA 5A6BA 2LRSA 4WSGA 1T4OA 2MDGA
chains in the Genus database with same CATH topology
2CPNA 3F6HA 1FKAE 2G7HA 4DMIA 4DV0E 4NXME 3IWCA 1PKPA 4DR2E 4L8NA 2E5LE 2UUBE 2NUGA 2B7TA 3HPZA 1N32E 4Q28A 5IT9C 1RQ0A 1WHQA 2WZOA 4L5NC 5A2QC 2FGGA 2VQFE 3P1XA 4DV3E 4DR4E 4LF5E 3ADGA 1XMQE 2LTRA 4X8WA 2M1SA 4OX9E 2N3GA 4LF4E 1UHZA 4GKKE 1X48A 4WSPA 2UUCE 2L3JA 2NUFA 2LE2A 3J7AG 4JI3E 2VQEE 2E1MA 2KONA 5DNYA 2YT4A 3JAMC 4YY3E 4I8OA 5F3WA 3ADLA 2JVAA 2V87A 4DKKA 3JU0A 3T1YE 2JR1A 3AV0A 2UU9E 4B3TE 2VE7C 4M2ZA 5LL6R 1N36E 3LLHA 4LF6E 4JI0E 2EZ6A 1J26A 2V88A 3C4TA 2LMZA 2ODRD 1T4NA 1WHNA 3VYXA 1IBKE 2L2NA 1DI2A 4YHHE 1O0WA 1J5EE 4GKJE 4BC7A 2B3TB 4LU9A 1XMOE 4AQYE 2HHHE 5FLXC 4X62E 1N34E 4P78A 4LF9E 4DR6E 5AASA 4X65E 4DR3E 1ZBQA 4M0VA 4R8OA 4JYAE 2ZM6E 1DQ3A 2DSYA 1STUA 2LJHA 2RS7A 1YYWA 4LFCE 3OTOE 2KOUA 4JI1E 1QU6A 5AE2A 3J80C 2NUEA 2MC5A 3DJWA 2V83A 4F9BB 4KHPE 4DR7E 2ODRC 2JOXA 2KHXA 4JV5E 4P7DA 3HQ1A 4JI7E 4DR1E 1HR0E 2V86A 5AE1A 4TUIA 3H09A 4OOGC 5ADZA 2YZTA 2V8QB 4M30A 1RC7A 1GQEA 1IBLE 3HTXA 1N33E 2F8BA 1HNXE 2LUQA 5CFFE 1FJGE 2DB2A 2JY9A 4NXNE 3JTZA 4WPYA 3LMLA 4DV4E 1X49A 2F4VE 5T6JA 2L6MA 2FTXB 3AUZA 3RMPA 4LFAE 4K0KE 4BBYA 3VK6A 4DR5E 4B3ME 2UXDE 2K4VA 2M4IA 5IWAE 2DMYA 4BC9A 3F6GA 2B7VA 2LTSA 3HXLA 4DUYE 3DF6A 4X64E 4LF7E 2B9DA 2N3HA 3OMLA 4WFTA 1YYKA 1I94E 1YYOA 3IWDA 2LBSB 5LMUE 2UXCE 4JI4E 3MSWA 1EKZA 3IWBA 4DV7E 4LTYA 2JOBA 3J81C 3J7Yp 3C4BA 1HNZE 4LF8E 1XNQE 1YZ9A 4JI6E 4DUZE 1GZ6A 4JI2E 2UXBE 2VF1A 4BS9A 2V85A 4X66E 3T1HE 2L2KB 4GEQB 2NA2A 3KWRA 2MDRA 4B3SE 2EWLA 1ZBTA 2MC6A 3ZOQB 5LMNE 1XNRE 1HNWE 2IHR1 2RTXA 2FV4B 4BCAA 2LUPB 5BR8E 4BMJA 4R03A 4LFBE 3FIGA 2DIXA 3K6QA 4KZSA 2L3CA 3VYYA 4DV2E 4DV6E 2L33A 4B3RE 1T4LB 2H36X 4TUGA 3ADJA 4DV5E 1SR9A 2L2MA 1WXRA 2L92A 5AE3A 1X47A 2RS6A 1IBME 4J8ZA 2M7QA 2UUAE 2L8TA 4DV1E 2V89A 4F9AB 4F9CB 4F54A 4JI5E 4JI8E 2RSMA 2JWOA 3HPSA 4WYQB 2LRSA 1UILA 1T4OA 3ADIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPN A;  1FKA E;  4DV0 E;  4NXM E;  1PKP A;  4DR2 E;  2E5L E;  2UUB E;  2NUG A;  2B7T A;  1N32 E;  1RQ0 A;  1WHQ A;  2VQF E;  3P1X A;  4DV3 E;  4DR4 E;  4LF5 E;  3ADG A;  1XMQ E;  2LTR A;  4X8W A;  4OX9 E;  2N3G A;  4LF4 E;  1UHZ A;  4GKK E;  1X48 A;  2UUC E;  2L3J A;  2NUF A;  4JI3 E;  2VQE E;  2YT4 A;  4YY3 E;  3ADL A;  2JVA A;  4DKK A;  3T1Y E;  4B3T E;  2UU9 E;  4M2Z A;  1N36 E;  3LLH A;  4LF6 E;  4JI0 E;  2EZ6 A;  1J26 A;  1T4N A;  1WHN A;  3VYX A;  1IBK E;  2L2N A;  1DI2 A;  4YHH E;  1O0W A;  1J5E E;  4GKJ E;  2B3T B;  1XMO E;  4AQY E;  2HHH E;  4LF9 E;  4X62 E;  1N34 E;  4DR6 E;  4X65 E;  4DR3 E;  4JYA E;  2ZM6 E;  2LJH A;  1STU A;  2RS7 A;  1YYW A;  4LFC E;  3OTO E;  4JI1 E;  1QU6 A;  2NUE A;  4DR7 E;  4KHP E;  2KHX A;  4JV5 E;  4JI7 E;  4DR1 E;  1HR0 E;  4OOG C;  1RC7 A;  4M30 A;  1IBL E;  1GQE A;  3HTX A;  1N33 E;  1HNX E;  2LUQ A;  5CFF E;  1FJG E;  2DB2 A;  2JY9 A;  4NXN E;  4DV4 E;  1X49 A;  2F4V E;  4K0K E;  4LFA E;  4DR5 E;  4B3M E;  2UXD E;  5IWA E;  2DMY A;  2B7V A;  2LTS A;  4DUY E;  4X64 E;  4LF7 E;  2N3H A;  4WFT A;  1YYK A;  2UXC E;  1I94 E;  1YYO A;  2LBS B;  5LMU E;  4JI4 E;  1EKZ A;  4DV7 E;  3J7Y p;  1XNQ E;  4LF8 E;  1HNZ E;  3C4B A;  1YZ9 A;  4JI6 E;  4DUZ E;  2UXB E;  4JI2 E;  4X66 E;  3T1H E;  2L2K B;  2NA2 A;  2MDR A;  4B3S E;  1XNR E;  1ZBT A;  1HNW E;  5LMN E;  2IHR 1;  2RTX A;  2LUP B;  5BR8 E;  4LFB E;  3VYY A;  2DIX A;  2L3C A;  4DV6 E;  4DV2 E;  4B3R E;  2L33 A;  1T4L B;  3ADJ A;  4DV5 E;  2L2M A;  1X47 A;  2RS6 A;  1IBM E;  2UUA E;  4DV1 E;  4JI5 E;  4JI8 E;  2RSM A;  3C4T A;  4WYQ B;  2LRS A;  1UIL A;  1T4O A;  3ADI A; 
#chains in the Genus database with same CATH topology
 1FKA E;  4M9V C;  2G7H A;  4NXM E;  1PJT A;  4DR2 E;  4L8N A;  2UUB E;  2NUG A;  3HPZ A;  4L5N C;  2EPR A;  2EJ4 A;  2FGG A;  2EN2 A;  2EPP A;  3ECR A;  4HTG A;  5KL6 A;  1T38 A;  4OX9 E;  1IQO A;  1YUJ A;  1X48 A;  3J7A G;  2L3J A;  1IQS A;  2GHF A;  5DNY A;  2E72 A;  4R2S A;  4ZYG A;  5KL2 A;  3JU0 A;  2VE7 C;  4MLV A;  2YTN A;  4WXC A;  2WCC 3;  4JI0 E;  2EZ6 A;  3VYX A;  2L2N A;  2HGH A;  1O0W A;  2YTQ A;  4GKJ E;  1TN9 A;  2B3T B;  1XMO E;  5FLX C;  2EMX A;  4X62 E;  4X65 E;  4DR3 E;  5KL3 A;  5A6B D;  4HEI A;  4R2R A;  1YUI A;  5KL7 A;  3KZZ A;  2BB8 A;  4BHC A;  2ENA A;  3J80 C;  2NUE A;  4O5G A;  2JXP A;  4DR7 E;  2YTD A;  5IXM B;  2EL4 A;  3EPH A;  2ODR C;  2JOX A;  2WBT A;  4JI7 E;  3H09 A;  2EOF A;  4M30 A;  1IBL E;  1GQE A;  1Z1B A;  2PRT A;  5CFF E;  2LO3 A;  1X6F A;  2EOJ A;  2I9I A;  3LML A;  4WPY A;  1X49 A;  2YPN A;  4MLQ A;  4LFA E;  1ZR9 A;  3VK6 A;  2UXD E;  2EPN A;  5IWA E;  2M4I A;  3F6G A;  2B7V A;  4R2P A;  3DF6 A;  2N3H A;  1X5W A;  5TSE A;  2LBS B;  3IWB A;  1YZ9 A;  2JOB A;  3TQM A;  1HNZ E;  3C4B A;  4ZYD A;  2UXB E;  1GZ6 A;  2HC5 A;  2V85 A;  2L2K B;  2MDR A;  1XNR E;  1ZBT A;  3UK3 C;  3BF2 A;  1HNW E;  1B69 A;  2RTX A;  1YSA C;  4BMJ A;  4F6M A;  1X6E A;  4KZS A;  2L33 A;  2MKN A;  3ADI A;  1GTK A;  1T4L B;  1SR9 A;  1JK2 A;  2EOQ A;  2I13 A;  2M7Q A;  2YRH A;  2L8T A;  2EPZ A;  2R76 A;  4JI5 E;  2YTI A;  1UIL A;  2EE8 A;  2EM9 A;  4DV0 E;  1QNT A;  2EM7 A;  1PKP A;  2E5L E;  2EPU A;  2EM2 A;  5IT9 C;  1WHQ A;  2WZO A;  2M9A A;  4KWY A;  3P1X A;  4O4K A;  2EPL X;  1XMQ E;  2EMZ A;  4LF4 E;  2EPA A;  2NUF A;  2LE2 A;  4X9J A;  4R2C A;  2JPA A;  1DGC A;  3MHS C;  3ADL A;  3T1Y E;  3LLH A;  4LF6 E;  4GZN C;  1J26 A;  2EML A;  2V88 A;  2JWO A;  2LMZ A;  1BB8 A;  1WHN A;  3THO B;  1DI2 A;  2GPI A;  4BC7 A;  4DR6 E;  4AQY E;  1N34 E;  2JP9 A;  5AAS A;  2EPC A;  5A6J A;  2EOO A;  1L4S A;  2ZM6 E;  2D9H A;  2DSY A;  2LJH A;  2GLI A;  4LFC E;  2KOU A;  4JI1 E;  1QU6 A;  4RH8 A;  4F9B B;  1AH5 A;  3C6K A;  2KHX A;  3HQ1 A;  2V86 A;  5AE1 A;  2YU8 A;  2MKD A;  3EPL A;  5AC4 A;  2YRM A;  2WBU A;  1N33 E;  4WXD A;  4F2J C;  1A1K A;  2DB2 A;  1KYQ A;  5T6J A;  3AUZ A;  3RMP A;  4F6N A;  2J7J A;  2YWQ A;  2DLQ A;  4BC9 A;  4NZV A;  3HXL A;  4DUY E;  4LF7 E;  2DMI A;  4WFT A;  2EOY A;  4DV7 E;  4BHB A;  1YPN A;  2EMI A;  4BS9 A;  3THN A;  3KWR A;  4B3S E;  3ZOQ B;  4BCA A;  4R03 A;  1A1G A;  2DRP A;  2R1F A;  1PDA A;  2JYA A;  3ADJ A;  4DV5 E;  2RS6 A;  3C6M A;  1IBM E;  1MEY C;  4ZYE A;  2UUA E;  4F9A B;  2EMC A;  1KJK A;  4WYQ B;  2EQ0 A;  5A69 A;  2CPN A;  2EPK X;  3IWC A;  2VRD A;  2EMF A;  2B7T A;  1N32 E;  1A1L A;  3MHH C;  3BGH A;  1BBO A;  5A2Q C;  2VQF E;  4DV3 E;  2WBS A;  2LTR A;  2M1S A;  2N3G A;  2CT1 A;  4Q35 B;  2EM4 A;  2EM6 A;  2EN3 A;  2UUC E;  1A1F A;  2KON A;  2NAB A;  2ENH A;  2YT4 A;  4YY3 E;  2JR1 A;  3AV0 A;  4B3T E;  4M2Z A;  1N36 E;  2LV2 A;  5AC5 A;  2ELY A;  1UN6 B;  2YTP A;  2ELZ A;  1IBK E;  4YHH E;  1YFH A;  1J5E E;  2EOE A;  4LU9 A;  2HHH E;  2EPO A;  2EMW A;  4R8O A;  4JYA E;  1DQ3 A;  1STU A;  2RS7 A;  2YTE A;  3OTO E;  2EL6 A;  2CSH A;  1IMU A;  4R2Q A;  4FK5 C;  4P7D A;  4O24 A;  2EMA A;  4OOG C;  2YZT A;  2LCE A;  2V8Q B;  3HTX A;  2F8B A;  1HNX E;  2LUQ A;  1FJG E;  2JY9 A;  4NXN E;  2YSO A;  3JTZ A;  1F2I G;  4DV4 E;  4B3M E;  2K4V A;  2DMY A;  2YRK A;  2LTS A;  4X64 E;  1G2D C;  3OML A;  1YYK A;  2UXC E;  1EH6 A;  4RHB B;  1YYO A;  5LMU E;  2EOZ A;  3MSW A;  1EKZ A;  1XNQ E;  2RQL A;  2EN6 A;  4DUZ E;  4JI2 E;  2VF1 A;  4GEQ B;  2NA2 A;  5KL5 A;  2EWL A;  3M99 B;  2EOI A;  4O43 A;  2IHR 1;  2FV4 B;  5BR8 E;  2EMK A;  1JK1 A;  2YTG A;  2DIX A;  3K6Q A;  2L3C A;  4DV2 E;  4DV6 E;  4B3R E;  1RMD A;  5A6A A;  2YTO A;  4TUG A;  2EN7 A;  2L92 A;  5AE3 A;  1X47 A;  4J8Z A;  2EN1 A;  4R2D A;  2EOX A;  4DV1 E;  1ZAA C;  1BBG A;  2RSM A;  3F6H A;  3T1H E;  4ZYH A;  2E1M A;  5F3W A;  2EPX A;  4DMI A;  2EP3 A;  3BBG A;  1PJQ A;  4Q28 A;  1RQ0 A;  2ADR A;  3KZY A;  4NHR A;  2RPC A;  4DR4 E;  4LF5 E;  3ADG A;  4X8W A;  1UHZ A;  4GKK E;  2CTD A;  4WSP A;  4JI3 E;  2VQE E;  4R2E A;  1P47 A;  5IV8 B;  1UBD C;  3JAM C;  4I8O A;  2EMY A;  2JVA A;  2V87 A;  4DKK A;  2EN4 A;  2UU9 E;  5LL6 R;  4N4R B;  1T39 A;  1PJS A;  1X6H A;  2EMH A;  1EH7 A;  2ODR D;  2K7I A;  1T4N A;  5A6K A;  4WX9 A;  1NEI A;  2ENC A;  2EMG A;  4LF9 E;  4P78 A;  2N8X A;  1ZBQ A;  2EM3 A;  2EOR A;  4M0V A;  3EPK A;  1YYW A;  5AE2 A;  3L00 A;  1SFE A;  2MC5 A;  3DJW A;  2V83 A;  4KHP E;  1AAY A;  4JV5 E;  2HJJ A;  4DR1 E;  1HR0 E;  1LLM C;  4TUI A;  5ADZ A;  1RC7 A;  2RSI A;  2BBG A;  2YSP A;  2EPM X;  1MGT A;  2F4V E;  2L6M A;  4R2A A;  1ZU1 A;  2FTX B;  4K0K E;  1N3G A;  1A1J A;  4BBY A;  2EL5 A;  4DR5 E;  3VHT B;  5KL4 A;  1WRJ A;  4IS1 C;  2EMB A;  2EN8 A;  3EQ1 A;  2YTF A;  1NCS A;  2LJU A;  2B9D A;  2EM5 A;  1I94 E;  1A1I A;  3IWD A;  4JI4 E;  2EQ1 A;  2YTJ A;  4LTY A;  3J7Y p;  3J81 C;  1A1H A;  4LF8 E;  4JI6 E;  1G2F C;  4X66 E;  1EH8 A;  3EPJ A;  2MC6 A;  2EOS A;  5LMN E;  2LUP B;  1X3C A;  2EM0 A;  2EM8 A;  4LFB E;  2EQ3 A;  3FIG A;  3VYY A;  2DGC A;  2EOH A;  2H36 X;  5LLQ A;  1WXR A;  2L2M A;  2A25 A;  2LT7 A;  2EOM A;  1TF6 A;  2DLK A;  1WJP A;  2YU5 A;  3QG5 C;  2Q8U A;  3BID A;  1TF3 A;  2V89 A;  4IJD A;  2LVH A;  4F9C B;  4F54 A;  4JI8 E;  3HPS A;  3C4T A;  5A6B A;  2LRS A;  4WSG A;  1T4O A;  2MDG A; 
#chains in the Genus database with same CATH homology
 2CPN A;  3F6H A;  1FKA E;  2G7H A;  4DMI A;  4DV0 E;  4NXM E;  3IWC A;  1PKP A;  4DR2 E;  4L8N A;  2E5L E;  2UUB E;  2NUG A;  2B7T A;  3HPZ A;  1N32 E;  4Q28 A;  5IT9 C;  1RQ0 A;  1WHQ A;  2WZO A;  4L5N C;  5A2Q C;  2FGG A;  2VQF E;  3P1X A;  4DV3 E;  4DR4 E;  4LF5 E;  3ADG A;  1XMQ E;  2LTR A;  4X8W A;  2M1S A;  4OX9 E;  2N3G A;  4LF4 E;  1UHZ A;  4GKK E;  1X48 A;  4WSP A;  2UUC E;  2L3J A;  2NUF A;  2LE2 A;  3J7A G;  4JI3 E;  2VQE E;  2E1M A;  2KON A;  5DNY A;  2YT4 A;  3JAM C;  4YY3 E;  4I8O A;  5F3W A;  3ADL A;  2JVA A;  2V87 A;  4DKK A;  3JU0 A;  3T1Y E;  2JR1 A;  3AV0 A;  2UU9 E;  4B3T E;  2VE7 C;  4M2Z A;  5LL6 R;  1N36 E;  3LLH A;  4LF6 E;  4JI0 E;  2EZ6 A;  1J26 A;  2V88 A;  3C4T A;  2LMZ A;  2ODR D;  1T4N A;  1WHN A;  3VYX A;  1IBK E;  2L2N A;  1DI2 A;  4YHH E;  1O0W A;  1J5E E;  4GKJ E;  4BC7 A;  2B3T B;  4LU9 A;  1XMO E;  4AQY E;  2HHH E;  5FLX C;  4X62 E;  1N34 E;  4P78 A;  4LF9 E;  4DR6 E;  5AAS A;  4X65 E;  4DR3 E;  1ZBQ A;  4M0V A;  4R8O A;  4JYA E;  2ZM6 E;  1DQ3 A;  2DSY A;  1STU A;  2LJH A;  2RS7 A;  1YYW A;  4LFC E;  3OTO E;  2KOU A;  4JI1 E;  1QU6 A;  5AE2 A;  3J80 C;  2NUE A;  2MC5 A;  3DJW A;  2V83 A;  4F9B B;  4KHP E;  4DR7 E;  2ODR C;  2JOX A;  2KHX A;  4JV5 E;  4P7D A;  3HQ1 A;  4JI7 E;  4DR1 E;  1HR0 E;  2V86 A;  5AE1 A;  4TUI A;  3H09 A;  4OOG C;  5ADZ A;  2YZT A;  2V8Q B;  4M30 A;  1RC7 A;  1GQE A;  1IBL E;  3HTX A;  1N33 E;  2F8B A;  1HNX E;  2LUQ A;  5CFF E;  1FJG E;  2DB2 A;  2JY9 A;  4NXN E;  3JTZ A;  4WPY A;  3LML A;  4DV4 E;  1X49 A;  2F4V E;  5T6J A;  2L6M A;  2FTX B;  3AUZ A;  3RMP A;  4LFA E;  4K0K E;  4BBY A;  3VK6 A;  4DR5 E;  4B3M E;  2UXD E;  2K4V A;  2M4I A;  5IWA E;  2DMY A;  4BC9 A;  3F6G A;  2B7V A;  2LTS A;  3HXL A;  4DUY E;  3DF6 A;  4X64 E;  4LF7 E;  2B9D A;  2N3H A;  3OML A;  4WFT A;  1YYK A;  1I94 E;  1YYO A;  3IWD A;  2LBS B;  5LMU E;  2UXC E;  4JI4 E;  3MSW A;  1EKZ A;  3IWB A;  4DV7 E;  4LTY A;  2JOB A;  3J81 C;  3J7Y p;  3C4B A;  1HNZ E;  4LF8 E;  1XNQ E;  1YZ9 A;  4JI6 E;  4DUZ E;  1GZ6 A;  4JI2 E;  2UXB E;  2VF1 A;  4BS9 A;  2V85 A;  4X66 E;  3T1H E;  2L2K B;  4GEQ B;  2NA2 A;  3KWR A;  2MDR A;  4B3S E;  2EWL A;  1ZBT A;  2MC6 A;  3ZOQ B;  5LMN E;  1XNR E;  1HNW E;  2IHR 1;  2RTX A;  2FV4 B;  4BCA A;  2LUP B;  5BR8 E;  4BMJ A;  4R03 A;  4LFB E;  3FIG A;  2DIX A;  3K6Q A;  4KZS A;  2L3C A;  3VYY A;  4DV2 E;  4DV6 E;  2L33 A;  4B3R E;  1T4L B;  2H36 X;  4TUG A;  3ADJ A;  4DV5 E;  1SR9 A;  2L2M A;  1WXR A;  2L92 A;  5AE3 A;  1X47 A;  2RS6 A;  1IBM E;  4J8Z A;  2M7Q A;  2UUA E;  2L8T A;  4DV1 E;  2V89 A;  4F9A B;  4F9C B;  4F54 A;  4JI5 E;  4JI8 E;  2RSM A;  2JWO A;  3HPS A;  4WYQ B;  2LRS A;  1UIL A;  1T4O A;  3ADI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...