2DB2A

Solution structure of the double-stranded rna binding domain in kiaa0890 protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
GSSGSSGASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0890 protein
publication title Solution structure of the double-stranded RNA binding domain in KIAA0890 protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 22
structure length 119
sequence length 119
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2005-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2db2A01
4AQYE 2UXCE 4DR1E 3T1YE 2UU9E 1RQ0A 4JI2E 2L33A 4DR7E 1YYWA 4WYQB 4LFBE 4B3RE 4DR2E 4LF5E 4JYAE 1YYKA 4KHPE 2YT4A 2RTXA 4M30A 2DIXA 1X48A 4DV4E 1HNWE 2N3HA 4X64E 2RSMA 2L3CA 1YYOA 2NUEA 4DKKA 5CFFE 4X65E 1EKZA 4OX9E 4LF8E 3C4TA 2UUAE 3ADLA 1ZBTA 2B7VA 3ADIA 4DV7E 4JI1E 2KHXA 5BR8E 3LLHA 2JY9A 4DV5E 1IBKE 1RC7A 4DR4E 4B3TE 2NUGA 2L2NA 4DUZE 4DUYE 3J7Yp 1T4NA 1N36E 2LBSB 2VQEE 1O0WA 2MDRA 4LF9E 2N3GA 1GQEA 5LMNE 2LRSA 2DMYA 4JI7E 2E5LE 1J26A 2L3JA 4JI3E 2L2MA 3P1XA 1N33E 4K0KE 1X47A 2B7TA 4X66E 2LUPB 2CPNA 4JI8E 1DI2A 4JI4E 2ZM6E 2VQFE 4X8WA 4NXNE 4GKKE 2LJHA 1T4LB 3ADJA 2IHR1 4JV5E 4LF6E 1UHZA 4X62E 5LMUE 2LUQA 4B3SE 4DV6E 4DR5E 1IBLE 1UILA 2LTRA 2B3TB 5IWAE 2LTSA 1X49A 4GKJE 2EZ6A 1YZ9A 3VYXA 3HTXA 4WFTA 4JI6E 1N32E 2RS6A 3OTOE 2L2KB 2NUFA 2UXDE 4DR3E 4DV0E 1IBME 4YHHE 2HHHE 4JI0E 1I94E 1HR0E 1HNXE 1J5EE 1N34E 4DV3E 1PKPA 4YY3E 1XMQE 1XNQE 1WHQA 3VYYA 1XMOE 4B3ME 1STUA 4OOGC 2NA2A 1FJGE 2UUBE 4LFCE 1WHNA 2F4VE 2UXBE 1HNZE 4LF4E 4M2ZA 2UUCE 2JVAA 4DV2E 3ADGA 1T4OA 4DV1E 4LFAE 3C4BA 4DR6E 1FKAE 2RS7A 4JI5E 3T1HE 2DB2A 4LF7E 1QU6A 1XNRE 4NXME
chains in the Genus database with same CATH superfamily
2LVHA 4DR1E 1A1KA 3HPSA 4DR7E 1YYWA 1X3CA 1T39A 4B3RE 4JYAE 2EN1A 5AE1A 2V8QB 1TF6A 5IXMB 2DIXA 4DV4E 4X64E 2RSMA 2L3CA 2EMYA 3TQMA 2DGCA 3OMLA 4RHBB 2EMGA 1A1HA 1GTKA 2EL4A 1ZAAC 2N8XA 3C4TA 2EN6A 2EMZA 5A6KA 4F6NA 2EMIA 1JK2A 2YRMA 3LLHA 2WCC3 4DV5E 2YTGA 3KZYA 2EL6A 2EM4A 4BC9A 2CTDA 4DUZE 2M7QA 2ODRD 3UK3C 3AUZA 2EE8A 2LBSB 2YRKA 2V89A 4Q35B 2M9AA 2MDRA 3AV0A 5KL5A 4LF9E 1T38A 2NABA 4WSGA 2YSOA 5A6AA 3VK6A 3C6KA 4K0KE 4R2SA 1PJTA 2B7TA 2R1FA 2EOXA 2LUPB 4BC7A 2EPXA 2YU8A 4JI4E 4Q28A 2VRDA 2YTIA 4WXCA 2EOYA 4R2EA 2EM7A 2LJHA 2MKDA 1YUJA 2EN2A 4BMJA 2IHR1 2BB8A 4DV6E 4DR5E 2EN8A 4BCAA 3QG5C 2RSIA 3ZOQB 2LE2A 1TN9A 1X5WA 1P47A 1G2DC 1N32E 2EMWA 1UN6B 2E1MA 4DV0E 1IBME 4JI0E 2JOXA 3EPKA 1HNXE 4WX9A 2FTXB 2V88A 4DV3E 1XNQE 1WHQA 2YTQA 4OOGC 1LLMC 2ENAA 1ZBQA 2EM0A 1GZ6A 3MHHC 4LF4E 4MLQA 3MSWA 4DV2E 2YWQA 5AASA 2DLQA 1KYQA 1FKAE 1BB8A 3T1HE 2DB2A 1QU6A 2CT1A 1WXRA 2YTOA 2YTNA 2YU5A 3ECRA 2UU9E 1N3GA 2EORA 1YPNA 4F9BB 2VE7C 1JK1A 2ELYA 4LFBE 4KWYA 4LF5E 4P7DA 2E72A 1SFEA 2YT4A 3K6QA 1G2FC 2N3HA 5LLQA 2J7JA 4DKKA 1NEIA 1MEYC 2EN7A 2B7VA 4IS1C 1X6FA 1A1GA 4HTGA 2LT7A 2YZTA 4JI1E 2KHXA 5BR8E 5T6JA 2ENCA 2JY9A 5KL7A 3EQ1A 4ZYDA 4B3TE 4R03A 4DUYE 3J7Yp 1T4NA 4NZVA 1X6EA 1WJPA 4F9CB 1N36E 4R2PA 4LU9A 4WXDA 2LJUA 4WSPA 1GQEA 5IV8B 4ZYGA 2EPCA 2EPUA 4M9VC 2LRSA 4JI7E 2E5LE 3IWCA 4R2CA 1N33E 4DMIA 2EP3A 2WBTA 4X66E 2M1SA 4O43A 4JI8E 2ZM6E 2VQFE 2YTPA 1SR9A 2EOEA 4X8WA 3MHSC 4TUIA 4GKKE 2GLIA 3ADJA 4LF6E 1DGCA 3EPLA 2LUQA 3VHTB 1NCSA 2MDGA 2FV4B 3JTZA 3L00A 5FLXC 3HQ1A 4BS9A 2EQ3A 3HTXA 4WFTA 4JI6E 2EOOA 2WZOA 2GHFA 2L2KB 5KL2A 1A1FA 1DQ3A 2I13A 2HHHE 1HR0E 1EH6A 4YY3E 4R2DA 4FK5C 1STUA 1FJGE 1KJKA 4LFCE 2EPAA 1TF3A 4M2ZA 2YSPA 2V87A 1ZR9A 2PRTA 2JPAA 3ADGA 1YUIA 2MC5A 2JR1A 1ZU1A 4R2QA 2F8BA 4RH8A 2V83A 1YSAC 2UXCE 2MC6A 2B9DA 2EOZA 2GPIA 3JAMC 4M0VA 2L33A 3DF6A 4F54A 5ADZA 4TUGA 4WYQB 3IWBA 2DRPA 2JP9A 4DR2E 3KZZA 2ENHA 1YYKA 2KOUA 2EPNA 2RTXA 3C6MA 1HNWE 2L8TA 2EMXA 2YRHA 1Z1BA 2NUEA 2K4VA 2RPCA 3J7AG 5CFFE 4LF8E 2EPPA 1B69A 2UUAE 3ADLA 5F3WA 2JYAA 2EMKA 2Q8UA 4DV7E 1L4SA 2DMIA 1RC7A 4F2JC 4R8OA 5AC4A 3EPHA 3IWDA 5KL3A 2EOJA 2VQEE 4BBYA 1AH5A 2EOFA 3F6GA 2YTEA 4F6MA 2CSHA 2EMAA 2HGHA 2EQ1A 2MKNA 2EWLA 2A25A 5IT9C 2L2MA 3P1XA 2ELZA 2JXPA 1X47A 4R2AA 2EPRA 1PJSA 2VF1A 2YTFA 3HPZA 3J80C 1DI2A 1A1IA 2EOIA 2H36X 2EM3A 3KWRA 2EM2A 3F6HA 1T4LB 2FGGA 4JV5E 2EPZA 4NHRA 1UHZA 4X62E 2DSYA 4GZNC 1IMUA 2YTJA 1IBLE 4N4RB 3HXLA 1RMDA 5AE3A 1X49A 2EPMX 4GKJE 2EZ6A 4O4KA 3LMLA 2EM8A 1F2IG 3BIDA 4X9JA 3OTOE 4ZYHA 4BHBA 2EMCA 2BBGA 4YHHE 2K7IA 1I94E 3THOB 2EMBA 1J5EE 1N34E 2EM9A 3H09A 1XMQE 1PKPA 3FIGA 2V85A 1XMOE 2NA2A 3RMPA 2UUBE 1WHNA 2F4VE 3BGHA 2L92A 2JVAA 2WBSA 1A1JA 1WRJA 4DV1E 4LFAE 1QNTA 2RS7A 3EPJA 4JI5E 4LF7E 5A69A 1XNRE 4NXME 4AQYE 2LV2A 2EMLA 3T1YE 2WBUA 2LMZA 5LL6R 5AC5A 1RQ0A 2EQ0A 2LCEA 4JI2E 2EN4A 2L6MA 5KL6A 2LO3A 4BHCA 2EMHA 4KHPE 4M30A 1X48A 2R76A 1BBGA 1YYOA 2YTDA 2EN3A 4X65E 2EJ4A 1EKZA 4OX9E 3BBGA 1ZBTA 3ADIA 2DLKA 1BBOA 2EPOA 5A6JA 2KONA 1IBKE 4LTYA 4DR4E 2EM5A 2NUGA 2L2NA 4IJDA 2RQLA 4MLVA 2EL5A 1A1LA 2EM6A 1IQSA 1O0WA 2EOHA 2N3GA 3J81C 5LMNE 2DMYA 3M99B 1EH7A 1J26A 2M4IA 4I8OA 2L3JA 4JI3E 1MGTA 3THNA 2EOQA 4L8NA 2ADRA 2CPNA 2D9HA 2ODRC 1IQOA 2G7HA 4NXNE 1AAYA 5AE2A 1PJQA 2JWOA 5A2QC 2I9IA 2EOMA 2V86A 5LMUE 4B3SE 2HC5A 4KZSA 4WPYA 1PDAA 1UILA 2LTRA 2B3TB 5IWAE 2HJJA 2LTSA 1YZ9A 3VYXA 5KL4A 4F9AB 2RS6A 4ZYEA 2JOBA 2EOSA 2NUFA 3JU0A 2UXDE 4HEIA 4DR3E 5DNYA 4GEQB 4O24A 4B3ME 3VYYA 2EPKX 3DJWA 4P78A 1UBDC 4J8ZA 4L5NC 2UXBE 1HNZE 1EH8A 5A6BD 1YFHA 2UUCE 1T4OA 1X6HA 5TSEA 4DR6E 3C4BA 4R2RA 2YPNA 3BF2A 5A6BA 4O5GA 2EPLX 2EMFA
chains in the Genus database with same CATH topology
2V83A 4AQYE 2UXCE 2MC6A 4DR1E 2B9DA 3T1YE 2UU9E 2LMZA 5LL6R 1RQ0A 4M0VA 3JAMC 2L33A 3HPSA 3DF6A 4F54A 5ADZA 4TUGA 2L6MA 4JI2E 4DR7E 1YYWA 4WYQB 2VE7C 3IWBA 4F9BB 4B3RE 4DR2E 4LF5E 4LFBE 4JYAE 5AE1A 4P7DA 2V8QB 2KOUA 1YYKA 4KHPE 2YT4A 2RTXA 3K6QA 4M30A 2DIXA 1X48A 4DV4E 1HNWE 2N3HA 2L8TA 4X64E 2RSMA 2L3CA 1YYOA 2NUEA 2K4VA 4DKKA 3J7AG 3OMLA 5CFFE 4X65E 1EKZA 4OX9E 4LF8E 3C4TA 2UUAE 3ADLA 5F3WA 1ZBTA 2B7VA 3ADIA 4DV7E 2YZTA 4JI1E 2KHXA 5BR8E 2KONA 3LLHA 2JY9A 5T6JA 4DV5E 1IBKE 1RC7A 4LTYA 4DR4E 4BC9A 4R8OA 4B3TE 2NUGA 2L2NA 4R03A 2M7QA 2ODRD 4DUYE 4DUZE 3AUZA 3J7Yp 1T4NA 1N36E 4F9CB 3IWDA 2LBSB 2V89A 2VQEE 4BBYA 3F6GA 1O0WA 2MDRA 3AV0A 4LF9E 4LU9A 2N3GA 3J81C 4WSPA 1GQEA 5LMNE 2LRSA 2DMYA 2EWLA 5IT9C 4JI7E 3VK6A 2E5LE 3IWCA 1J26A 2M4IA 4I8OA 2L2MA 3P1XA 2L3JA 4JI3E 1N33E 4DMIA 4K0KE 1X47A 2B7TA 4L8NA 4X66E 2VF1A 3HPZA 3J80C 2M1SA 2CPNA 4JI8E 2LUPB 1DI2A 4BC7A 4JI4E 2ZM6E 2H36X 2VQFE 1SR9A 2ODRC 4Q28A 3KWRA 4X8WA 2G7HA 3F6HA 4NXNE 4TUIA 4GKKE 2LJHA 1T4LB 5AE2A 2FGGA 3ADJA 4BMJA 2IHR1 2JWOA 4JV5E 5A2QC 4LF6E 1UHZA 4X62E 5LMUE 2DSYA 2V86A 2LUQA 4B3SE 4KZSA 4WPYA 4DV6E 4DR5E 1IBLE 3HXLA 1UILA 2LTRA 4BCAA 2B3TB 5AE3A 5IWAE 2LTSA 2FV4B 1X49A 3JTZA 3ZOQB 5FLXC 3HQ1A 4BS9A 2EZ6A 3LMLA 2LE2A 4GKJE 1YZ9A 3VYXA 3HTXA 4WFTA 4JI6E 1N32E 4F9AB 2RS6A 2JOBA 2WZOA 3OTOE 2L2KB 2NUFA 1DQ3A 3JU0A 2UXDE 2E1MA 4DR3E 4DV0E 1IBME 4YHHE 2HHHE 4JI0E 1I94E 1HR0E 2JOXA 1HNXE 1J5EE 1N34E 5DNYA 2FTXB 2V88A 3H09A 4GEQB 4DV3E 1PKPA 4YY3E 3FIGA 1XMQE 1XNQE 1WHQA 2V85A 3VYYA 1XMOE 4B3ME 1STUA 3DJWA 2NA2A 4OOGC 1FJGE 1ZBQA 4P78A 3RMPA 2UUBE 1GZ6A 4J8ZA 1WHNA 4L5NC 4LFCE 2F4VE 2UXBE 1HNZE 4LF4E 2L92A 4M2ZA 2V87A 2JVAA 3MSWA 2UUCE 4DV2E 3ADGA 1T4OA 5AASA 4DV1E 4LFAE 3C4BA 2MC5A 4DR6E 2JR1A 1FKAE 2RS7A 4JI5E 3T1HE 2DB2A 4LF7E 1QU6A 1WXRA 2F8BA 1XNRE 4NXME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY E;  2UXC E;  4DR1 E;  3T1Y E;  2UU9 E;  1RQ0 A;  4JI2 E;  2L33 A;  4DR7 E;  1YYW A;  4WYQ B;  4LFB E;  4B3R E;  4DR2 E;  4LF5 E;  4JYA E;  1YYK A;  4KHP E;  2YT4 A;  2RTX A;  4M30 A;  2DIX A;  1X48 A;  4DV4 E;  1HNW E;  2N3H A;  4X64 E;  2RSM A;  2L3C A;  1YYO A;  2NUE A;  4DKK A;  5CFF E;  4X65 E;  1EKZ A;  4OX9 E;  4LF8 E;  3C4T A;  2UUA E;  3ADL A;  1ZBT A;  2B7V A;  3ADI A;  4DV7 E;  4JI1 E;  2KHX A;  5BR8 E;  3LLH A;  2JY9 A;  4DV5 E;  1IBK E;  1RC7 A;  4DR4 E;  4B3T E;  2NUG A;  2L2N A;  4DUZ E;  4DUY E;  3J7Y p;  1T4N A;  1N36 E;  2LBS B;  2VQE E;  1O0W A;  2MDR A;  4LF9 E;  2N3G A;  1GQE A;  5LMN E;  2LRS A;  2DMY A;  4JI7 E;  2E5L E;  1J26 A;  2L3J A;  4JI3 E;  2L2M A;  3P1X A;  1N33 E;  4K0K E;  1X47 A;  2B7T A;  4X66 E;  2LUP B;  2CPN A;  4JI8 E;  1DI2 A;  4JI4 E;  2ZM6 E;  2VQF E;  4X8W A;  4NXN E;  4GKK E;  2LJH A;  1T4L B;  3ADJ A;  2IHR 1;  4JV5 E;  4LF6 E;  1UHZ A;  4X62 E;  5LMU E;  2LUQ A;  4B3S E;  4DV6 E;  4DR5 E;  1IBL E;  1UIL A;  2LTR A;  2B3T B;  5IWA E;  2LTS A;  1X49 A;  4GKJ E;  2EZ6 A;  1YZ9 A;  3VYX A;  3HTX A;  4WFT A;  4JI6 E;  1N32 E;  2RS6 A;  3OTO E;  2L2K B;  2NUF A;  2UXD E;  4DR3 E;  4DV0 E;  1IBM E;  4YHH E;  2HHH E;  4JI0 E;  1I94 E;  1HR0 E;  1HNX E;  1J5E E;  1N34 E;  4DV3 E;  1PKP A;  4YY3 E;  1XMQ E;  1XNQ E;  1WHQ A;  3VYY A;  1XMO E;  4B3M E;  1STU A;  4OOG C;  2NA2 A;  1FJG E;  2UUB E;  4LFC E;  1WHN A;  2F4V E;  2UXB E;  1HNZ E;  4LF4 E;  4M2Z A;  2UUC E;  2JVA A;  4DV2 E;  3ADG A;  1T4O A;  4DV1 E;  4LFA E;  3C4B A;  4DR6 E;  1FKA E;  2RS7 A;  4JI5 E;  3T1H E;  2DB2 A;  4LF7 E;  1QU6 A;  1XNR E;  4NXM E; 
#chains in the Genus database with same CATH topology
 2LVH A;  4DR1 E;  1A1K A;  3HPS A;  4DR7 E;  1YYW A;  1X3C A;  1T39 A;  4B3R E;  4JYA E;  2EN1 A;  5AE1 A;  2V8Q B;  1TF6 A;  5IXM B;  2DIX A;  4DV4 E;  4X64 E;  2RSM A;  2L3C A;  2EMY A;  3TQM A;  2DGC A;  3OML A;  4RHB B;  2EMG A;  1A1H A;  1GTK A;  2EL4 A;  1ZAA C;  2N8X A;  3C4T A;  2EN6 A;  2EMZ A;  5A6K A;  4F6N A;  2EMI A;  1JK2 A;  2YRM A;  3LLH A;  2WCC 3;  4DV5 E;  2YTG A;  3KZY A;  2EL6 A;  2EM4 A;  4BC9 A;  2CTD A;  4DUZ E;  2M7Q A;  2ODR D;  3UK3 C;  3AUZ A;  2EE8 A;  2LBS B;  2YRK A;  2V89 A;  4Q35 B;  2M9A A;  2MDR A;  3AV0 A;  5KL5 A;  4LF9 E;  1T38 A;  2NAB A;  4WSG A;  2YSO A;  5A6A A;  3VK6 A;  3C6K A;  4K0K E;  4R2S A;  1PJT A;  2B7T A;  2R1F A;  2EOX A;  2LUP B;  4BC7 A;  2EPX A;  2YU8 A;  4JI4 E;  4Q28 A;  2VRD A;  2YTI A;  4WXC A;  2EOY A;  4R2E A;  2EM7 A;  2LJH A;  2MKD A;  1YUJ A;  2EN2 A;  4BMJ A;  2IHR 1;  2BB8 A;  4DV6 E;  4DR5 E;  2EN8 A;  4BCA A;  3QG5 C;  2RSI A;  3ZOQ B;  2LE2 A;  1TN9 A;  1X5W A;  1P47 A;  1G2D C;  1N32 E;  2EMW A;  1UN6 B;  2E1M A;  4DV0 E;  1IBM E;  4JI0 E;  2JOX A;  3EPK A;  1HNX E;  4WX9 A;  2FTX B;  2V88 A;  4DV3 E;  1XNQ E;  1WHQ A;  2YTQ A;  4OOG C;  1LLM C;  2ENA A;  1ZBQ A;  2EM0 A;  1GZ6 A;  3MHH C;  4LF4 E;  4MLQ A;  3MSW A;  4DV2 E;  2YWQ A;  5AAS A;  2DLQ A;  1KYQ A;  1FKA E;  1BB8 A;  3T1H E;  2DB2 A;  1QU6 A;  2CT1 A;  1WXR A;  2YTO A;  2YTN A;  2YU5 A;  3ECR A;  2UU9 E;  1N3G A;  2EOR A;  1YPN A;  4F9B B;  2VE7 C;  1JK1 A;  2ELY A;  4LFB E;  4KWY A;  4LF5 E;  4P7D A;  2E72 A;  1SFE A;  2YT4 A;  3K6Q A;  1G2F C;  2N3H A;  5LLQ A;  2J7J A;  4DKK A;  1NEI A;  1MEY C;  2EN7 A;  2B7V A;  4IS1 C;  1X6F A;  1A1G A;  4HTG A;  2LT7 A;  2YZT A;  4JI1 E;  2KHX A;  5BR8 E;  5T6J A;  2ENC A;  2JY9 A;  5KL7 A;  3EQ1 A;  4ZYD A;  4B3T E;  4R03 A;  4DUY E;  3J7Y p;  1T4N A;  4NZV A;  1X6E A;  1WJP A;  4F9C B;  1N36 E;  4R2P A;  4LU9 A;  4WXD A;  2LJU A;  4WSP A;  1GQE A;  5IV8 B;  4ZYG A;  2EPC A;  2EPU A;  4M9V C;  2LRS A;  4JI7 E;  2E5L E;  3IWC A;  4R2C A;  1N33 E;  4DMI A;  2EP3 A;  2WBT A;  4X66 E;  2M1S A;  4O43 A;  4JI8 E;  2ZM6 E;  2VQF E;  2YTP A;  1SR9 A;  2EOE A;  4X8W A;  3MHS C;  4TUI A;  4GKK E;  2GLI A;  3ADJ A;  4LF6 E;  1DGC A;  3EPL A;  2LUQ A;  3VHT B;  1NCS A;  2MDG A;  2FV4 B;  3JTZ A;  3L00 A;  5FLX C;  3HQ1 A;  4BS9 A;  2EQ3 A;  3HTX A;  4WFT A;  4JI6 E;  2EOO A;  2WZO A;  2GHF A;  2L2K B;  5KL2 A;  1A1F A;  1DQ3 A;  2I13 A;  2HHH E;  1HR0 E;  1EH6 A;  4YY3 E;  4R2D A;  4FK5 C;  1STU A;  1FJG E;  1KJK A;  4LFC E;  2EPA A;  1TF3 A;  4M2Z A;  2YSP A;  2V87 A;  1ZR9 A;  2PRT A;  2JPA A;  3ADG A;  1YUI A;  2MC5 A;  2JR1 A;  1ZU1 A;  4R2Q A;  2F8B A;  4RH8 A;  2V83 A;  1YSA C;  2UXC E;  2MC6 A;  2B9D A;  2EOZ A;  2GPI A;  3JAM C;  4M0V A;  2L33 A;  3DF6 A;  4F54 A;  5ADZ A;  4TUG A;  4WYQ B;  3IWB A;  2DRP A;  2JP9 A;  4DR2 E;  3KZZ A;  2ENH A;  1YYK A;  2KOU A;  2EPN A;  2RTX A;  3C6M A;  1HNW E;  2L8T A;  2EMX A;  2YRH A;  1Z1B A;  2NUE A;  2K4V A;  2RPC A;  3J7A G;  5CFF E;  4LF8 E;  2EPP A;  1B69 A;  2UUA E;  3ADL A;  5F3W A;  2JYA A;  2EMK A;  2Q8U A;  4DV7 E;  1L4S A;  2DMI A;  1RC7 A;  4F2J C;  4R8O A;  5AC4 A;  3EPH A;  3IWD A;  5KL3 A;  2EOJ A;  2VQE E;  4BBY A;  1AH5 A;  2EOF A;  3F6G A;  2YTE A;  4F6M A;  2CSH A;  2EMA A;  2HGH A;  2EQ1 A;  2MKN A;  2EWL A;  2A25 A;  5IT9 C;  2L2M A;  3P1X A;  2ELZ A;  2JXP A;  1X47 A;  4R2A A;  2EPR A;  1PJS A;  2VF1 A;  2YTF A;  3HPZ A;  3J80 C;  1DI2 A;  1A1I A;  2EOI A;  2H36 X;  2EM3 A;  3KWR A;  2EM2 A;  3F6H A;  1T4L B;  2FGG A;  4JV5 E;  2EPZ A;  4NHR A;  1UHZ A;  4X62 E;  2DSY A;  4GZN C;  1IMU A;  2YTJ A;  1IBL E;  4N4R B;  3HXL A;  1RMD A;  5AE3 A;  1X49 A;  2EPM X;  4GKJ E;  2EZ6 A;  4O4K A;  3LML A;  2EM8 A;  1F2I G;  3BID A;  4X9J A;  3OTO E;  4ZYH A;  4BHB A;  2EMC A;  2BBG A;  4YHH E;  2K7I A;  1I94 E;  3THO B;  2EMB A;  1J5E E;  1N34 E;  2EM9 A;  3H09 A;  1XMQ E;  1PKP A;  3FIG A;  2V85 A;  1XMO E;  2NA2 A;  3RMP A;  2UUB E;  1WHN A;  2F4V E;  3BGH A;  2L92 A;  2JVA A;  2WBS A;  1A1J A;  1WRJ A;  4DV1 E;  4LFA E;  1QNT A;  2RS7 A;  3EPJ A;  4JI5 E;  4LF7 E;  5A69 A;  1XNR E;  4NXM E;  4AQY E;  2LV2 A;  2EML A;  3T1Y E;  2WBU A;  2LMZ A;  5LL6 R;  5AC5 A;  1RQ0 A;  2EQ0 A;  2LCE A;  4JI2 E;  2EN4 A;  2L6M A;  5KL6 A;  2LO3 A;  4BHC A;  2EMH A;  4KHP E;  4M30 A;  1X48 A;  2R76 A;  1BBG A;  1YYO A;  2YTD A;  2EN3 A;  4X65 E;  2EJ4 A;  1EKZ A;  4OX9 E;  3BBG A;  1ZBT A;  3ADI A;  2DLK A;  1BBO A;  2EPO A;  5A6J A;  2KON A;  1IBK E;  4LTY A;  4DR4 E;  2EM5 A;  2NUG A;  2L2N A;  4IJD A;  2RQL A;  4MLV A;  2EL5 A;  1A1L A;  2EM6 A;  1IQS A;  1O0W A;  2EOH A;  2N3G A;  3J81 C;  5LMN E;  2DMY A;  3M99 B;  1EH7 A;  1J26 A;  2M4I A;  4I8O A;  2L3J A;  4JI3 E;  1MGT A;  3THN A;  2EOQ A;  4L8N A;  2ADR A;  2CPN A;  2D9H A;  2ODR C;  1IQO A;  2G7H A;  4NXN E;  1AAY A;  5AE2 A;  1PJQ A;  2JWO A;  5A2Q C;  2I9I A;  2EOM A;  2V86 A;  5LMU E;  4B3S E;  2HC5 A;  4KZS A;  4WPY A;  1PDA A;  1UIL A;  2LTR A;  2B3T B;  5IWA E;  2HJJ A;  2LTS A;  1YZ9 A;  3VYX A;  5KL4 A;  4F9A B;  2RS6 A;  4ZYE A;  2JOB A;  2EOS A;  2NUF A;  3JU0 A;  2UXD E;  4HEI A;  4DR3 E;  5DNY A;  4GEQ B;  4O24 A;  4B3M E;  3VYY A;  2EPK X;  3DJW A;  4P78 A;  1UBD C;  4J8Z A;  4L5N C;  2UXB E;  1HNZ E;  1EH8 A;  5A6B D;  1YFH A;  2UUC E;  1T4O A;  1X6H A;  5TSE A;  4DR6 E;  3C4B A;  4R2R A;  2YPN A;  3BF2 A;  5A6B A;  4O5G A;  2EPL X;  2EMF A; 
#chains in the Genus database with same CATH homology
 2V83 A;  4AQY E;  2UXC E;  2MC6 A;  4DR1 E;  2B9D A;  3T1Y E;  2UU9 E;  2LMZ A;  5LL6 R;  1RQ0 A;  4M0V A;  3JAM C;  2L33 A;  3HPS A;  3DF6 A;  4F54 A;  5ADZ A;  4TUG A;  2L6M A;  4JI2 E;  4DR7 E;  1YYW A;  4WYQ B;  2VE7 C;  3IWB A;  4F9B B;  4B3R E;  4DR2 E;  4LF5 E;  4LFB E;  4JYA E;  5AE1 A;  4P7D A;  2V8Q B;  2KOU A;  1YYK A;  4KHP E;  2YT4 A;  2RTX A;  3K6Q A;  4M30 A;  2DIX A;  1X48 A;  4DV4 E;  1HNW E;  2N3H A;  2L8T A;  4X64 E;  2RSM A;  2L3C A;  1YYO A;  2NUE A;  2K4V A;  4DKK A;  3J7A G;  3OML A;  5CFF E;  4X65 E;  1EKZ A;  4OX9 E;  4LF8 E;  3C4T A;  2UUA E;  3ADL A;  5F3W A;  1ZBT A;  2B7V A;  3ADI A;  4DV7 E;  2YZT A;  4JI1 E;  2KHX A;  5BR8 E;  2KON A;  3LLH A;  2JY9 A;  5T6J A;  4DV5 E;  1IBK E;  1RC7 A;  4LTY A;  4DR4 E;  4BC9 A;  4R8O A;  4B3T E;  2NUG A;  2L2N A;  4R03 A;  2M7Q A;  2ODR D;  4DUY E;  4DUZ E;  3AUZ A;  3J7Y p;  1T4N A;  1N36 E;  4F9C B;  3IWD A;  2LBS B;  2V89 A;  2VQE E;  4BBY A;  3F6G A;  1O0W A;  2MDR A;  3AV0 A;  4LF9 E;  4LU9 A;  2N3G A;  3J81 C;  4WSP A;  1GQE A;  5LMN E;  2LRS A;  2DMY A;  2EWL A;  5IT9 C;  4JI7 E;  3VK6 A;  2E5L E;  3IWC A;  1J26 A;  2M4I A;  4I8O A;  2L2M A;  3P1X A;  2L3J A;  4JI3 E;  1N33 E;  4DMI A;  4K0K E;  1X47 A;  2B7T A;  4L8N A;  4X66 E;  2VF1 A;  3HPZ A;  3J80 C;  2M1S A;  2CPN A;  4JI8 E;  2LUP B;  1DI2 A;  4BC7 A;  4JI4 E;  2ZM6 E;  2H36 X;  2VQF E;  1SR9 A;  2ODR C;  4Q28 A;  3KWR A;  4X8W A;  2G7H A;  3F6H A;  4NXN E;  4TUI A;  4GKK E;  2LJH A;  1T4L B;  5AE2 A;  2FGG A;  3ADJ A;  4BMJ A;  2IHR 1;  2JWO A;  4JV5 E;  5A2Q C;  4LF6 E;  1UHZ A;  4X62 E;  5LMU E;  2DSY A;  2V86 A;  2LUQ A;  4B3S E;  4KZS A;  4WPY A;  4DV6 E;  4DR5 E;  1IBL E;  3HXL A;  1UIL A;  2LTR A;  4BCA A;  2B3T B;  5AE3 A;  5IWA E;  2LTS A;  2FV4 B;  1X49 A;  3JTZ A;  3ZOQ B;  5FLX C;  3HQ1 A;  4BS9 A;  2EZ6 A;  3LML A;  2LE2 A;  4GKJ E;  1YZ9 A;  3VYX A;  3HTX A;  4WFT A;  4JI6 E;  1N32 E;  4F9A B;  2RS6 A;  2JOB A;  2WZO A;  3OTO E;  2L2K B;  2NUF A;  1DQ3 A;  3JU0 A;  2UXD E;  2E1M A;  4DR3 E;  4DV0 E;  1IBM E;  4YHH E;  2HHH E;  4JI0 E;  1I94 E;  1HR0 E;  2JOX A;  1HNX E;  1J5E E;  1N34 E;  5DNY A;  2FTX B;  2V88 A;  3H09 A;  4GEQ B;  4DV3 E;  1PKP A;  4YY3 E;  3FIG A;  1XMQ E;  1XNQ E;  1WHQ A;  2V85 A;  3VYY A;  1XMO E;  4B3M E;  1STU A;  3DJW A;  2NA2 A;  4OOG C;  1FJG E;  1ZBQ A;  4P78 A;  3RMP A;  2UUB E;  1GZ6 A;  4J8Z A;  1WHN A;  4L5N C;  4LFC E;  2F4V E;  2UXB E;  1HNZ E;  4LF4 E;  2L92 A;  4M2Z A;  2V87 A;  2JVA A;  3MSW A;  2UUC E;  4DV2 E;  3ADG A;  1T4O A;  5AAS A;  4DV1 E;  4LFA E;  3C4B A;  2MC5 A;  4DR6 E;  2JR1 A;  1FKA E;  2RS7 A;  4JI5 E;  3T1H E;  2DB2 A;  4LF7 E;  1QU6 A;  1WXR A;  2F8B A;  1XNR E;  4NXM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...