2DB6A

Solution structure of rsgi ruh-051, a c1 domain of stac3 from human cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
GSSGSSGEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRCSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-051, a C1 domain of STAC3 from human cDNA
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords SH3 and cysteine rich domain 3
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2db6A01
2J87A 2B8TA 1Y8FA 4UXJA 4FKDA 4UXHA 3UFFA 2ROWA 4UXIA 1TBNA 2UZ3A 2YUUA 1XBTA 2QQEA 2ENNA 1W4RA 1KBFA 2GVIA 2QQ0A 3UGLA 5FUYA 1FARA 4B6DA 5FUVA 1RFHA 1XX6A 1PTRA 2ENZA 3UEYA 2QPOA 2WVJA 1XA6A 3BJIA 3UEJA 4L9MA 2ELIA 2DB6A 2VRWB 2E73A 1R79A 3E2IA 1PTQA 1KBEA 3CXLA 5FUWA 3UGIA 3UGDA 3KY9A 5FUXA 1TBOA 2J9RA 2JA1A 2ORWA 1FAQA 2FNFX 2ORVA
chains in the Genus database with same CATH superfamily
1UUCA 1MJAA 1IY6A 1HEVA 4FKDA 1K7UA 4UXHA 2CWHA 2V53A 2ROWA 2UZ3A 2YUUA 1Y1CA 2QQEA 3FSYA 1FYBA 5HQ8A 1W4RA 5CCLA 3TOBA 1KBFA 1OYVI 3B4VC 1TGSI 5JHWC 9WGAA 2QQ0A 1FY7A 5EX0A 3TO9A 1TURA 1FARA 5E3RA 1V1IA 1HPTA 1TOTA 2ENZA 3OL0A 3OVOA 2NU2I 2KCXA 2GKRI 1XA6A 1SGRI 2SGFI 1SGQI 2KMOA 2L8EA 2NU3I 2SGPI 4L9MA 2VRWB 2JZMA 3E2IA 2A20A 1KBEA 2LUYA 3UGIA 4E1PA 1H0ZA 1WTJA 2OZUA 1Z7KB 3OXGA 3R5BA 1MT1A 2NU1I 1OMTA 1P9ZA 2ARPF 2L7XA 2WCYA 4AMLA 2RIJA 1DS2I 1CE3A 3TJQA 5CCMA 3OXFA 2SGDI 2X52A 4UXIA 1TBNA 4HGUA 2QQDA 2ENNA 2SGQI 1K7VA 4GI3C 2GIVA 5HI7A 3PDNA 1Y1BA 2WGCA 1YTPA 2CJSC 5DAEA 4B6DA 1S20A 3VDUA 5J8FA 1WGCA 1XX6A 1WGTA 2Y0MA 2B0UC 2YQPA 3VDPA 1CT4I 2KMRA 2WVJA 3RU0A 1SGDI 1CHOI 5J8CA 5E3QA 3SEKC 2BUSA 2E73A 1PTQA 2PQ8A 2QQCA 3CXLA 1CGII 1W3SA 1ULKA 3KY9A 4JCVE 5FUWA 2JYYA 3TO7A 2NU0I 2JA1A 1ULNA 2NU4I 1PCEA 1FAQA 2ORVA 1OVOA 2J87A 2LB7A 4UXJA 4OVOA 2CWGA 3SGBI 3UFFA 1UVGA 1IW4A 1M8BA 1HDLA 1Q9BA 7WGAA 3TOAA 1XBTA 1AN1I 1ULMA 2OD1A 1NUBA 1M8CA 1PPFI 1X74A 2LEOA 1BMOA 1V1HA 3FSXA 3MEKA 2GVIA 1CT2I 4A24A 1TBRR 1TBQR 1TUSA 1CGJI 3R5DA 1VDDA 3GOXA 1UVFA 3E59A 2RC4A 1LR8A 3FC3A 1X4SA 3OXLA 1UHAA 1KMAA 2QPOA 4MPIA 3UEJA 1U5KA 4SGBI 3UOEA 4DNCA 1DS3I 2V1CC 2DB6A 3R5AA 1YU6C 1R79A 1CSOI 1SGYI 3TO6A 3QAHA 2OU2A 2DKVA 3VE5A 1P9GA 1R0RI 2M5XA 2ORWA 2GKTI 2CWFA 2FNFX 2K9HA 2N52A 2B8TA 1Y8FA 2XRCA 2ERWA 2N17A 2V1CA 3HH2C 1OMUA 4WP4A 2X3TA 3QWPA 1N13A 1TIHA 2F3CI 1K7TA 2KMQA 3SGQI 2N71A 1SGEI 2KMPA 1IY5A 1BUSA 3UGLA 2N1AB 5FUYA 2JXDA 4E1RA 1WKXA 1LR7A 1HJAI 1RFHA 1SGNI 5FUVA 1PTRA 2GKVA 3UEYA 1Z2IA 3QTLD 1MJ9A 1LR9A 3BJIA 2ODDA 2JW6A 2P6AC 2ELIA 2E5RA 1CT0I 2DIPA 3D00A 2UVOA 3UGDA 1NXUA 5FUXA 1SGPI 1TBOA 2J9RA 3R5CA 2W0TA 5EX3A 1PJUA 2OVOA 2SGEI 1MJBA 5E3PA
chains in the Genus database with same CATH topology
1UUCA 1IY6A 4FKDA 4UXHA 2V53A 2ROWA 2UZ3A 2YUUA 1Y1CA 2QQEA 1FYBA 5HQ8A 1W4RA 5CCLA 1KBFA 1OYVI 3B4VC 1TGSI 5JHWC 2QQ0A 5EX0A 1TURA 1FARA 1V1IA 1HPTA 1TOTA 2ENZA 3OL0A 3OVOA 2NU2I 2KCXA 2GKRI 1XA6A 1SGRI 2SGFI 1SGQI 2KMOA 2L8EA 2NU3I 2SGPI 4L9MA 2VRWB 2JZMA 3E2IA 2A20A 1KBEA 2LUYA 3UGIA 4E1PA 1H0ZA 1Z7KB 3OXGA 1MT1A 2NU1I 1OMTA 2L7XA 2ARPF 2WCYA 1DS2I 1CE3A 3TJQA 5CCMA 3OXFA 2SGDI 4UXIA 1TBNA 4HGUA 2QQDA 2ENNA 2SGQI 4GI3C 5HI7A 3PDNA 1Y1BA 1YTPA 2CJSC 5DAEA 4B6DA 3VDUA 1XX6A 2B0UC 2YQPA 3VDPA 1CT4I 2KMRA 2WVJA 3RU0A 1SGDI 1CHOI 3SEKC 2BUSA 2E73A 1PTQA 3CXLA 2QQCA 5FUWA 1CGII 1W3SA 3KY9A 4JCVE 2JYYA 2NU0I 2JA1A 2NU4I 1PCEA 1FAQA 2ORVA 1OVOA 2J87A 4UXJA 4OVOA 3UFFA 3SGBI 1IW4A 1UVGA 1HDLA 1M8BA 1BUSA 1XBTA 1AN1I 2OD1A 1NUBA 1M8CA 1PPFI 1X74A 2LEOA 1BMOA 1V1HA 3MEKA 2GVIA 1CT2I 4A24A 1TBRR 1TBQR 1TUSA 1CGJI 1VDDA 3GOXA 1UVFA 3E59A 1LR8A 3FC3A 1X4SA 3OXLA 1KMAA 2QPOA 3UEJA 1U5KA 4SGBI 1DS3I 2V1CC 2DB6A 1YU6C 1R79A 1CSOI 1SGYI 3VE5A 2ORWA 1R0RI 2M5XA 2GKTI 2FNFX 2K9HA 2N52A 2B8TA 1Y8FA 2XRCA 2ERWA 2N17A 2V1CA 1OMUA 3QWPA 1N13A 1TIHA 2F3CI 2KMQA 3SGQI 1IY5A 2N71A 1SGEI 2KMPA 3UGLA 2N1AB 5FUYA 2JXDA 4E1RA 1LR7A 1HJAI 1RFHA 1SGNI 5FUVA 1PTRA 2GKVA 3UEYA 3QTLD 1LR9A 3BJIA 2ODDA 2JW6A 2P6AC 2ELIA 2E5RA 1CT0I 2DIPA 3D00A 3UGDA 5FUXA 1SGPI 1TBOA 2J9RA 2W0TA 5EX3A 1PJUA 2OVOA 2SGEI 3HH2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J87 A;  2B8T A;  1Y8F A;  4UXJ A;  4FKD A;  4UXH A;  3UFF A;  2ROW A;  4UXI A;  1TBN A;  2UZ3 A;  2YUU A;  1XBT A;  2QQE A;  2ENN A;  1W4R A;  1KBF A;  2GVI A;  2QQ0 A;  3UGL A;  5FUY A;  1FAR A;  4B6D A;  5FUV A;  1RFH A;  1XX6 A;  1PTR A;  2ENZ A;  3UEY A;  2QPO A;  2WVJ A;  1XA6 A;  3BJI A;  3UEJ A;  4L9M A;  2ELI A;  2DB6 A;  2VRW B;  2E73 A;  1R79 A;  3E2I A;  1PTQ A;  1KBE A;  3CXL A;  5FUW A;  3UGI A;  3UGD A;  3KY9 A;  5FUX A;  1TBO A;  2J9R A;  2JA1 A;  2ORW A;  1FAQ A;  2FNF X;  2ORV A; 
#chains in the Genus database with same CATH topology
 1UUC A;  1MJA A;  1IY6 A;  1HEV A;  4FKD A;  1K7U A;  4UXH A;  2CWH A;  2V53 A;  2ROW A;  2UZ3 A;  2YUU A;  1Y1C A;  2QQE A;  3FSY A;  1FYB A;  5HQ8 A;  1W4R A;  5CCL A;  3TOB A;  1KBF A;  1OYV I;  3B4V C;  1TGS I;  5JHW C;  9WGA A;  2QQ0 A;  1FY7 A;  5EX0 A;  3TO9 A;  1TUR A;  1FAR A;  5E3R A;  1V1I A;  1HPT A;  1TOT A;  2ENZ A;  3OL0 A;  3OVO A;  2NU2 I;  2KCX A;  2GKR I;  1XA6 A;  1SGR I;  2SGF I;  1SGQ I;  2KMO A;  2L8E A;  2NU3 I;  2SGP I;  4L9M A;  2VRW B;  2JZM A;  3E2I A;  2A20 A;  1KBE A;  2LUY A;  3UGI A;  4E1P A;  1H0Z A;  1WTJ A;  2OZU A;  1Z7K B;  3OXG A;  3R5B A;  1MT1 A;  2NU1 I;  1OMT A;  1P9Z A;  2ARP F;  2L7X A;  2WCY A;  4AML A;  2RIJ A;  1DS2 I;  1CE3 A;  3TJQ A;  5CCM A;  3OXF A;  2SGD I;  2X52 A;  4UXI A;  1TBN A;  4HGU A;  2QQD A;  2ENN A;  2SGQ I;  1K7V A;  4GI3 C;  2GIV A;  5HI7 A;  3PDN A;  1Y1B A;  2WGC A;  1YTP A;  2CJS C;  5DAE A;  4B6D A;  1S20 A;  3VDU A;  5J8F A;  1WGC A;  1XX6 A;  1WGT A;  2Y0M A;  2B0U C;  2YQP A;  3VDP A;  1CT4 I;  2KMR A;  2WVJ A;  3RU0 A;  1SGD I;  1CHO I;  5J8C A;  5E3Q A;  3SEK C;  2BUS A;  2E73 A;  1PTQ A;  2PQ8 A;  2QQC A;  3CXL A;  1CGI I;  1W3S A;  1ULK A;  3KY9 A;  4JCV E;  5FUW A;  2JYY A;  3TO7 A;  2NU0 I;  2JA1 A;  1ULN A;  2NU4 I;  1PCE A;  1FAQ A;  2ORV A;  1OVO A;  2J87 A;  2LB7 A;  4UXJ A;  4OVO A;  2CWG A;  3SGB I;  3UFF A;  1UVG A;  1IW4 A;  1M8B A;  1HDL A;  1Q9B A;  7WGA A;  3TOA A;  1XBT A;  1AN1 I;  1ULM A;  2OD1 A;  1NUB A;  1M8C A;  1PPF I;  1X74 A;  2LEO A;  1BMO A;  1V1H A;  3FSX A;  3MEK A;  2GVI A;  1CT2 I;  4A24 A;  1TBR R;  1TBQ R;  1TUS A;  1CGJ I;  3R5D A;  1VDD A;  3GOX A;  1UVF A;  3E59 A;  2RC4 A;  1LR8 A;  3FC3 A;  1X4S A;  3OXL A;  1UHA A;  1KMA A;  2QPO A;  4MPI A;  3UEJ A;  1U5K A;  4SGB I;  3UOE A;  4DNC A;  1DS3 I;  2V1C C;  2DB6 A;  3R5A A;  1YU6 C;  1R79 A;  1CSO I;  1SGY I;  3TO6 A;  3QAH A;  2OU2 A;  2DKV A;  3VE5 A;  1P9G A;  1R0R I;  2M5X A;  2ORW A;  2GKT I;  2CWF A;  2FNF X;  2K9H A;  2N52 A;  2B8T A;  1Y8F A;  2XRC A;  2ERW A;  2N17 A;  2V1C A;  3HH2 C;  1OMU A;  4WP4 A;  2X3T A;  3QWP A;  1N13 A;  1TIH A;  2F3C I;  1K7T A;  2KMQ A;  3SGQ I;  2N71 A;  1SGE I;  2KMP A;  1IY5 A;  1BUS A;  3UGL A;  2N1A B;  5FUY A;  2JXD A;  4E1R A;  1WKX A;  1LR7 A;  1HJA I;  1RFH A;  1SGN I;  5FUV A;  1PTR A;  2GKV A;  3UEY A;  1Z2I A;  3QTL D;  1MJ9 A;  1LR9 A;  3BJI A;  2ODD A;  2JW6 A;  2P6A C;  2ELI A;  2E5R A;  1CT0 I;  2DIP A;  3D00 A;  2UVO A;  3UGD A;  1NXU A;  5FUX A;  1SGP I;  1TBO A;  2J9R A;  3R5C A;  2W0T A;  5EX3 A;  1PJU A;  2OVO A;  2SGE I;  1MJB A;  5E3P A; 
#chains in the Genus database with same CATH homology
 1UUC A;  1IY6 A;  4FKD A;  4UXH A;  2V53 A;  2ROW A;  2UZ3 A;  2YUU A;  1Y1C A;  2QQE A;  1FYB A;  5HQ8 A;  1W4R A;  5CCL A;  1KBF A;  1OYV I;  3B4V C;  1TGS I;  5JHW C;  2QQ0 A;  5EX0 A;  1TUR A;  1FAR A;  1V1I A;  1HPT A;  1TOT A;  2ENZ A;  3OL0 A;  3OVO A;  2NU2 I;  2KCX A;  2GKR I;  1XA6 A;  1SGR I;  2SGF I;  1SGQ I;  2KMO A;  2L8E A;  2NU3 I;  2SGP I;  4L9M A;  2VRW B;  2JZM A;  3E2I A;  2A20 A;  1KBE A;  2LUY A;  3UGI A;  4E1P A;  1H0Z A;  1Z7K B;  3OXG A;  1MT1 A;  2NU1 I;  1OMT A;  2L7X A;  2ARP F;  2WCY A;  1DS2 I;  1CE3 A;  3TJQ A;  5CCM A;  3OXF A;  2SGD I;  4UXI A;  1TBN A;  4HGU A;  2QQD A;  2ENN A;  2SGQ I;  4GI3 C;  5HI7 A;  3PDN A;  1Y1B A;  1YTP A;  2CJS C;  5DAE A;  4B6D A;  3VDU A;  1XX6 A;  2B0U C;  2YQP A;  3VDP A;  1CT4 I;  2KMR A;  2WVJ A;  3RU0 A;  1SGD I;  1CHO I;  3SEK C;  2BUS A;  2E73 A;  1PTQ A;  3CXL A;  2QQC A;  5FUW A;  1CGI I;  1W3S A;  3KY9 A;  4JCV E;  2JYY A;  2NU0 I;  2JA1 A;  2NU4 I;  1PCE A;  1FAQ A;  2ORV A;  1OVO A;  2J87 A;  4UXJ A;  4OVO A;  3UFF A;  3SGB I;  1IW4 A;  1UVG A;  1HDL A;  1M8B A;  1BUS A;  1XBT A;  1AN1 I;  2OD1 A;  1NUB A;  1M8C A;  1PPF I;  1X74 A;  2LEO A;  1BMO A;  1V1H A;  3MEK A;  2GVI A;  1CT2 I;  4A24 A;  1TBR R;  1TBQ R;  1TUS A;  1CGJ I;  1VDD A;  3GOX A;  1UVF A;  3E59 A;  1LR8 A;  3FC3 A;  1X4S A;  3OXL A;  1KMA A;  2QPO A;  3UEJ A;  1U5K A;  4SGB I;  1DS3 I;  2V1C C;  2DB6 A;  1YU6 C;  1R79 A;  1CSO I;  1SGY I;  3VE5 A;  2ORW A;  1R0R I;  2M5X A;  2GKT I;  2FNF X;  2K9H A;  2N52 A;  2B8T A;  1Y8F A;  2XRC A;  2ERW A;  2N17 A;  2V1C A;  1OMU A;  3QWP A;  1N13 A;  1TIH A;  2F3C I;  2KMQ A;  3SGQ I;  1IY5 A;  2N71 A;  1SGE I;  2KMP A;  3UGL A;  2N1A B;  5FUY A;  2JXD A;  4E1R A;  1LR7 A;  1HJA I;  1RFH A;  1SGN I;  5FUV A;  1PTR A;  2GKV A;  3UEY A;  3QTL D;  1LR9 A;  3BJI A;  2ODD A;  2JW6 A;  2P6A C;  2ELI A;  2E5R A;  1CT0 I;  2DIP A;  3D00 A;  3UGD A;  5FUX A;  1SGP I;  1TBO A;  2J9R A;  2W0T A;  5EX3 A;  1PJU A;  2OVO A;  2SGE I;  3HH2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...