2DB9A

Solution structure of the plus-3 domain of human kiaa0252 protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
149
structure length
149
Chain Sequence
GSSGSSGPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paf1/RNA polymerase II complex component
publication title Solution structure of the plus-3 domain of human KIAA0252 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 26
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03126 Plus-3 Plus-3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.30 Mainly Beta Beta Complex paz domain paz domain 2db9A01
4L1PA 3U1UA 4L1UA 2DB9A 2BZEA
chains in the Genus database with same CATH superfamily
4NHAA 4Z4EA 4W5QA 2XFMA 5KI6A 4W5TA 3HJFA 4NGGA 4OLAA 4NH5A 5JS2A 3HVRA 1T2RA 4L1UA 4NH6A 4NGBA 2BZEA 3F73A 3DLBA 1R6ZA 2L5DA 3HK2A 3MJ0A 3HM9A 4Z4FA 1Z26A 3HO1A 4NGFA 1U04A 3DA5A 4NGCA 4NH3A 5T7BA 4Z4HA 4Z4GA 4W5RA 1Z25A 3O3IX 2FFLA 3O7XA 4Z4CA 4W5OA 4L1PA 4KREA 3O6EX 1VYNA 1R4KA 3QIRA 1SI3A 4OLBA 2DB9A 4KRFA 2QVWA 4NGDA 4F3TA 4Z4IA 2L5CA 3DLHA 4W5NA 3O7VX 3U1UA 1T2SA 5JS1A 1SI2A
chains in the Genus database with same CATH topology
4NHAA 4Z4EA 4W5QA 2XFMA 5KI6A 4W5TA 3HJFA 4NGGA 4OLAA 4NH5A 5JS2A 3HVRA 1T2RA 4L1UA 4NH6A 4NGBA 2BZEA 3F73A 3DLBA 1R6ZA 2L5DA 3HK2A 3MJ0A 3HM9A 4Z4FA 1Z26A 3HO1A 4NGFA 1U04A 3DA5A 4NGCA 4NH3A 5T7BA 4Z4HA 4Z4GA 4W5RA 1Z25A 3O3IX 2FFLA 3O7XA 4Z4CA 4W5OA 4L1PA 4KREA 3O6EX 1VYNA 1R4KA 3QIRA 1SI3A 4OLBA 2DB9A 4KRFA 2QVWA 4NGDA 4F3TA 4Z4IA 2L5CA 3DLHA 4W5NA 3O7VX 3U1UA 1T2SA 5JS1A 1SI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L1P A;  3U1U A;  4L1U A;  2DB9 A;  2BZE A; 
#chains in the Genus database with same CATH topology
 4NHA A;  4Z4E A;  4W5Q A;  2XFM A;  5KI6 A;  4W5T A;  3HJF A;  4NGG A;  4OLA A;  4NH5 A;  5JS2 A;  3HVR A;  1T2R A;  4L1U A;  4NH6 A;  4NGB A;  2BZE A;  3F73 A;  3DLB A;  1R6Z A;  2L5D A;  3HK2 A;  3MJ0 A;  3HM9 A;  4Z4F A;  1Z26 A;  3HO1 A;  4NGF A;  1U04 A;  3DA5 A;  4NGC A;  4NH3 A;  5T7B A;  4Z4H A;  4Z4G A;  4W5R A;  1Z25 A;  3O3I X;  2FFL A;  3O7X A;  4Z4C A;  4W5O A;  4L1P A;  4KRE A;  3O6E X;  1VYN A;  1R4K A;  3QIR A;  1SI3 A;  4OLB A;  2DB9 A;  4KRF A;  2QVW A;  4NGD A;  4F3T A;  4Z4I A;  2L5C A;  3DLH A;  4W5N A;  3O7V X;  3U1U A;  1T2S A;  5JS1 A;  1SI2 A; 
#chains in the Genus database with same CATH homology
 4NHA A;  4Z4E A;  4W5Q A;  2XFM A;  5KI6 A;  4W5T A;  3HJF A;  4NGG A;  4OLA A;  4NH5 A;  5JS2 A;  3HVR A;  1T2R A;  4L1U A;  4NH6 A;  4NGB A;  2BZE A;  3F73 A;  3DLB A;  1R6Z A;  2L5D A;  3HK2 A;  3MJ0 A;  3HM9 A;  4Z4F A;  1Z26 A;  3HO1 A;  4NGF A;  1U04 A;  3DA5 A;  4NGC A;  4NH3 A;  5T7B A;  4Z4H A;  4Z4G A;  4W5R A;  1Z25 A;  3O3I X;  2FFL A;  3O7X A;  4Z4C A;  4W5O A;  4L1P A;  4KRE A;  3O6E X;  1VYN A;  1R4K A;  3QIR A;  1SI3 A;  4OLB A;  2DB9 A;  4KRF A;  2QVW A;  4NGD A;  4F3T A;  4Z4I A;  2L5C A;  3DLH A;  4W5N A;  3O7V X;  3U1U A;  1T2S A;  5JS1 A;  1SI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...