2DBBA

Crystal structure of ph0061
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
146
Chain Sequence
KLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLGYMYAIVLIKSKVPSDADKVISEISDIEYVKSVEKGVGRYNIIVRLLLPKDIKDAENLISEFLQRIKNAENVEVILISEVRKFEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative HTH-type transcriptional regulator PH0061
publication title Crystal structure of PH0061
rcsb
source organism Pyrococcus horikoshii
molecule tags Transcriptional regulator
total genus 36
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dbbA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dbbA02
3F8CA 1OYWA 1MJ9A 1U78A 2ZNYA 3T8TA 4ZYGA 2VBXA 3DQVC 1ZYRF 4I0BA 4HF1A 3HOSA 4HV5A 4RS8A 3DPLC 1FX7A 1KQ8A 1QZZA 4KT5C 3WTTC 2P7CB 3RIRA 5BQTA 2V79A 1BN5A 3F8FA 3ZMTA 2XAFA 1ZGJA 4YFNF 4HX7A 3KP7A 1ONVA 2HEOA 5JR3A 3DP7A 1B59A 2OQRA 3K1MA 2XAHA 2F5CA 2VN2A 2E1NA 4WK8F 4PDKA 4PGGA 4IXAA 5E8GA 5JFRA 5E1ZB 4MNUA 1QQIA 2P5KA 3P9KA 2A6HF 3LFKA 4CXFA 1CF7B 3GZ6A 2Q8KA 3DFGA 3RJPA 4HQEA 2DQRA 2YX7A 1IW7F 4M72A 3GVAA 3QU6A 2E1CA 3NEUA 2W84A 1ZRFA 2JPCA 4GGGA 3ROUA 1BI2A 3WTUC 4L18B 1Z1DA 3TDUC 1YLFA 2FNAA 2VBYA 3PQKA 3VEPA 4HLXA 2CW0F 2XAQA 3WU0A 5FO5A 3SFZA 4H0EA 3RDIA 1ZREA 4HF0A 4CICA 4ZYDA 5DCFA 2PFBA 3LQRA 4HV6A 2Y0MA 1XGMA 4WX9A 4NB5A 5IT3A 1HBXG 5K1YA 1W7PD 2WTEA 4KN4X 2L4MA 4LLLA 3WTWC 2P5LC 1H9GA 3BJOA 2VODA 2PMHA 3BJ6A 3F6VA 3RPQA 3SXYA 1WRJA 2YPRA 3R60A 3I59A 1FYLA 2PEXA 2PG4A 3FWEA 4Q4ZF 2HOEA 5ILUA 3DPTA 1ZAOA 3QPHA 1K78B 2VE9A 2JPBA 4Q48A 4MEXF 1SD6A 3ABUA 5D4RA 4WXHA 3QOPA 2QQ9A 5JVTA 2LDUA 2O3FA 3R61A 2M45A 1SD4A 3EQLF 4GCVA 2KIMA 4B09A 4OIPF 1P4XA 4DNCA 1LDDA 2HKXA 2PMUA 3L00A 4P96A 3MAJA 4CYDA 5BOXA 3F23A 2XV4S 4K2EA 1TQPA 5E8IA 3I4PA 1YS7A 3U9GA 4Y17A 4BAYA 3BWGA 1O3TA 4KNYA 1FSEA 2CYYA 1OYYA 3IKTA 1IXCA 1LJ9A 3BPXA 5ICGA 4RGSA 3RKWA 2FOKA 3RTRA 5ICFA 2GIVA 3QP6A 5HDGA 3VB2A 2Q2EA 1KYZA 5JHUA 2YR2A 5L3BA 1MDMA 4MEYF 2RKHA 4N9HA 1U8RA 5LLQA 2W85A 2HS5A 1ZLKA 2D1HA 4XBFA 2STWA 3F6OA 1Z91A 3CLOA 4PZJA 1Y0UA 1ON2A 4A0YA 1FP2A 2GA2A 1YW9A 1XGSA 2Z99A 5CVJA 3ABTA 4CHUA 3GFLA 3E5XA 2JRTA 3ELKA 6PAXA 3T5XA 1YS6A 4P5OA 2AXLA 1EH6A 3E6MA 4WWCA 4MTEA 4ENMA 4EGZA 2VONA 4L5IA 2FMYA 2FE3A 4Y13A 5BPDA 4UV9A 2MH2A 2BEOA 1CF7A 1S7AA 1V4RA 4Z2YA 3EETA 1R1VA 2VXZA 1J2XA 5AIQA 2HYGD 5LHIA 1FOKA 4AD9A 1ZN2A 1KYWA 4FT8A 4I0AA 1O3SA 1YYVA 2DI3A 2QQBA 3E5UA 3GEZA 5ILVA 3BROA 3KZZA 2EWNA 2ELHA 1J75A 1P4AA 2MD5A 3WTXC 3T8RA 4IF4A 2GWRA 3CUQA 1BBYA 2P4WA 2R7DA 2Y48A 4YIFA 3DV8A 4KIFA 3HOTA 4R1HA 5E1XA 2F5EA 4A6EA 2EA4A 2ADUA 4CO8A 2FF4A 2OU2A 1RUOA 1UHWA 2RGVA 3CUQC 4OIRF 2TDXA 5LHHA 2YX4A 5FB2A 3VODA 3P7NA 3DXJF 1SD7A 2Z3YA 5D5WB 3HRSA 3HTUA 2ZXJA 4ZYEA 2A61A 3ZN0A 2A68F 4OIQF 2ZMEB 3M9AA 5HLIA 5LRRA 3WG9A 2COMA 4EVIA 3P9IA 3R6SA 3F22A 4GO1A 4UVCA 3D5LA 4KN7X 3W6JB 1K78A 1ZRDA 4UUVA 5HS8A 4AIJA 1MKMA 1IZ1A 3KFWX 3D0SA 1XD7A 2IVMA 4KFCA 2MA3A 2P6SA 2DAOA 2EK5A 2XIGA 3GFMA 4MGRA 5LEJA 4GYGA 3F8BA 3TOBA 4ASNA 4IRGA 1G6NA 1K6OA 4G6DA 2G9WA 2Z5UA 2VT2A 3V8JA 1FBUA 4A5MA 3TQNA 3V8LA 1HKSA 4I09A 1DDNA 3GWZA 3MFKA 4A0XA 4MTDA 2E7WA 1AWCA 4M9ZA 4G7ZF 2DK5A 1U6GA 1D5VA 2DJWA 4ETSA 2H27A 1XMKA 1PUEE 1MZBA 3COAC 3ZPLA 1TNTA 2VBWA 2DW4A 2V1UA 4M71A 4IJAA 4IHTA 1J9IA 1OPCA 2EFWA 3HSEA 1ZGAA 4JQFA 2ZFWA 2PJPA 4OMZA 5L3FA 1D8KA 2HQNA 1QBJA 4LB5A 3EYYA 2G7HA 3HRMA 2ACJA 3ZP5A 4QLCU 1OR7A 4CZZA 2RQPA 2F5DA 1BI0A 4YIIA 5BS6A 3LA7A 1ZG1A 4B8XA 2PQ8A 2GXGA 3O6BB 4UHTA 3KP5A 4Q5SF 1GXPA 4BH9A 2LSOA 3DKWA 2OA4A 3EUHA 4M9XA 1U5TB 3G3ZA 2P5VA 1BIAA 5LEKA 2JSCA 5DV5A 5BMZA 1SFUA 3DEUA 3I54A 2CO5A 1BOAA 3E97A 2PI0A 2MC3A 4JK1X 2UZKA 1W5SA 1RZ4A 1LDKB 1BIBA 5HDKA 3G73A 4IRIA 4O3MA 4P9UA 3U2RA 2D45A 1W5TA 2HZTA 2K4BA 1FYMA 5D8KB 4KDPA 4AIHA 5TJJA 5LGNA 4A2UA 2PLYA 2QLZA 3IHUA 1USSA 2ZNZA 4HYEA 5LHGA 1Z7UA 1REPC 1STZA 4G9YA 2F2EA 1YQAA 4CGZA 4RB1A 3FM3A 4LB6B 2Y75A 2ZBKA 1G3TA 3CTAA 1HKTA 1K7AA 1EH7A 3F72A 2DBBA 4Q47A 3RYPA 1UB9A 3HTSB 5FGMA 3V4GA 1SFEA 3IWZA 5CVIA 1JHFA 1Q1HA 3BDDA 1QZYA 2FEZA 1BI3A 1T6SA 5LGUA 4G8XA 3Q5FA 1R5HA 1S3JA 3IKVA 1FWZA 3QRFF 2STTA 2NS0A 1Z6RA 1R36A 2OZ6A 3WE2A 1F4KA 2FQ3A 2FRHA 2XAGA 3WGIA 2WC2A 1C0WA 3RKYA 2ZKZA 1W7PB 3CO7C 1L0OC 2A3SA 2O03A 4BNCA 2DO7A 5DUKA 3F8NA 2KKOA 2D1VA 1XGNA 1LQ1A 2KJBA 2EV5A 2HKOA 4KIGA 1TQIA 2W57A 3H3UA 3QU3A 2QYOA 5J8CA 2FBHA 1BJAA 2HWVA 3GX4X 1OMIA 1HSJA 2EFPA 2K27A 2BE5F 4KICA 3TDZC 5F1RA 3MEXA 2NRAC 3B73A 2VOPA 3F21A 3L2CA 2NYXA 3JTHA 3I64A 1NHAA 2K4JA 4OMYA 1DP7P 2JTVA 5LGTA 2C6YA 3ZMSA 1E2XA 2H6BA 1FP1D 2IA2A 4ENKA 3NQOA 2QQAA 1I1GA 1O7FA 1HQCA 4L0YB 1YFHA 2UXNA 2B0LA 4LK0F 3FM5A 2DPDA 3Q9VA 3GZ5A 5K5RA 4EM1A 4ENNA 5DD4A 4LJZF 3LWFA 1U2WA 2FBKA 2FU4A 5K5QA 4IPAA 4ZH4F 3TGNA 3J81Z 2X4HA 5ILSA 1DPRA 1KU9A 5HOOA 1KU3A 3HYIA 2R3SA 1XSXA 1HW2A 1R7JA 4LLGF 1U5TA 3KLNA 3HIFA 5HLGA 1FT9A 3CJNA 1O3RA 5DCMB 5LRSA 2GAUA 4EJVA 4RAYA 1HSTA 2QVOA 5CJ9A 2DK8A 1U5TC 1WKMA 3WTZA 4AVPA 3V7SA 3WGHA 3K0LA 4BYYA 5E20A 1RI7A 4LK1F 2CGPA 2Z33A 3O2PE 1ZHFA 4P55A 2XUBA 3B02A 2XVCA 2NNYA 1XB4A 2LNBA 2CFXA 5H20A 3R0AA 5D5XB 3W6KB 1KA8A 3FHZA 1IN8A 3VOEA 1JGSA 1TNSA 2BBYA 2VT3A 4LFUA 1XDUA 1R00A 4ESJA 4PGHA 3Q9SA 1QNTA 5H6QA 1XMAA 3C18A 2L02A 3JW4A 3N97A 1QO0D 1T39A 3E5QA 1S29A 2QBYB 2F5FA 1L3LA 5D6EA 1PP8F 1XGOA 3RPUA 2K02A 3MQ0A 3QP5A 2EJRA 2DQLA 4LG0B 4UVBA 1DUXC 2P6TA 4L5JA 1UFMA 5D5UB 1BC8C 2EA2A 1I6XA 1PDNC 1OKRA 1SMYF 4RB0A 1H9TA 1G4DA 1A04A 2IA1A 3MZYA 2VBZA 2XROA 3HSRA 4O6JA 4RB3C 5IT9Z 3E6CC 3WGGA 4L0ZB 5CVRA 1J5YA 3MCZA 4OOIA 3KP6A 4WXDA 1W7PA 3JSOA 3KZYA 3TO9A 4FHTA 2XRNA 3QPTA 3BJAA 2UXXA 1I1SA 3CUOA 2P8TA 1AOYA 1S8NA 3J81K 4F7ZA 2FNPA 3V8KA 4I01A 1KQ0A 4EM0B 1CGPA 3RYRA 1HXDA 1I5ZA 2QENA 5TRDA 2A6EF 1GHCA 2ETHA 3K1NA 5ERIA 2VOOA 1B1BA 5ED4A 3IRRA 1JXSA 3BOQA 4N9IA 3ZMZA 3REOA 1G3YA 3WTSC 4RGRA 5DEQA 1IN4A 4ON0A 4ESBA 1FLIA 3RKXA 1KU2A 5A2QK 3I59B 3V7CA 4Y15A 3R4KA 4WCGA 3V7RA 1FPQA 1FNNA 4NHJA 3U1DA 3LAJA 3MWMA 4FX0A 3WU1B 4OU0A 2HGCA 1IRGA 4R8HA 2QWWA 1YIOA 5FD5A 1G3SA 1LB2A 1WSUA 2AS5F 1FSHA 1FYKA 2HDCA 4LLNA 4HF2A 3N4MA 2FSWA 3E6DA 5D4SA 3LAPA 2H6CA 2BYVE 2KRFA 1MJBA 3OOPA 1TLHB 5CLSA 2MLGA 3M8EA 3PQJA 4XLPF 3FX3A 2V1DA 3K1PA 4HZFA 3H3ZA 1Z9CA 3KETA 1UHMA 1XDSA 3BP8A 4E70A 3HUGA 1KGSA 4HOBA 4OINF 2ZBCA 4A6DA 3SZTA 1XSVA 5DDGA 1J7KA 3GYHX 3ZQ7A 5F64A 4MQVA 2XKOA 1O57A 5EEGA 3TKYA 2O6GE 5H6RA 2A07F 1D8JA 1D3YA 5AONA 2CQKA 1U3EM 3JAMZ 2HTSA 5J8FA 3BZ6A 5AIPA 4GYIA 3SZPA 1X3UA 4IHSA 3EYIA 2W24A 2O0YA 5IT9K 1S7OA 1LEAA 2ZJ2A 1ZH5A 2RVCA 1R22A 1ZG3A 2XKPA 2EFOA 2E1AA 4HLYA 4RB2C 3JSPA 1R1UA 2PN6A 1ON1A 2YU3A 2DT5A 4HX4A 3ECHA 3M8FA 5CYVA 4RGXA 1MDMB 4ZZLA 1XN7A 2QBYA 3GF2A 1LVAA 3LSTA 2H94A 2OZUA 1USTA 1MJAA 3OV8A 1XSDA 5DUIA 4LG0A 3DF8A 4BHPA 1TW3A 3I53A 5FFXA 2E7XA 2QZ8A 5L3CA 4XLNF 5E1WA 2GZWA 1HW5A 4YFKF 2RNJA 5ICEA 2G7UA 3LA3A 4KA4A 4U0YA 1T38A 1H0MA 3LQQA 3JTGA 4R79A 5L3EA 1WQ2A 5L3DA 3HHGA 3IL2A 2VC1A 3I0TA 4IRHA 2V1XA 1ZLJA 4HBLA 4XSZF 1ODDA 2D2WA 3BPVA 3SHFA 1WI9A 2L54A 3TOAA 4S05A 1IN6A 2X0LA 2ZMEA 5L3GA 1J59A 3FMSA 5K5OA 4L9JA 3GUDA 3KEOA 2A69F 2ISYA 5FD6A 3MZHA 2VE8A 4LMYA 4M73A 1R5GA 2OAZA 4GXOA 2BV6A 2A5YB 3CUQB 3ZN1A 2Z4PA 5F6FA 4KYWA 2LF8A 2L4AA 3L9FA 4A0ZA 3S2WA 1YW8A 2ZCWA 1BC7C 1B6AA 2KIUA 1IAWA 4I2OA 1BI1A 5KK1A 3M7GA 4BHCA 4I02A 2RC4A 4PCQA 3C3WA 2M1BA 3KP3A 2FXAA 2HR3A 3ML6A 4G6QA 2FMLA 4HDVA 3T0YA 3WTVC 3I5UA 3JAMK 1OYIA 1WWXA 2EV6A 4CDGA 4EMSA 1TQMA 1IF1A 3ZMUA 4KIBA 2M8EA 5HVQC 3E3VA 1FBQA 1LDJA 4JBAA 2QUFA 3ECOA 4HA8A 3KP2A 1Z6TA 3K2ZA 1EV7A 2DLLA 1ZG5A 4U88A 2M30A 2MLKA 1XCBA 4MHGA 2MBFA 1F5TA 4G94A 1Z05A 3CDHA 1I27A 5BPIA 5HLHA 5CVVA 2VC0A 4L9NA 3K69A 2ZO4A 1RUNA 3L09A 4EJTA 3RI4A 1F1ZA 2OBPA 1RIOH 1SMTA 4O5VA 4KMFA 1T0FA 4HQMA 3ERED 2R7FA 2ESHA 3CO6C 2XGXA 5FLXZ 5FFZA 1ZRCA 3M1EA 3L7WA 1E17A 2O61A 3C7JA 3BY6A 1MGTA 3GO5A 3FMRA 1SFXA 1SAXA 2LF7A 3F3XA 4ENJA 2CWEA 4M6YA 4RGUA 5D8LB 4UXNA 1R23A 4EQQA 2EB7A 1YO5C 3K9TA 5LBQA 1T2KA 1ZARA 3WODF 3H92A 3HRTA 2KJCA 3PFIA 4U0VA 4QWQA 1S6LA 3HHHA 4EM2A 2UWMA 1JE8A 1IUYA 2MH9A 5A2QZ 2Z9OA 4UVAA 3FZVA 1UCRA 1GXQA 3C1DA 1F9NA 1JHHA 3I71A 3KEQA 3TO6A 2OD5A 3GW2A 3VFZA 3I58A 3ISPA 1TBXA 3FXRA 1IRFA 4ESFA 3QAHA 4XRFA 2KIFA 1EH8A 4M6XA 1T98A 2M5WA 2V6CA 3O3KA 1O7LA 4XSXF 1LNWA 2DTRA 1IXSB 1BM9A 3P9CA 2HQRA 3SQNA 4G7HF 2WV0A 2HFHA 1QGPA 2NNNA 1FZPB 3WTYC 2CVIA 3J7AO 2L01A 5JI6A 1TW2A 3ULQB 2YSRA 4A5NA 3IWFA 4EJOA 3FXUA 4OIOF 1J0RA 2K86A 5J6XA 2P7VB 2NAZA 4BXUA 1PP7U 4AIKA 2XAJA 2W25A 4HDUA 1LEBA 4G7OF 4EJWA 3F8MA 3J80Z 4M74A 2FBIA 4U0WA 1B4AA 1R1TA 2J5PA 2GQQA 4FX4A 2J5OA 4HAMA 4S04A 2IRFG 2EFNA 4UNOA 3T1BA 1YTYA 1IN7A 3KP4A 1TTYA 4RAZA 4LD5A 5E18F 4P9FA 5HS9A 1SD5A 2DFIA 1R58A 2V9VA 2L3DA 2IPQX 5FLXK 4HX8A 3WE3A 2IP2A 2JZYA 4EV0A 2K7LA 1P4WA 4DQ2A 1V3FA 1GVJA 3LA2A 3IRQA 2HYFA 4UV8A 3FMQA 3GLXA 4NQWA 1P2FA 2BGCA 3KE2A 2GXBA 4I98B 4L9VA 1K79A 4WXCA 5HDNA 1FC3A 2WWYA 3KLOA 3ZMDA 3GFJA 3E6BA 2HTJA 1VTNC 5DD8A 4YG2F 4BHBA 4YFXF 2LKPA 2IJLA 4U7BA 2DU9A 2GA1A 1B9NA 2QM3A 3EDPA 1DPUA 2IA0A 2EV0A 4I7HA 4U7DA 2IW5A 1IXRC 2PBIA 4M9SA 1YW7A 4EGYA 1HW1A 4ZYHA 5ICCA 1KQ9A 3HRUA 3GXOA 1FBSA 2H09A 4WF2A 2M87A 2CSOA 2XHKA 4IVNA 3HSFA 2Q0OA 2RN7A 5DYMA 5D5VB 2ISZA 1G3WA 2RV8A 2JT1A 2OQGA 5KVRA 5E17F 4ZZDA 4L9TA 3TO7A 3AAFA 3ZMVA 2CG4A 3FF5A 5DCMA 3KCCA 1YG2A 3FXQA 2XASA 4BQAA 1KU7A 1B9MA 1XCVA 4A12A 1IN5A 4D0PA 4HW0A 1P6RA 4TV7A 1ULYA 4LGWA 2DPUA 5D6FA 1FY7A 1MD0A 2JSXA 3NRVA 3J80K 5EEHA 1QPMA 4AWXB 4N0BA 3GFIA 4MQ9F 1HKQA 2IT0A 3R0JA 5HS7A 2ESNA 1O3QA 2EFQA 1RNLA 5CVUA 1P92A 4EJUA 2O8XA 1W4MA 2RDPA 3IC7A 4KMUX 4KUMA 2FA5A
chains in the Genus database with same CATH superfamily
5CD4H 2MSSA 2IIHA 5K8PA 2RF2B 3R9LA 4YHHJ 2ZNYA 3HB9A 3T8TA 3X3UA 1ZYRF 2EEYA 4K7QA 1T9VA 4HV5A 2AT1B 4B3RJ 2ZBQA 2Y30A 4C0BA 4RS8A 1X0PA 2H3EB 1KQ8A 2W2NP 5EG0B 1U26A 2DNNA 1FKOA 3CXCR 4KT5C 4PUOA 1TP4A 4MO7A 4CTAB 5IP6A 3KX2A 4DW6A 4EI2A 2XAFA 2MKKA 4EBCA 2M8DB 3PFOA 4UQGA 3OSGA 4QIWD 1NB7A 1Z21A 2R5YA 4MKYA 1JT0A 3GG1A 1ONVA 5JR3A 4DU7A 3DP7A 2F5CA 2VN2A 1Q53A 2K3KA 2B7EA 2KM8B 2BJ1A 3G82B 3LL7A 1RKTA 4WP9A 4WK8F 2ABYA 4PDKA 4DR4J 3VHQA 2OO4A 4IXAA 5E1ZB 2R9LA 4K59A 3CCJS 1TL5A 3RPUD 3ZR8X 1QSYA 1TL4A 4KHMA 5KFZA 2ZH7A 3VQSA 2IMOA 1EB0A 2Q8KA 2K40A 1O5JA 3DCFA 3DFGA 2GX8A 2AQFA 4PABA 2AHQA 3DMJB 4F26A 3TUIC 2LTPA 4AVZA 4KIAA 2YX7A 2CWXA 3OSFA 3GVAA 3CCQS 2OTLS 5KT3A 2NXCA 1SAUA 3A4TA 2EVZA 4IYQA 2MZ1A 4ECYA 1HOMA 2C2NA 1U45A 3ROUA 4OZ0A 1BI2A 3OIPA 2G9OA 3TDUC 2ASYA 3OYIA 1S1TB 3PQKA 5IQ6A 5J2PB 2AD9A 3PZPA 3O44A 1NHVA 2XAQA 2NYIA 1TFWA 2BDPA 3SFZA 4H0EA 3DRRB 2JVHA 3B82A 4HF0A 4BJ6C 1HQUA 4ZYDA 4FNHA 2DNGA 5DCFA 1VRUA 3LQRA 3H5XA 2Y0MA 4OWRB 1XQIA 4HEA2 2CNLB 4NB5A 1JUMA 5IT3A 1QLNA 4KN4X 1JXEA 4DV7J 4LLLA 2P5LC 2C1EB 3BJOA 3IGVA 1QTMA 2E60A 1RTDB 1QRYA 1JLCA 4YR0A 1IKWB 4ZPCA 4ED4A 4IH6A 3I59A 4A93J 4DFJA 1CBKA 4PUSA 1SJQA 2CUFA 5EN1A 2HZVA 2OP5A 5JHFA 1VQ5I 4MEXF 1U4BA 1U6ZA 2R7XA 4ZCLA 3ABUA 1X31C 3QOPA 1M0SA 3HULA 3DN9A 2QQ9A 5LSOA 2CQ0A 4USMA 1KTQA 2NZ4A 3J7YJ 5CAAA 2KISA 2DGWA 2KO1A 1EKEA 3GR1A 4KH1B 4PG5A 2LMDA 4GCVA 5IV3A 5KFKA 4XKWA 5D4OA 3RRKA 4B09A 3G71I 1P4XA 4DNCA 1LDDA 2ZITA 4MH8A 4RW8A 2GGPA 1C1CB 1VGYA 1VFJA 4P96A 4ED0A 1WC3A 5D0EA 2OCEA 5IWAF 2XC7A 5GAEI 4A3CJ 2UV1A 1S79A 3BO3A 1N25A 1TQPA 4H4MA 3U9GA 4Y17A 2OFHX 5KFMA 4BE2A 2GMHA 2CUEA 3PIOF 4X0GA 4LITA 4E0DA 1RKWA 4DR3J 5IZHA 1UEUA 1OYYA 5IT0A 1IXCA 1FIPA 5H9EK 4L3KA 2LDYA 1NTCA 2WZ1A 4WU2A 2FOKA 2JLFA 4D5FA 4OLPA 2XGDA 3T9ZA 4C4WA 3E01B 2E5HA 2RF2A 2CH0A 5JHUA 4ZOSA 4MEYF 2RKHA 4N9HA 3BR3A 2BKNA 4C3LA 4F0HA 3OXLA 5LLQA 1YRNB 2HQIA 2W85A 2X9DA 2HS5A 3NP5A 2GIFA 2HHUA 4LFCF 2D1HA 5EG0A 4XBFA 4B9VA 2STWA 3N9UC 2WAQA 4PZJA 4CTAA 1ON2A 4Z37A 1YLXA 3GTQJ 4P2XA 5ETVA 2WB1A 4PXCA 2Z99A 4RNMA 5CVJA 2RRBA 2O66A 2LFBA 2I10A 2CQPA 2ZHBA 3IBWA 2CJBA 1UW4A 1YI2S 6PAXA 2XNRA 4P5OA 2AXLA 2CPIA 4K50A 2R5ZA 2ATLA 4IRDA 3K0JA 4A3JJ 3E6MA 4WWCA 2LLZA 2KN4A 1IRXA 2CS3A 4L5IA 4HG2A 4ZDNA 3KJVA 4LF4J 2FGCA 2FE3A 4UB6C 1RQ0A 4NUBA 4ETXA 1RDRA 1S7AA 1V4RA 1V9OA 3CP8A 4Z2YA 2MLXA 5I42B 1R1VA 3J7ZI 2OGUA 3Q89A 2DOAA 5M2RA 2Q3PA 4A3BJ 1N56A 1UAWA 5LHIA 1QVGR 2KHDA 3R5JB 4O4GB 4FT8A 4DG1B 4I0AA 5CZXA 1O3SA 4UT4A 4YHHF 3NOCA 5JXSA 4FKYA 3E5UA 3GEZA 2GHWA 1FVSA 5F0UA 4B3RF 2ELHA 1W36C 1S1TA 2GWRA 1WTBA 2LFVA 4ZVRB 4OHXA 4ABZA 1BBYA 3R7BB 4NC8A 3MFHA 1NM2A 3HOTA 3ZGKA 4A6EA 2F4OB 2EA4A 2V1NA 4BWMA 3LSMA 2PGCA 2YUSA 3MMBB 1YG0A 1YK9A 4ECTA 2RGVA 1V3RA 3DLBA 3FSXA 3JRIA 1XR6A 1YJWI 2DNPA 3EICA 1RAJA 2B63J 3VODA 3UKGA 3JTOA 5D5WB 1RTDA 4F67A 4KPYA 3ZN0A 3MPWA 1IKWA 2HGNA 1RHKB 3UN2A 4B9SA 3ZRGA 4ID8A 4DR4F 5LRRA 3VGSA 3WG9A 1QU3A 2AO9A 2I5UA 4C2MA 4ZTJA 4EVIA 3BGUA 2ZKUA 3R6SA 1YJRA 4HPQA 2CDRB 1C4CA 3AXMA 2VKEA 3G8TA 2F6CA 3DU5A 2DA3A 2N8GA 3W6JB 2ZHAA 1ZRDA 1MKMA 2V2VA 3KFWX 1Z3XA 3D0SA 4DR7F 3MM8B 4KFCA 3M8SA 4UUXA 1P7IA 2MA3A 2P6SA 5KTQA 1KWMA 3E0JB 1IDZA 4Y2MA 5K7HA 5LEJA 2XIGA 2IVYA 4RW4B 3ZNUA 4ZK7M 3F8BA 1JT6A 2AYBA 3CD6S 3LQVA 5EEAA 3IRWP 1G6NA 1K6OA 2ZKTA 4G6DA 4Y52J 4MK7A 3RW6A 5F9LA 3KDOA 1FBUA 3SIPB 1T03B 3TQNA 3V8LA 3TUZC 1HKSA 3C19A 1DDNA 3GWZA 3GILA 2LQJA 3MFKA 4A0XA 4M9ZA 1T0TV 1Q86T 5T41A 5E3MA 1WACA 4DBRA 4EMDA 4ETSA 4DV7F 1XMKA 2B7CB 3GCWP 5KT4A 4Q43A 3VYRB 3PHTA 4ZVFA 4FE7A 5KG0A 3ZPLA 1FVQA 4QIWN 4WK1A 2GQ2A 3GTOJ 4PJJA 4DMZA 1BA5A 2N7YA 3ADAC 4I69A 3QGIA 2KT3A 4M71A 4HLBA 3MCMA 3S2DJ 4F7VA 5B66C 1OPCA 4QSHA 4P2SA 3MCSA 4A3DJ 1ZGAA 1NLKL 1G8XA 2EW9A 2XMKA 1X4FA 2HQNA 3DPUA 4RDUA 5AE2A 1AW0A 2D3OR 1YRNA 4XLAA 2Z2MA 1VQ8I 2BA9A 2DA1A 4K4VA 2L7FP 3JR9A 2L48A 3CCSS 3ZTSA 1X1DA 4FTHA 3FBIB 2F5DA 2QLFB 4CLZA 1FD2A 4R0JA 1BMQB 2CJQA 2K9LA 2PQ8A 2GXGA 2FLNA 2OD4A 3Q8RB 4UHTA 3KP5A 4Q5SF 1GXPA 2HGLA 2DHGA 2LSOA 4M5KA 2VPZB 2HYJA 2VKVA 3EUHA 1YDLA 4M9XA 4PQUA 4YOEA 3G3ZA 1OR7C 3GMGA 5LEKA 2Y8YA 3VV2B 1SFUA 3I54A 3HM5A 2CQBA 1TVRB 2XDVA 2KRBA 4CLSA 4LF9J 4HACA 2F40A 3M1VB 5E2QA 4O3PA 3KLVA 2RDJA 4JK1X 1Y1VJ 2RNGA 3KJNB 2CXEA 1BIBA 2GAGC 3DI6B 1MBEA 4DR3F 1Z67A 3SFUA 2CQ7A 2IGMA 1RZMA 4N8NA 3R7SB 4ZMMA 2XMAA 2W48A 1I5OB 4CH7A 3J7AY 1FIAA 2JLEA 3OIQA 4NOHA 1RISA 1FNMA 2XLIA 2K5CA 2W82A 3SZGA 4AIHA 3T3FA 4XQFA 4O4GA 4DG1A 4DV5J 2I9SA 4F92B 4ZPTR 1L3TA 4I99C 2K8GA 4NEZA 2OTJS 3QQCD 4F3QA 2NXNA 3CD5A 2CQNA 2MJNA 3CB4A 1X7VA 1T95A 2NXEA 2NXJA 2M4KA 3MTKA 1GMVA 3WG7H 3OL6A 4ZDLA 3FEYB 2FC8A 1ZAVA 5ETQA 5KG5A 2Y75A 4HHHA 3CTAA 1RETA 2BQUA 4PWDB 2LA4A 2DBBA 1XMOJ 2ID6A 5KFUA 1UB9A 2RAEA 3HTSB 4DBQA 1SFEA 3IWZA 1FOYA 5CVIA 4PQAA 3D68A 2FEZA 1SQEA 3OS0A 4KSEB 2VUGA 3J7YI 4IH5A 1U09A 3UI3A 3I55S 4KV8B 3FQKA 3QGPA 3OW2R 2F7VA 1BI3A 4LF4F 3K2AA 1SC4B 5LGUA 4G8XA 1S3JA 1VQYA 3OR1A 2VJJA 1RT5A 3PNYA 4Y2AA 3BBBA 4I2PA 2IYIA 2EKNA 3TWZA 1SKRA 2E71A 1A31A 2BE2A 1N6QA 1F4KA 2MQNA 2FRHA 2XAGA 1X4BA 3WGIA 1F3FA 1C0WA 3RKYA 4TN2A 4Q5VA 4RW4A 2F65A 5ETSA 1L0OC 2O03A 1HARA 4BNCA 3UCGA 3F8NA 2R4GA 1VLOA 3VAFA 1NG6A 1R31A 2D1VA 1KBRA 5HQLA 3QIPB 1HPZA 2EV5A 3TP2A 3K4JA 2HKOA 5D6GA 4KIGA 4QPQA 2B7BB 3QGHA 3TI0A 2W57A 1AUSL 1IV6A 4FF2A 4IFYB 5J8CA 1CJUA 2FVCA 1B7YB 3GX4X 1KTVA 3DKYA 5DDQC 2GV1A 3ENVA 4NRUA 2Y2ZA 4OI3A 5A8WB 2NRAC 2JH3A 3QJLA 1IXKA 4BQQA 3I64A 4URSA 1NHAA 5F8LA 1U0JA 3HMJG 3HJVA 1GT8A 4NA2A 4I6WA 4JYAJ 2E7VA 3K8WA 2CUYA 4ZVOB 4J9MA 3A8EA 3OV7A 3ZMSA 2QFIA 1CC7A 1HDDC 4K4SA 1FP1D 4YR3A 2IA2A 3NQOA 4N76A 4L0YB 4HTIA 2UXNA 4MTPA 2B0LA 4OV6A 1UFKA 2BRKA 5AT1B 3FM5A 3H5SA 3GZ5A 5M2PA 1FE0A 3ZQFA 1RA6A 3AFHA 2YH1A 2JFDA 2Z2LA 5FIIA 3TP3A 2QIFA 3WHCA 2J9DE 4DSLA 1BL0A 1ZR2A 3M7VA 1ACMB 4ANEA 4XDDA 1DPRA 5HOOA 1KU3A 2E1MB 3HYIA 3CZ6A 3RBZA 2JA8J 2LY2A 2OPQB 1LW2B 1F9FA 1I3OB 2NCKL 3KLNA 1T56A 5HLGA 1T0FC 1FT9A 3QO9B 2Y0SA 2CU7A 3UD5A 1O3RA 4CP5A 4B02A 2PMWA 3HSDA 5LRSA 2FGOA 4CNYA 1UPPA 4USKA 1TVRA 2CJXB 1RWPB 1DQ8A 4RAYA 2K9QA 2BHZA 1RT7B 4XOPA 3LSGA 3ASNH 4BDPA 5DTDA 1ELOA 3KLGB 1TK5A 4AVPA 3FFIA 2V4RA 4DL6A 2C3PA 3A8JA 2EG2A 3MPDA 2XVCA 3EGWB 1XB4A 5KFXA 1D0XA 5B0GA 3DDKA 5J1EB 3R0AA 5D5XB 1Y0HA 3W6KB 2CPZA 1S10A 1IN8A 3VOEA 4QWEA 2E5NA 1NH3A 4KHRA 4YUDA 1R00A 3U27A 1F3VA 2CQGA 3HZJA 5K8MA 2VQFJ 3R6GB 2HRTA 1XMAA 1WVRA 1VMBA 4PG4A 1S6QB 4FISA 5GPAA 5KT2A 1T39A 3JYTB 4IL6C 2VV5A 4ZYAA 3H40A 1SCJB 2DH7A 2QBYB 4LREA 3N5FA 4F25A 3BR0A 4PWDA 1P9YA 3RPUA 2DCEA 2BMBA 3TA1A 3W5YA 3CMEI 2MZTA 4EATA 3D5RC 4LG0B 3FK4A 2DB1A 4X4QA 1WDTA 3ZQCA 4DHVA 4H4KC 4DX8H 2QSWA 3BV8A 3R2DJ 1I6XA 4U8VA 3CWJA 3H25A 3NCPA 4JI0J 4LF9F 2EILH 1SMYF 2DR8A 4K4TA 3X2QH 1NO8A 1JLGB 5HNFA 2EFGA 1WDDA 2FPHX 4F3MA 1H9TA 3NGUA 2IA1A 2FJ1A 3HSRA 3CJQB 1B0TA 2Z58B 4O6JA 1RA7A 1RTHA 5HODA 3PKMA 2MHNA 3AG3H 3PJRA 5IT9Z 1NHUA 3P5TL 4PEOA 2X7IA 4FZVA 4XRMA 3WGGA 1AYEA 1HI8A 1JB0C 3OPKA 4XONA 1NPPA 4OZLA 3GR0A 4DV5F 4OYBA 4Y34A 1OY9A 3SCJE 2N7CA 2CV0A 4DQSA 3BN7A 3TO9A 3KKFA 4PFOA 3TANA 1HBOA 1TT0A 4M5DA 3RGIA 2BE7D 3VGVA 1NPKA 4AM3A 1AOYA 2HW3A 3E3XA 3J81K 1MSEC 1GT0C 4PJ0C 3SDBA 1XS9A 1V5GA 2HFZA 1ETWA 1XMOF 4V19K 4CLYA 4FCYA 1E3HA 1HFEL 2CQIA 4QWCA 4DL7A 2QENA 1IR2A 1TWCJ 5TRDA 2A6EF 2W9BA 3E7LA 4DI6A 4DQPA 3ET6A 3K1NA 3ZZYA 5ERIA 3FZ2A 4ZP9A 2VOOA 3FKIJ 5CHCB 1Y00A 1VRQC 3IRRA 3D0IE 1S6OA 3ZMZA 5E3OA 3EXCX 1I51B 1H38A 1G3YA 3FEXB 3IP4B 1T08B 4FF1A 1HBMB 4RGRA 1SIWB 1FLIA 1QZEA 3FSIA 4OX6A 1ZA1B 5HMXA 4Y15A 2ZZNA 3VF0B 3U1DA 3M6UA 4BS9A 4IO1A 2FVPA 3WU1B 2FJBB 4TKTA 4CLLA 4CNZA 4O3SA 1B0VA 2MQMA 4TU9A 3CESA 2OFGX 5F27A 2HFSA 2VHGA 3HKZD 1DTTB 5KFAA 2HDCA 4NLYA 4HF2A 5KT5A 4FYYB 2DCLA 4ZP8A 1LW2A 2H6CA 2BYVE 2KRFA 1SJ4P 4F55A 4GVLA 3M8EA 2XF7A 3WX4A 1GX5A 5F8HA 2MDAA 3KLEB 3FBNB 2RDDA 2WSFC 3H3ZA 5THWA 2AJ4A 1UHMA 1XDSA 1O6XA 2KXHA 2V2QA 2GCFA 1S0VA 2L7ZA 2XGQA 3TW0A 3TARA 5DDGA 1J7KA 1RT7A 2V6EA 4NZ0A 2V6AA 2DJNA 3LO3A 1ZM4A 3KLGA 4MQVA 1WGXA 2V8DA 3JSRA 1W0TA 5H6RA 3UR0A 3IFEA 2QJ3A 1NKEA 4JYAF 5AONA 5U47A 3QNWB 2FTRA 1RYSA 2CQKA 2ZH9A 1FWLA 2YQ0A 2VFRA 3CP2A 3JAMZ 4TLQA 1IV8A 3ZOBA 5J8FA 3BZ6A 1NUEA 4RL1A 2FQQB 4XLFA 5CYQA 4B9MA 1YHQI 1Q1KA 3N4WA 1DU6A 4L75A 2BJDA 5J1EA 4C48A 3J7A1 3IAS2 3S3NA 1U1MA 2W24A 4YB1P 2FLPA 4XOTA 2ZJ2A 2H1LA 1P7JA 2N3LA 2RVCA 1ZG3A 3GTGJ 1S57A 1ENHA 3OYKA 5J2QB 3NWRA 4JV2A 4N4NB 2N3OA 1N78A 1H2UX 2X1CA 4FXDA 4RGXA 2MKYA 1WHWA 3TQ1A 4X2BA 2QBYA 3QT7A 1ZTWA 2HQDA 2M52A 3K17A 2VDIA 2ZH3A 1JJ6C 1F5BA 2BBEA 4GC6A 2H94A 2OZUA 1Z1ZA 2VG6A 4B9NA 2X1EA 3GV7B 5DUIA 4LG0A 2RIJA 1DHMA 2HG4A 4LR9A 4XK8C 2E44A 1VQMI 1AA1B 1S1UB 5DETA 3OL8A 1WJ9A 4M8LA 3PJWA 2GZWA 3HVRA 1QAYA 2U1AA 2G7UA 2MGZB 2HBQB 1MMDA 1HI1A 2LXUA 5AE3A 4KA4A 1JLGA 4LJMA 5GAHI 3AG1H 1DY3A 4ED6A 3JTGA 1A0OB 5CXTA 3CCLS 5L3EA 2D3ZA 3CJQA 3IL2A 1FFGB 1MSWD 1DP3A 2ZSIB 2W7AA 4ECRA 2RHSB 4CYCB 3AODA 3I0TA 2V1XA 1U0HB 4ERDA 3DOMA 1VS3A 4PG8A 4HBLA 4XSZF 9ANTA 2YNIA 2O01C 1RT3A 4NLXA 1IN6A 1FRHA 1U8BA 4IOCF 1UJ6A 2X0LA 1KQSR 1NHKL 2ZMEA 2D69A 1VC0A 3S1QJ 4PKDB 5IP7J 5K5OA 4MFEA 3F56A 4NCAA 3SDGA 3PVXA 2MJUA 5FD6A 2VQFF 3HVAA 2WY8Q 3IRXB 3DEWA 2PIIA 4OQJA 3CJRA 1SIZA 1IRZA 1CC8A 2XF6A 4M73A 4KY3A 1TL3A 1WI8A 1R5GA 2OAZA 3CIZA 1R7IA 3MR5A 3W3SA 4ZTFA 1FXLA 2RREA 1JGGA 3A3OB 3P6YC 3BQ2A 2V94A 2BV6A 3CUQB 3ZN1A 2Z4PA 2VJVA 5BYSA 1D1BA 1H2TZ 1FX2A 1WG1A 2JQ7A 4Q2MA 3L9FA 4WYWA 2IS2A 4RLQA 4A0ZA 3S2WA 1RTZA 2KIUA 1N88A 4ZCMA 5KG2A 2DFFA 3ETOA 3M7GA 4DL3A 4JI0F 2RC4A 3GCMA 2EK6A 4DLEA 1TT5B 1VQ7S 2M1BA 4KYZA 3SFGA 1N0VC 2R7RA 4X4OA 3BG9A 1HBMA 2VJ5A 4G6QA 2ZOFA 2CQXA 2BJEA 1TZLA 3AFGA 3QBCA 4LVOP 4X84A 4AXJA 2EV6A 2WONA 5FLXU 4KIBA 5HVQC 3QWLA 1VQSA 4ALZA 4JBAA 1R8PA 3TA0A 2QUFA 1Q8KA 1WNEA 3J7AN 4HA8A 3DNCA 3KLIB 2XQCA 4ZJQA 1FMWA 2CA9A 4ZC3A 2DLLA 3BT9A 4BDYA 2ZUGA 2QMUB 3NAIA 4BC9A 2WA0A 3W9IA 5J2NB 1A6LA 2HBYB 3QYYA 2XGCA 4XICA 5JVHQ 5J2MA 2MBFA 4WKYA 2UXBJ 4F0KA 1JLEB 3KLEA 2EC0A 3S15J 5HLHA 3MD3A 4M5JA 4QWAA 1OCTC 3CCVI 1FXRA 1HWLA 1VBKA 2OUGA 1RUNA 3L09A 4EJTA 3KOAA 4WE1B 4WTOB 3MMYB 3PTWA 4O5VA 4AYBD 1FHTA 2XGXA 3FXMA 4IOBA 4C2UA 2OPRB 1JWWA 1FCAA 1E17A 4BUPA 1Q16B 2C3MA 4UQTA 3C7JA 1UMQA 1T9YA 3GO5A 4RW6B 4FXVA 2JC1A 2Q1LA 4NLRA 2W1OA 4P10A 1SAXA 1RPWA 1K44A 4DX6A 1JLAA 1MH3A 4M6YA 2HVRA 1KONA 4CQ1A 2XPWA 2K2PA 2HKEA 4FDFA 1R23A 3OYEA 2EB7A 1YO5C 4AL7A 2C2RA 4NA3A 1XC5A 5J2QA 3I0RB 2LLKA 3WODF 2M7BA 2DGOA 4C98A 2K3PA 1K0TA 4PPZA 3BBFA 4XTTA 1RTJB 4USVA 2Z9OA 5I3QA 3FZVA 4E7KA 1UCRA 1CQTA 3GPAA 3C1DA 1JHHA 1REVB 3KEQA 3J80U 4OHVA 4ESFA 2KIFA 2WHOA 3KHHA 1S7EA 4M6XA 2MQOA 2VPLA 5H9EJ 2V6CA 1A9NB 3O3KA 4LF8J 2FZKB 4XSXF 2X51A 1EARA 3CE8A 3DGPB 1HNVB 2VKZG 5KFHA 4RW9B 4CZCA 4ZP7A 2DT6A 1F0XA 2IA6A 1PGZA 1Z77A 3GTLJ 1W2BR 3CCRS 1U1OA 3CCJI 4O44A 1FZPB 4WIIA 1M1GA 2B6AA 1U0HA 5JI6A 1TW2A 3SSRA 1FRLA 2NREA 3JXOA 2V68A 2LU2A 1BWEA 4GVBB 3IWFA 4W97A 3S1TA 2K86A 5J6XA 1SH0A 2M7SA 5B1AH 4FF3A 3PEJA 3CCQI 2OTLI 1LEBA 4G7OF 3P8BB 1RAEB 4EJWA 3F8MA 3CDLA 4DF4A 4M74A 4JI4J 5E3LA 4OYIA 4FX4A 5KCMA 4E7JA 2XY6A 1QD1A 3C3LA 5E3CA 2IRFG 3AB2B 2W4SA 5FLMJ 1FJLA 4LRAA 4EO8A 3UCZP 2BJ7A 3FRZA 2WADA 3H5RA 3MEGB 3JTNA 3HKZN 4K2XA 1MNMC 4J90A 4P74A 2CQ1A 1UJ5A 4BJ5C 4QTRA 5HS9A 1I3QJ 1SD5A 3KEYA 2DFIA 5AXNA 4RBOA 1N33J 3EJMA 2B4VA 4DDFA 2IPQX 2IVFB 1UFWA 5IV4A 1FI4A 2V0NA 3NMAA 4HX8A 3WE3A 2L9RA 2XSDC 3NG8A 4II2A 2E9RX 4GKJJ 1P4WA 2ZE2A 3JRFA 3KK1B 2DTJA 2FHKA 2NS7A 1GVJA 1JLQB 2DO4A 3IRQA 3TA2A 4DR5J 4UV8A 3GLXA 4C8OA 1NNDA 3PRDA 2XM3A 1P2FA 4M63A 3S6EA 2XB5A 1NU4A 3ILOA 2XEXA 1K79A 1FC3A 3DWLE 2GMJA 3ZMDA 5DZ7A 4BHBA 1ULRA 2NSBA 5J2NA 2LKPA 2DU9A 4U7BA 3BN4A 2HNHA 5C42A 1DPUA 1Y0NA 4FVMA 1UPMB 1TC3C 3I0SB 2XMTA 4C3KA 5B0DA 1UP1A 2Q1ZB 1TL7A 2DA5A 4XO0A 2KKHA 3OMYA 3I9V2 1ETVA 4EGYA 3TX0A 3PV8A 3MAAA 1KQ9A 4CI0B 1HR0J 2H09A 4PFPA 4CO5A 2BW3A 2CSOA 2JJ4D 4KGKA 4IVNA 3KUGA 1X4GA 2ISZA 2XYHB 1T3NA 3G6YA 1MIJA 3D54A 3GV8B 2JT1A 1I6JA 1D8ZA 4NPOA 1DTQB 4RAFA 2HYIB 4PSWA 2O5RA 5KVRA 4RW6A 1OY8A 3SBMA 3KMSA 3T5JA 3CO9A 3AG2H 3B4MA 3AAFA 1TWGJ 3TO8A 2CG4A 3FMWA 3OYJA 4DSKA 4CCJA 3BDEA 4H4OB 3IR5B 2WY7Q 3G71S 2WVEA 1FDNA 1MU2B 3HT0A 1YITS 4BDZA 3EX7B 3MKWB 1XCVA 3I0RA 4J9OA 3JRCA 4DGWB 1AU7A 2IHR1 5FKOA 1FY7A 1VBXA 2XGEA 3VR1A 1WF0A 4DV4J 3DEEA 1MD0A 1A5JA 4Q8FA 1QPMA 2CZVC 4AFFA 1XR7A 3MN2A 3H5YA 2R2TA 4OZNA 3OYBA 2UXBF 3Q83A 2IT0A 3R0JA 1FNXH 5KG3A 1O3QA 1XMBA 1RNLA 1S5LC 5CYJA 1BR2A 2Z1DA 2VPXB 3N6NA 1UG0A 4BJTA 1YI2I 2Z2YB 3QATA 4OHYA 3CPWR 2AGOA 3ITHB 1MJ9A 2HNDB 3D3CJ 2ROGA 2HFUA 3H7HB 4CYUB 2MHEA 3BCBA 2HXIA 4BEHB 3V81A 3RU0A 4I7FB 3CJ5A 3WTTC 5EX3A 2P7CB 5DQGA 2V79A 3NARA 3QYBA 1VIOA 4GVBA 3HOVJ 1Y8QB 4YFNF 3RR7A 3GIKA 2H5JB 3S1MJ 3RW7A 3NLCA 2GVZA 3VWSA 1NXIA 3FZBA 1B59A 5LSLA 2OQRA 2XAHA 5D0RA 3PW7A 4EEYA 4ZHRB 1NMEB 4OL8A 5B3SH 3IH2A 3H5NA 2HVHA 2LD5A 5EZHA 1RKJA 4LSNB 2H5EA 2VA3A 2NVUB 3HVWA 3M9OB 3OIOA 3JRDA 5E8GA 5JFRA 1QSLA 2ZXIA 4IO9F 4CCOA 5BR8J 5DM6Q 3OLAA 1QQIA 1PYSB 3O8GA 1PIEA 1A6QA 2KLOA 4Y2IA 4CXFA 2DA2A 3GZ6A 2CADA 4HHJA 4PXEA 3RJPA 4K4WA 1DFDA 1DURA 3LAMA 4C9DA 2MEWA 3RBXA 2DQRA 3HSZA 3JSMB 2VIXA 3K59A 5TISC 1A6IA 5K14B 2O67A 4NNJA 3EVWA 5LMUF 4GGGA 3W63A 5EYRA 1UEVA 1U9OA 4LF8F 5DM6F 3FQLA 3WHIA 1N5VA 4N4OB 1MBJA 4NZ7A 4L18B 2DNQA 4YELA 4AYBN 1PC5A 4ZKAA 1X4OA 1JLQA 2QGFB 3DRYA 2DPJA 5FO5A 3D2WA 1IN0A 4ZA1A 1K83J 2IFXA 3ILLA 1GXTA 2LQ9A 3ZXSA 1B72A 3MAHA 1NZ8A 2OH2A 4WX9A 4IH7A 3JRHA 1W7PD 3C46A 2BY3A 2L4MA 2GO9A 3IWXA 3WTWC 2BEFA 4JI4F 2RSQA 2PMHA 2P81A 4L74A 4IKFA 1RAIB 2V69A 3I0SA 3OR1C 3SXYA 1WRJA 4DV2J 2YPRA 2DXFA 4Z7CA 3R60A 5M5YJ 3CD6I 2HWIA 1C0TA 2PEXA 2PG4A 2IS6A 4FXWA 4WYLA 3FWEA 2HOEA 5ILUA 5IFMA 2PEBA 2H51B 1S6UA 3DPTA 3QLHB 3AA8A 1MSFC 2I5JA 3OD2A 4P1WA 1NJXA 2VE9A 4LRDA 3C16B 3MECB 1KD1T 2B4OA 4ZCKA 1N33F 3W2WB 4LIWA 4F04B 1CJTB 3BR1A 1VQKI 5JVTA 4FN5A 4Z2XA 2MG4A 2LDUA 5GAGU 3HKZA 2M45A 3EQLF 3ZQGA 2JEGA 1OO0B 1EKRA 4GKJF 4F2RA 3DHXA 2IC3A 2HKXA 2W4PA 1MU2A 1YX2A 5SUHA 3MXHP 3IA0A 4DR5F 5BJRA 3M8PB 2YKNB 3AHPA 3P5BP 2VG7B 3PNVA 4C3HJ 5BOXA 3F23A 1XJWB 1FF2A 4K2EA 3I4PA 1JKPC 1HA1A 3BWGA 5FDLA 5IC4B 4CLFA 4KNYA 1H74A 2NVYJ 3CCSI 2DGUA 1FSEA 3A01B 2YQ3A 1LJ9A 2JZ5A 5ICGA 3SI8A 3AJ2A 3OFHA 4RGSA 1EP4B 2VG5B 1H89C 4U7UK 5I3PA 1UKUA 3RTRA 5IC6B 1RT2B 2EBGA 2BOPA 3UDEA 1JTYA 1HR0F 3VPRA 2L08A 1KYZA 4N47A 4KHPJ 5L3BA 1MDMA 3O2IA 4WZMA 3F9KA 1U1QA 5IOZA 1HW9A 1HWKA 3F6OA 3MM6B 3PY8A 1Y0UA 1SFOJ 4A0YA 3A4CA 2Z0GA 2GA2A 1YW9A 4CHUA 3ISZA 1WWHA 2XMJA 5IYCJ 3GJRB 3ELKA 1SPBP 3T5XA 5F8JA 4V2GA 4ZHRA 2OTJI 3V6HA 1WEYA 2MPUA 3M6XA 2IYGA 3T9NA 1EH6A 3HM9A 4LSNA 4A8QA 3BQ1A 4ENMA 1UJ4A 4DV4F 3OLBA 3CTRA 3F0NA 5DJBA 2FMYA 1P6TA 1VRTB 1FRXA 2V8HA 4UY8T 3H8YA 4Y13A 3SSQA 2ZD1B 4L72B 2IM2A 3K4KA 3PR4A 2BEOA 1D5YA 1NH7A 1J2XA 3E51A 5T7LA 2HYGD 2IDEA 1RACB 5RUBA 3JSMA 1XPXA 2ZJQQ 4G6TB 5K14A 5ETPA 3QSYB 2WV1A 2DITA 2JRSA 2CRLA 2OELA 3DRPA 1Y6IA 5JVGQ 2MD5A 1N48A 4NLOA 3I55I 2ZJPQ 2IBDA 2Y48A 3A02A 4YIFA 2MLYA 2DISA 4R1HA 2L7MP 4DL5A 4CO1A 2HQGA 5GMEA 3MKZA 1RTIA 4QPXA 5GTHC 1Y56A 2MYFA 3HP6A 1DQ9A 3H4BA 3CDAA 2QLWA 2YKOA 1U25A 3EXYA 5LHHA 3CMAS 2YX4A 3OS1A 3MD2A 3P96A 4YB5A 3P7NA 1NSQA 2OJED 2ZJPF 2Z3YA 4KT0C 3NGDA 4ZYEA 1IM6A 2HAFA 4OIQF 2F48A 3M9AA 4XNFA 1FK9A 1WORA 5KFYA 5BR8F 2YNGA 3LF0A 3P9IA 3F22A 4P9SA 4GO1A 3Q8UA 3BGRA 2L9DA 2VQCA 2O9LA 3QLHA 3JREA 3C15B 3PUBA 3HGGA 2E29A 3CEDA 5HS8A 2G0IA 1Q7LB 4AIJA 4DCOB 2AKWB 2IM0A 5KFBA 5FKMA 1DAXA 4XDCA 2HWTA 5KFJA 5J40A 1V5EA 4AL6A 3GFMA 1R3NA 2F9JA 4C2MJ 3GYNA 1EX8A 4M3GA 2APOA 3EZUA 1BWVA 3GWCA 1T9TA 2YVSA 5LSRA 2G9WA 2GO8A 2NSCA 3C66A 3BQZA 4A5MA 2CPYA 4ES3A 1E3PA 1G3OA 3MWBA 1KOOA 2VG7A 5FLXY 2JUCA 2IPOB 4WZQA 4URQU 2JEIA 3QT6A 3BR2A 1AWCA 4AYBA 4FS1A 4Y28C 2QFJA 3A13A 2IGOA 1X60A 2DJWA 2H27A 2YWFA 1OQYA 1PUEE 2J0QD 3CULA 1MZBA 2X6YA 5GADU 4V19J 4QZVB 1IBLJ 2JA2A 3EUAA 1IWGA 4DV2F 1YBAA 1OLTA 1J9IA 1K1QA 4CO4A 5HQMA 3HSEA 4F4XA 3HOUJ 2ZFWA 1AKHB 4PJLA 1FOWA 4ZITA 3JTPA 1RSCA 2B4PA 3V6DA 2J8AA 1D8KA 2ZH8A 3NEKA 2HHPA 5DGAA 3MPVA 2G7HA 3M4XA 3HRMA 3CCUS 4EBEA 3ZP5A 1HNXJ 4IHYA 2AWZA 1X4EA 5HVGA 4X4PA 1XK8A 1OR7A 1SBRA 2CJ9A 1K47A 3MMJA 3T41A 4YIIA 4OX8A 1BI0A 4ZPDA 1HNZJ 4B8XA 2OPPA 3EUNA 3VDXA 2DH8A 1FDBA 2FJEB 1X1PA 2DTZA 1D1UA 1WHXA 3H9QA 1GMUA 4U8YA 4YEAA 4OI2A 2DRAA 1BIAA 2HS0A 2JSCA 5J1YA 4FF4A 5LXYA 4IKAA 2VF3A 3S17J 1ZZFA 5HLFB 2E2JJ 2RB7A 1O51A 4PK4A 1RWUA 2AJFE 2UZKA 1JKOC 1RZ4A 2X85A 2IRUA 1OIAA 4DYQA 5HDKA 2RT3A 1SJ1A 4C3MA 2ZD1A 2D45A 1PILA 5SZTA 3MEEA 2DEIA 2ZC4A 2JUGA 4HDHA 4DSJA 2CRGA 2EK1A 3BO2A 4KDPA 1RKIA 2QC3A 5D77A 1RT1A 3J80Y 2NPFA 4BBRJ 3M1CA 5TJJA 2HOSA 4DUYJ 2PLYA 4P73A 4IDKB 1O4XA 3NOGA 2WB4A 3IHUA 2WOMB 3OVAA 4KHPF 2P2CB 3HVTA 1EF4A 4MKBA 3OJSA 2O7OA 3H35A 1O8BA 3QAUA 4JI5J 2FJXA 1U1KA 4J9SA 2KFNA 3C14A 2IM1A 3Q8YA 2ZBKA 4ES2A 3D6MB 4OJHA 4DSEA 1RAOA 1GV5A 1HKTA 3ICLA 1TKXB 4YB6A 5L1IA 4KAIA 3F72A 4L6V3 4DV1J 4YRVA 1FJCA 3V42A 4USHA 4HVZA 4IG3B 3ZTPA 2DMNA 5E3NA 3X1LB 1GXUA 4DCPB 1M1HA 1X0FA 4K0KJ 1Q1HA 2YPYA 3M8ZA 2ZM6J 1QZYA 4OZ1A 4RW7B 2WRMA 1CS4A 2MZJA 2VI6A 1R9TJ 4P7VA 4V19X 3DLLQ 2ZH2A 2UV8G 1X1BA 1NKCA 3K5MA 1R5ID 1YWXA 4GRIA 1WOSA 3QFHA 4DN9A 1NK0A 2KFZA 1YE9A 1M5PC 2BVZA 4NCGB 5ETNA 2GJ2A 4ZJLA 2XCPA 2FQ3A 4XMYA 3GTPJ 2OUMA 4Q7AA 1BQMA 5KT6A 2ZKZA 1W7PB 2DGXA 2RU9A 1CJVB 2QSFA 2RNEA 2M0MA 1SFKA 1WZ2A 1RT6B 3N0VA 3W2VB 2E66A 2X3GA 1N0UA 2KJBA 3ZTQA 2YQ1A 4PZVA 2HK2A 5CD4A 2K7JA 1S0OA 2ZXHA 3SXLA 4X66J 5EJCA 3KJFB 3KK3A 4ZPVR 5F9NA 3CF5Q 3QU3A 1MMAA 1CQNA 1BJAA 3EVOA 1OMIA 3MEDA 2EFPA 2K27A 3DLKA 3W9HA 2YPZA 3HHKA 3J81U 4ED1A 4FYXB 4MFBA 1AFJA 4A8KA 1NBEB 3MD1A 3QQAA 3VVUA 5M5XJ 1DZ5A 2BXYA 3NMRA 4DZJA 3JTHA 1PBAA 5J1PA 4IRKA 2WVDA 2K4JA 1QHHD 2GZOA 1WFXA 4Y0FA 5HNHA 1DP7P 2TRTA 5LGTA 1TZ0A 3LOCA 2CPEA 2C6YA 1PAEX 3U02A 1N32F 1E2XA 2CG8A 4IZZA 2WSEC 3H9GA 2QQAA 1FWKA 2EZHA 1I1GA 5KFVA 3U1NA 1LWEB 1MWQA 4WWSA 2OLWA 2JRMA 4YN3B 1YFHA 2DEJA 1AUDA 1VQPS 2MC4A 3Q0VA 2DPDA 3Q9VA 4ENNA 4EM1A 2J7KA 2QF7A 4CLPA 2QLJB 4BWJA 5KFEA 3HG9A 2HS4A 2FU4A 3ZNJ1 4ZH4F 4TXSA 2FJVA 1NG7A 4KRWA 2X4HA 4NMXA 5E3RA 4IG0B 5HANA 3KG0A 2R3SA 1HW2A 1V5IB 4ED7A 1R7JA 3NRBA 2Q43A 1FJ7A 4JBCA 3EDQB 2MSTA 3W2AA 8AT1B 5DCMB 1PVEA 5HLFA 4EJVA 2R42A 3CLQA 1S9GA 1Y5NB 3T1AA 2J0WA 3K7RA 1ETQA 1FRIA 4U7CA 5CJ9A 4E6KG 3KNGA 4B4CA 1OY6A 1U5TC 1OPZA 1SKWA 1WKMA 1KKHA 3WTZA 2QA1A 3QWUA 3WGHA 4AD6A 1WSRA 4BYYA 5E20A 1U24A 4LK1F 2V9WA 4ED3A 2RVJA 1ZHFA 4P55A 3B02A 2NNYA 2L3MA 2AX1A 2RUSA 3M2VB 2LNBA 2GOMA 4LSZB 4WJBA 1YHQS 1IWAA 4IDKA 5A8RA 2WOMA 3CT9A 3FHZA 3JQJA 1JJ4A 2QL9B 2BBYA 2VT3A 4ZVPB 1KLMB 4ESJA 3BG7A 2ASJA 5GAEJ 3OFGA 2ZEJA 2VFSA 4J00A 3N97A 2V67A 3CCLI 4H4KA 3CC4S 1QVTA 1HNZF 2RDIA 3ZZOA 3E5QA 2F5FA 2KM8C 3KJQB 5D6EA 4XPCA 3KG4A 1XGOA 3BTJA 1TKXA 2MKSA 4PR6A 3MQ0A 3QP5A 4GMKA 5EDNA 2DQLA 3DOLA 1S12A 3IR6B 2KYXA 4DIQA 4PWWA 5DGBA 3ERMA 3HHLD 3THVA 1NK4A 3S2HJ 4DL2A 2E35A 1OKRA 4BC7A 1VYAA 4ID5A 4RW7A 1T02A 2HHSA 2KP6A 4AT1B 2CNNB 2BW2A 1MW7A 2DGVA 5D4LA 2VXDA 2V8PA 4NLGA 4RNNA 4U96A 4W1UA 1JXVA 2VJ4A 4O3NA 3L1PA 4XLCA 2XROA 5ETRA 2CIMA 3HHNB 4KJIA 5HQ8A 2DHSA 3NCRA 3D67A 3E6CC 1TAQA 2CV1A 2XMMA 2GIQA 4DZDA 2UUBJ 3OTOJ 4B3AA 3PM1A 3KYLA 3MCZA 4BXFA 4DUYF 5LL6d 2AGQA 2MKHA 2MLZA 1H2VZ 1D0ZA 3KP6A 4OYWA 1W7PA 3NNHA 5JUMA 3G86A 5B5EC 1M5KC 1PYTA 3NS7B 1VQ7I 1K6YA 1UMJA 2MW8A 4KGMA 3MUMP 4JI5F 2BX6A 2P8TA 3A12A 1S8NA 1CEZA 5B0BA 4I0WA 4ZVTB 4NLVA 5I4MA 2WBRA 1ETOA 4QIVA 3WZ0A 2RS2A 3VYSB 4I01A 4DV1F 3K57A 1ZA2B 1OFCX 2XHWA 3L4BC 1CULA 1CGPA 2A3JA 2HBRB 1HXDA 1XERA 3FBEA 2ECBA 2B8QA 1HQUB 4JOUA 2HHQA 2HFOA 3SCLE 9RUBA 3KHGA 2ETHA 2I6WA 1JJ2R 4BQNA 4K0KF 4OJ1A 2HVZA 1IDYA 3NS5A 2ZM6F 1JNRB 4ECZA 2EKYA 4QR1A 1OMSA 2J76E 3VVTA 1J09A 1Q4RA 3CC2I 3P49B 3OYMA 4CM0A 3ETMA 3NGKA 1T7PA 5DEQA 1O0PA 4C8NA 2EIJH 4OI6A 3RKXA 3UCUP 5KFTA 1XMXA 4CCLA 1JUPA 3I59B 3V7CA 4GC7A 3R4KA 2KHMA 3V7RA 5L8RC 1U8SA 4J9KA 1FNNA 3LAJA 4FX0A 2V2ZA 3T1HJ 4OU0A 2HGCA 3PX4A 4R8HA 2V9KA 5FKKA 2BHYA 1S48A 1YIOA 1G3SA 3ZXWA 4PRFA 1FSHA 2HVEA 4W90B 3N4MA 3G96A 3DLHA 2PFDA 1KQFB 3AA9A 3PNTA 4O23A 2J8SA 4X66F 3PQJA 5IY5H 2QE5A 2BJ3A 3K1PA 2VFVA 3TX8A 3KETA 3O1LA 3BP8A 4ZDOA 1KGSA 1EHWA 2AMCB 1HDPA 2FVQA 4E4HA 3ILJA 4A6DA 1FEXA 2PX9A 2DYAA 3GYHX 2KZMA 5F64A 2XKOA 2MZQA 5EEGA 1YSJA 1HMVA 4TYAA 2A07F 1YJNS 3IS9A 1LFWA 4Q0BA 1K4TA 1WCMJ 1KS2A 3TVKA 3OTBA 4JP8A 2HTSA 2W7OA 2IGKA 4GYIA 4JI7J 1Q8IA 1NCLA 5IQQA 3M2VA 2DN0A 2ZDPA 1X3UA 1ITYA 4IHSA 4ZVGA 2W8LA 3WX8A 3LSIA 3EYIA 1Z2ZA 4BE1A 2O0YA 3WU2C 5IT9K 2W4CA 2B43A 1S7OA 2YY3A 2IS1A 1S7HA 4FBTA 1HD0A 1RHMB 3FDYA 2EFOA 4HLYA 3PFYA 4KT6A 5ITHA 1MNDA 1CQMA 1JLBA 3TBIA 4JI6J 2DR7A 1R1UA 3KIOA 3RQ4A 1K4SA 3BCAA 3ECHA 2LC2A 1RRJA 2J6SA 3HPOA 2ILYA 3MZ8A 4ZZLA 2G1HA 5C2GA 1XN7A 4MIBA 3GF2A 2QV6A 3FBFA 5D3GA 3LSTA 3CCRI 1USTA 1MJAA 3OV8A 1XSDA 2VZ9A 2W9CB 2MY7A 4IR9A 2FHJD 4V1Ak 2OCCH 3I53A 2J9DA 2FZCB 4B3OA 2M88A 2QZ8A 4WXWA 5E1WA 3F73A 3Q86A 1HNWJ 4YFKF 1RBLA 2RNJA 1YRUA 3FHNA 2OPSA 2HRYA 4DXLA 1MLAA 3U21A 3UO0A 3HKWA 5KOWA 2R5ZB 4FETA 2MKCA 2F1FA 3CW2C 3IR7B 4FE4A 4Y4RA 4B9UA 3PR5B 4A3GJ 3KJVB 3TAPA 2M2EA 5C4JJ 3P3DA 2JWTA 2DYRH 5FROA 1ODDA 1WI9A 2ROEA 2LQBA 1RWWB 1Q7YT 3UFCX 3T19A 1PAUB 1XMQJ 4KB7A 4ZPBA 3PW0A 3FMSA 2B56A 2V8GA 3DLEA 3KK2B 2CQ4A 2VKRA 5A76A 5E33A 2DY9A 4JI2J 2EFVA 5KG6A 4LMYA 2QLXA 4XKBA 1K73T 3LP2B 4NMLA 5E3QA 3C6UB 4HEA9 3GE9A 2AJQA 4G1PA 3MKLA 3CJ0A 2R8KA 3LSPA 3KUHA 1XR5A 3IUOA 1QDUB 1G2EA 1P1TA 1B6AA 3HDSA 1IAWA 4I2OA 4NC7A 3Q2SC 2G4BA 1M5SA 5I3UB 2ZB9A 1H6KX 4I02A 2BACA 1G7CB 2JA7J 3C3WA 2DNRA 3SEOA 1R43A 1MN9A 3KP3A 1WELA 2NLWA 1TAUA 4QJVA 2BV3A 2HR3A 3N05A 3HXMA 3ML6A 2RAQA 4DPUA 3T0YA 4ETZA 4O0NA 3JAMK 4HH0A 4NZ6A 3PW5A 3AD9C 1TQMA 3UNYA 1IF1A 5C7PA 3ZMUA 2UUBF 3OTOF 1K8AT 3E3VA 1FBQA 1MN7A 1PO6A 2HMIB 3PEHA 3PYEA 2HHVA 5E5NA 4LT6A 2EPIA 4UF4A 1W7WA 1Z6TA 1A36A 3DM2A 2JDJA 3QT8A 2NVQJ 5E3PA 2QTWA 1TU0B 1IVZA 2F4MB 3BS9A 2KT5A 4U88A 1H7WA 2HBZB 1OWXA 2MLKA 4J9LA 4MHGA 5CCLA 1NK7A 2PMZD 1F5TA 5AXKA 1SVLA 3RKQA 3PIOQ 2EIMH 1UVMA 1YITI 1FMVA 4O3OA 2ZO4A 1HWUA 2DA4A 3TJ9A 1F1ZA 1FOXA 1XBWA 1SMTA 3FMBA 3UNGC 1FJGJ 4KMFA 4UY8I 4QBUA 3CO6C 2N4CA 3IG1B 1TUVA 1ZRCA 3KNAA 2ALYB 1Y5LB 2EQRA 2X6XA 4ILRA 1SV5A 3BY6A 1RHQB 2XPVA 2FJDB 2H8WA 2NZCA 3UR3C 1SFXA 3I56S 2M34A 4C0OC 2DRDA 1X3WB 4EGLA 2LF7A 4HNTA 1GQEA 4LR7A 3H36A 4RGUA 2RQ4A 1B7FA 3W7BA 4UXNA 2XYGB 4OYMA 2YWHA 4LSLA 3K4CA 4DQQA 1S76D 5EGOA 5LBQA 1YIJI 1T2KA 3K89A 3H92A 4M6VA 2KRHA 3T1HF 3PFIA 8ATCB 3DTIA 2GXAA 4EM2A 2LKZA 2MH9A 4IHXA 5IOYA 4UVAA 3D5SC 1WF1A 3E8OA 1BW6A 2UUZA 2R2RA 4EZ9A 4ZVEA 2OD5A 2W9CA 3VFZA 3I58A 3K4BA 3ISPA 3CJ3A 1TBXA 4JP0A 2CNOB 2FOWA 5BYQA 2JVOA 4KGVB 1EH8A 2CV2A 2BXJA 1T98A 1HKAA 4PQUB 2I0XA 4N77A 2M5WA 1PUFA 4KE5A 3FUYA 4HNVA 3NKYA 2OEKA 3M9MB 2XO7A 4DYCA 1OQ3A 1SXLA 3NBPA 3H1CA 4RBVA 2VASA 2FY8A 5F8IA 4G7HF 2WV0A 4HACB 4JI7F 3VAKA 3BEGB 1FRMA 1GEHA 3J7AO 2CVIA 2YWWA 2Q6BA 4A5NA 2OSRA 4OIOF 1JUSA 2P7VB 2NAZA 2XPUA 2AYMA 5J47A 4BXUA 3TRGA 1QTNB 4AIKA 2W25A 4JI6F 3KK2A 1HI0P 4NXNJ 2FBIA 5EF6A 1B4AA 4CUGA 3BJYA 1KHVA 3DTKA 2NXNB 5KAFC 4S04A 3LP2A 2YKMA 1WJDA 3C6UA 3H0PA 4HHUA 2EZIA 4UNOA 2DO0A 3V6JA 4PYAA 3AD7C 3M07A 2R7ZJ 5GMDA 1YTYA 1IN7A 3UD4P 1WG4A 1TTYA 2JJ7A 4P7TA 1VQ9S 1V55H 3D6HB 5E18F 5GAGI 1HNWF 1JTXA 4RUHA 5I3UA 4OYPA 1KC8T 2UUTA 4OYXA 3CD0A 3CDBA 3L9ZA 4J9UE 2Q6CA 1RU1A 1F5CA 2YWKA 2UUWA 7FD1A 4DQ2A 1FJEB 4J19A 3LA2A 4M3DA 2R2UA 4CO2A 2HMIA 3FMQA 1NJYA 3MR6A 5EGYA 4HSRA 4CT8A 2BGCA 3KE2A 2WW4A 3OR1B 1H3DA 1RT5B 4WXCA 5AXLA 1FXDA 2H54B 3GFJA 3E6BA 4I2PB 3Q23A 1VTNC 1XMQF 5DD8A 4YG2F 2BUNA 2XHCA 4OJGA 3LGNA 4A46A 3PSFA 2BE2B 1MG7A 1N6QB 2IJLA 1NZAA 3EDPA 1B9NA 4JI2F 3OQ2A 1IC8A 1F9EB 2EV0A 2Y0SN 1QVUA 4HSTA 3CO0P 3J7YU 4U7DA 3PW4A 1POGA 3TZYA 1BQNA 2QG9B 1S1WA 2E5ZA 2F4VJ 2HU9A 4ZYHA 3HHDA 5ICCA 2GVDA 1HPZB 4MMOA 3BM7A 3OYDA 1SI9A 1I50J 4TY9A 3A03A 2M87A 3A0BC 3ZQHA 3BR5A 3J81Y 1CJUB 1TWAJ 2Q0OA 3IG1A 1D0EA 2GBYA 5DYMA 3TUJC 3TL4X 2X1BA 5KAIC 1RLDA 2OQGA 2PO4A 3D66A 3HJEA 3AY0A 1UVLA 1VQKS 3KG1A 2LU1A 4TU7A 5C24B 2AJ0A 1KN6A 1RR7A 2F4IA 1Z7LA 3FF5A 1SQGA 3KCCA 1YBUA 4GFBA 5HP1B 2XASA 4BQAA 4C8ZA 2EWHA 4DSFA 1B9MA 4U6PA 2B51A 3IMQJ 4A12A 1IN5A 1QVFR 4D0PA 4HW0A 1UCNA 1P6RA 4NEYA 2DOFA 4TV7A 4D3HA 1ULYA 3EYZA 3Q22A 4II3A 5D6FA 5KHDA 2LOOA 3Q8VA 1DGWY 2KB2A 3NRVA 2H65B 5EEHA 3RRGA 4F91B 3TZXA 3KZIC 1SB6A 3MMAB 4AWXB 4N0BA 4G3IA 4HL9A 2XS5A 4ECQA 4MQ9F 4E7SA 2C42A 3KXDA 2VQEF 3LSKA 3PNIA 4J37A 3FK6A 4UOFA 2QMWA 4IFVB 1G2HA 2QKMB 1N5YB 3SCKE 4LBPA 3RAXA 3C6TB 2JA6J 2H48B 3OL7A 4ECUA 4EJUA 4NC6A 4P2MA 1W4MA 4E8UA 3PUFA 3UDCA 3B78A 4LIRA 1FJGF 3F8CA 1B70B 1U78A 3PO2J 3LP0B 2FD5A 2HRUA 4ZYGA 2VBXA 2LBFA 4X64J 4I0BA 4HF1A 4C8LA 3Q8SB 2V4JC 3HOSA 2DIVA 1FX7A 2QEXS 1Y10A 5K5MA 1BN5A 4IQJA 3IP0A 1IKVA 3BR9A 3ZMTA 2NYHA 3Q0AA 3TZZA 3FFIB 1S97A 3DYAB 3TYTA 3RZOJ 3CGIA 3VSKA 1XTZA 2XB0X 3LOUA 1AZSB 4BU2A 1LVKA 2M7AA 3MR2A 2HEOA 3OXGA 3ENAA 3HHLA 4X4VA 3M2RA 4UTGA 4HT7A 2CWKA 2IBOA 1Y7PA 2E1NA 4USTA 5GPCA 1DLOB 3KPHA 4I68A 2G0JA 4ANDA 3OS2A 3U1LA 3OYAA 3ONQA 4X65J 4MNUA 1LWFA 1OCPA 3CCES 3KDNA 2Y9ZA 3B6AA 3P9KA 2A6HF 1D1CA 4XKCA 1CF7B 2OD6A 3OXFA 4C11A 3GU0A 3DRSB 3NGSA 2UV8A 4HQEA 3Q0WA 1GFWB 1H0HB 4N8OA 2PMZN 3OTDA 1IW7F 4M72A 3CMAI 3FVYA 3NEUA 5KT7A 2W84A 3FCVA 1FWPA 3GTKJ 2JPCA 1NKBA 1SEUA 3MM7B 1FA0A 3UPFA 3OOUA 3HOYJ 4N41A 2ASLA 1Z1DA 3R5BA 2OC6A 4C3JJ 1YLFA 2FNAA 1OCZH 4HLXA 1DRZA 2CW0F 2VL8A 2NS1B 3NWGA 1RBOB 4A4JA 3JSYA 2EIKH 4D9JA 3KYDB 1EIYB 1OQ6A 1L3UA 3SYTA 2YNFA 3DBLB 3GB0A 3RDIA 4TYBA 4ED5A 3G1OA 1ZREA 3M8RA 1HNIA 4NLSA 1RTHB 1D9AA 4RO0A 4WFNQ 4Y65A 3VAIA 3I5CA 3HXLA 3ISNC 1HQEA 1VDHA 2KRRA 5LMNJ 1HBXG 1D9FA 5K1YA 2W00A 3GCXP 1RJJA 3ZZ0A 3TEHB 3OR2C 2NQPA 3MEKA 3OYCA 1H9GA 2NR0A 5J1NA 1N54B 4NXNF 3R5AA 2VODA 1MBHA 5JLWA 3BJ6A 1RHUB 3F6VA 3RPQA 1WJCA 2KTQA 4L3NA 1Y39A 5HSPA 3OHBA 1IBKJ 4B3TJ 2HHWA 3NS6A 2BY2A 1UAAA 4UOGA 1HBOB 4CLKA 5GAHJ 5JMNA 4ZVQB 4Q4ZF 4M5DB 1X2NA 2FDNA 3RB6A 2JMWA 1WJEA 3ZO7A 1C4AA 3MFIA 4EUVA 3SCIE 3MVPA 1K78B 2JPBA 4Q48A 3H90A 3AJ1A 1SD6A 2DNMA 1F1BB 1D1AA 2XWYA 5B0FA 3CMMA 2XC9A 2ZJRF 1APSA 2R7OA 2W9BB 2E5JA 3R61A 3ET6B 5DDPC 5C24A 3TJ8A 1GUUA 1FE4A 1S4EA 5F0FA 4OIPF 5HP1A 2GNKA 3PHEA 4BY1J 2C2OB 5ETTA 2FQ4A 3QRPA 3GJSB 1NK9A 4CYDA 3V5RA 4Y2KA 3Q2TC 4NLWA 4RUBA 3CCUI 2BRLA 2XV4S 2Q66A 5E8IA 2D3O1 1YS7A 2RKIA 4BAYA 4A69C 2W1BA 1B8IA 3MMAA 2DXIA 4R8UA 1KQGB 4ES1A 3IKTA 5E7OB 3GFYA 3QJJA 3BPXA 2Y1LB 1R0AA 1GNKA 2F4VF 2YS9A 3LWLA 4IFVA 4TQSA 1N5YA 3D5MA 2KT0A 3ZQQA 3C6TA 5KG4A 4M94A 3LAKA 1W1WE 3TW6A 5ICFA 2GIVA 4YDDB 1VQNS 3QP6A 5HDGA 3TEDA 3DLAA 3LP0A 2B9SA 2IDLA 2YR2A 3MUTP 1U8RA 3NWSA 5EX0A 2RE1A 1BD6A 1NDLA 2RILA 3L2QA 1GAOA 3SJMA 1RWNB 3G4SS 2R8IA 1ZLKA 1BUXA 2AJ1A 3GFHA 3HDDA 3UDVA 3EMTA 4R5PA 3CLOA 1KVKA 1ACIA 3NXZA 2LMIA 4LOCA 4O3QA 3OUYA 1QE1B 3IBCB 2V50A 1FP2A 1IQZA 3AJDA 1ICEB 3HEFA 3MKYB 3DYAA 4IR1A 2J0SD 2JRTA 2YNHA 2WW8A 5HMWA 1AZSA 1S1VA 1VC6A 2RRAA 1E6VA 4Y3CA 5IXUA 5CYQB 3KUEA 1UL3A 1UFLA 3G1LA 3R1LA 4M3BA 3IAM2 5K9FA 1TQLA 4WFBQ 3FKBA 2XY7A 2E1RA 4N7TA 3U7JA 1DLOA 3RTVA 1SJRA 4TVAB 1Q0NA 2HHTA 1V54H 1KSPA 4NYPA 5ADZA 2MH2A 5KFSA 1CF7A 3RYLA 5IYDJ 3VGUA 1QM9A 4MAKA 4B48A 3DRSA 1FOKA 4AD9A 2VG6B 1PSDA 2EPFA 1KYWA 1LWCB 1XG1A 5C3EJ 1GTHA 4JB8B 3IM8A 1U2RA 3UVJB 1YX3A 3MM7A 1V3SA 4XRSA 4K5SA 1NPRA 5D4NA 4X64F 5ILVA 1NRKA 4CCMA 2EWNA 1D3WA 3D1QA 1P4AA 3WTXC 3L2VA 1U0SA 2P0WA 4P6QA 3GFZA 1LK7A 1CJKB 1I6HJ 1ZAWA 4DR2J 3AXKA 3DV8A 4RUCA 4KIFA 4Y7NJ 5KAKA 3NL0A 2X6WA 1X19A 3UN5A 1ETYA 1NEEA 2F5EA 2DK2A 2R7TA 2WVBA 2ADUA 2D3UA 4ICLA 4Q8EA 2W2OP 3VWBA 2QRRA 2FF4A 2OU2A 4ATNA 1S59A 3CUQC 4OIRF 3NNCA 4C8YA 1HYSA 2TDXA 3I6PA 3CJ4A 3DOMB 2KDZA 2O5DA 3DBHB 3MDFA 2IAIA 2YNIB 3DXJF 1SD7A 2BANB 1RT3B 2K3FA 3HRSA 2ZXJA 2A61A 1SKSA 4IQ4A 1WKJA 2RRNA 1R8CA 2ZMEB 3BC8A 1JKHB 3ABKH 5HLIA 4I6AA 2XY5A 5GAHU 2HDWA 2DGQA 3H2VE 2COMA 4FPRA 4X65F 3CJRB 3FKJA 2K9MA 4UUWA 2VQLA 1P1LA 1TL3B 2XNQA 1BR1A 3DDNA 2BQ3A 1K78A 2DMUA 2OIHA 1OCCH 1JLFA 1IZ1A 4F02A 1WHUA 1XD7A 2IVMA 2CPDA 2UUAJ 1LKZA 1NB2A 2ZWPA 2IJFA 2B5JA 1DJ0A 4RNFA 2DAOA 3VYTB 4MGRA 2B9EA 2W9AA 2DRBA 4GYGA 2CUZA 1Q8LA 4ILMA 3TOBA 2FIUA 3EPIA 3LP1B 4QOTA 4ASNA 3R7NB 3M3YJ 4JI3J 3UD3P 4IRGA 1VQOS 1IJWC 2PMZA 1RHJB 2VT2A 2XI2A 2E5LJ 4ZDPA 5FJ8J 1SH2A 2GA7A 4I09A 1VQPI 1Q82T 1HWIA 4FPIA 2FVRA 2WONB 4GO5X 4MTDA 3UQSA 2JEFA 4G7ZF 1U02A 5LMNF 1D5VA 4G6VB 2YWGA 4F36A 3P45B 4B43A 1UG2A 1Y4ZB 3IH4A 1TNTA 2DW4A 1RCOB 3FSYA 2OPTA 2XRLA 3IWLA 1IBKF 4B3TF 3R8YA 4IJAA 4IHTA 4BLGA 4IEJA 3FNNA 1U1LA 5LM7E 4DS5A 1S49A 4CA0A 2OSQA 5F1JA 1AXQA 5J4VA 1VISA 5J2MB 2EG1A 2UZAA 4U9RA 4OMZA 5L3FA 4USJC 1ZOTA 3SQOP 2O1PA 1QBJA 1AA7A 4CT9A 2FX0A 3LANA 4GKKJ 3S1RJ 5E79C 3EVMA 1TKZB 5A2QY 2C2DA 4IRCA 2ACJA 4K4XA 3PRVA 4LUBA 3U1KA 1RUSA 3H2LA 3CDIA 2ECCA 2IY5B 2MMYA 2RQPA 1QE1A 5BS6A 3LA7A 2JC0A 3IAS9 1ZG1A 1K1SA 1A35A 4A8XA 2PA8D 5DG8A 2HEKA 1RESA 4BH9A 2MXYA 1V5FA 4ZPAA 2M9HA 1IJFB 2AP6A 5J4YA 4RA2A 1H7XA 1U5TB 3WDOA 4F4ZA 2P5VA 5BMZA 3DEUA 1IM4A 5IOLA 3PXGa 5CYMA 2CO5A 1JLAB 1N5SA 2HPUA 1QUVA 2O3DA 2GIRA 2L9WA 2XO6A 3K4MA 1WC0A 3E97A 2PI0A 1IQTA 5ETOA 4OZ2A 4XLHA 4RNHA 3PX6A 2CUJA 3HFKA 2XMUA 1T8EA 2MC3A 2YTCA 4YQWA 1VLYA 1LDKB 3M05A 4IRIA 1UW9A 3CC4I 4UOHA 3PYGA 3G8QA 2X1DA 4KGZB 2BW7A 3I5BA 1JIHA 4XL9A 1NK2P 2DNOA 3BPDA 5D8KB 3HZGA 5IM0B 4WP8A 2ICWG 1IGNA 3S32A 2CJJA 3A2KA 4LG3A 1RAFB 2QMXA 2NVXJ 2FUG9 1LWCA 2VJUA 4A2UA 1VFCA 3UVJA 1UWBA 4DX5A 4HYEA 5LHGA 4LF5J 3TMOA 1C1BB 2D74B 2ZDOA 4UUSA 4WFZA 3KLHA 3OYLA 2BKPA 2HLUA 1CJKA 1U48A 2MZRA 4IOCQ 1PKUA 1F5AA 4RB1A 3JB9k 3FM3A 2NS8A 1G3TA 4WXOA 1K7AA 4AUXA 1EH7A 3K4NA 3OL4A 1L3VA 1YX5A 3EPZA 1BY9A 3W65A 3I87A 1N77A 4O44B 2HLTA 4DR7J 4DQIA 3FXJA 2B6AB 1KFDA 3I32A 1KVIA 2B9WA 5E0OA 3OL9A 2XULA 5M3FJ 3V4GA 1FTTA 5HROB 2HQAA 2BANA 3BQYA 3N28A 1G4CA 2HURA 3LPEA 3LGHA 1VHIA 1JKHA 3EM1A 3L7OA 4PWUA 1TR0A 4X4RA 2W4DA 1RAHB 2X3DA 2H1YA 4CLWA 1DQAA 4DFPA 3Q5FA 2KZGA 3ZZTA 4DPXA 3BBCA 3IKVA 1FWZA 3BR8A 2NS0A 1YJVA 2HQ5A 1Z6RA 4F4AA 2R4FA 2FD2A 1CVJA 2KI2A 1IR1A 3L2RA 1Q81T 4DJAA 2ZHOA 2GMLA 4RM3A 2DO7A 3RZDJ 3LP1A 3LUYA 3AT1B 1XGNA 1LQ1A 1BR4A 3R6LB 1FTCA 1SUQB 2BABA 4DR2F 2QYGA 3N01A 1OSDA 3OTCA 3H3UA 3W66A 4DPYA 1HD1A 2ZE2B 1HSJA 4KICA 2PJRA 3OYFA 1JJ8C 2X48A 4C30A 3MEXA 4HTJA 2M8GX 2C2EA 1RXOB 2DDAA 4KC5A 2A05A 5DO2A 3L2CA 2EI5A 4IQMA 4QIEA 1WI6A 1ZM9A 4OMYA 5KFQA 4P75A 2DFEA 5E3AA 2JVGA 2YBVA 2BM0A 1UEKA 1RT4A 5C42B 4ENKA 4LF1A 4YY3J 2HOTA 3ENWA 2UVRA 3CC2S 3MM9A 1HQCA 3LPYA 1WPKA 3D3BJ 1DU0A 1TL7B 1PJRA 1FO1A 4LK0F 1B0PA 5A0YB 3SZ2A 1NSAA 1TKZA 5K5RA 3OYNA 2KL8A 3AD8C 5DD4A 4LJZF 1TK0A 3LWFA 1U2WA 2EXUA 2FBKA 3MAAB 3G6VA 2UUAF 5B1BH 3RBEA 2PA3A 4MYUA 1LQ9A 2BW3B 1YJNI 2JN6A 3TGNA 1QUPA 2AIRB 5HK4A 2L9VA 3HPGA 5LJ5Y 2W7PA 3UN3A 2BE9B 3EDRB 1AFIA 4JI3F 4KFBA 3HI9A 2LK2A 4LLGF 3Q8QB 4OLOA 1U5TA 5G0RA 4OZ5A 2AGPA 3K5LA 5D8HB 3MI7X 3OL3A 2E5LF 3HUGB 2M3DA 1WSVA 4ZCIA 4RNOA 2QVOA 4QR2A 1SC7A 3D6FB 1S9FA 3V7SA 3PCOB 4CCHA 2OV7A 4X4SA 5CA5A 2CGPA 2HHHJ 1N5TA 5IM0A 2XUBA 2CFXA 5KFNA 1KOHA 2J6UA 4CO0A 5H20A 3PM9A 1RWKB 1KA8A 3G82A 4GKKF 1WJFA 2HHXA 4LFUA 1C1BA 2R8HA 2PE8A 5LJ3Y 3Q9SA 5IT9U 4ED8A 4V2FA 3CF2A 5H6QA 4OZJA 1YJ9S 1LKXA 3SEZA 2L02A 3SYZA 3TVYA 1QO0D 1HA8A 1S29A 3RG6A 2XSFA 3TAMB 2LP0A 1VR6A 1Y8RB 3V81B 5H9FK 1NJWA 3DMJA 2E9ZA 4MLOA 2AV5A 4XAKA 2XZDB 1HBNB