2DBBA

Crystal structure of ph0061
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
146
Chain Sequence
KLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLGYMYAIVLIKSKVPSDADKVISEISDIEYVKSVEKGVGRYNIIVRLLLPKDIKDAENLISEFLQRIKNAENVEVILISEVRKFEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH0061
rcsb
source organism Pyrococcus horikoshii
molecule tags Transcriptional regulator
molecule keywords Putative HTH-type transcriptional regulator PH0061
total genus 36
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dbbA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dbbA02
4MTEA 2ETHA 1ZRDA 2E7WA 3JAMZ 4IPAA 4LLGF 3HOSA 1LB2A 1R23A 1KYZA 2HGCA 1B4AA 1QZYA 2OQGA 3CO7C 2ACJA 2FOKA 4UVAA 1UCRA 2AXLA 1O3QA 1EH6A 4ENMA 4Y15A 4HW0A 4ZYDA 1S8NA 2COMA 4HX7A 2EV5A 3H3ZA 4BXUA 2E7XA 1XGOA 2ZMEB 3CLOA 4OOIA 1W4MA 2IPQX 1IN7A 3J80Z 4N9HA 2L01A 3TQNA 3KLNA 4RAZA 1ZG1A 3ELKA 2YSRA 4GYIA 3W6JB 2RQPA 3RIRA 4MQ9F 5F64A 3ROUA 4FX0A 2UXNA 3P9IA 4ESFA 2JPCA 2KJCA 3NEUA 4HAMA 5ILVA 3R61A 4LB6B 4A5NA 1Z7UA 1REPC 2RNJA 3HHGA 1HXDA 5LHIA 2XAQA 3F72A 5JHUA 4CICA 1BBYA 2K27A 3K2ZA 2XAFA 3R60A 2JZYA 4L9VA 3MFKA 1LEBA 2RVCA 2HFHA 2RKHA 3TOBA 3WGIA 3K1NA 1K79A 1IW7F 1PUEE 3KZZA 3F22A 2Y0MA 3COAC 2K7LA 1ZARA 1JE8A 4RGUA 1IXSB 2LKPA 3HSFA 2GIVA 3WTZA 3GFMA 1P6RA 1BC7C 4KICA 4NQWA 1E17A 2JSCA 3E5XA 5J8FA 1TW3A 3C7JA 2ZBKA 4A12A 1FLIA 3RYPA 2K86A 3VODA 5DV5A 3ZMZA 1KGSA 1Z1DA 1DUXC 1KU3A 1A04A 5HOOA 4I09A 5FLXZ 3MEXA 3ECHA 1T0FA 2M87A 4LD5A 1IF1A 3L9FA 5DD4A 2V1UA 1FSHA 1STZA 2XVCA 1UHMA 4IXAA 3MQ0A 4I0BA 4L9NA 5E17F 3D0SA 2P5KA 3KETA 3V8JA 2G7HA 3FMSA 4M6XA 1ZHFA 4KNYA 4WXCA 3LQQA 1IRFA 4UVCA 2XROA 4OU0A 1SAXA 1RZ4A 2OU2A 2ZNYA 3KP2A 5D5VB 2DLLA 2ELHA 4CGZA 1OMIA 4I2OA 2VE9A 3ERED 5HVQC 1U5TB 1HQCA 1LQ1A 3SZPA 4L18B 4HOBA 3ZPLA 3HRMA 2FBKA 4JK1X 2XIGA 2O3FA 1HSTA 1IN6A 4KA4A 3Q9VA 4WF2A 3J81K 1DPUA 1OKRA 3E6CC 3F8MA 2H09A 4BH9A 2IT0A 3ZMDA 4O5VA 3DKWA 3REOA 4ENKA 3C3WA 3K0LA 1J7KA 4YIFA 4RB3C 5CVJA 1ZN2A 5ED4A 2KIUA 1R5HA 5H20A 1ZYRF 1RI7A 1XSXA 4K2EA 4OIPF 1C0WA 1ZRFA 4ZH4F 4L9TA 1DPRA 4EM1A 2IA0A 5E20A 2CG4A 2DK8A 3GEZA 4PZJA 5E1WA 5TJJA 1ZAOA 1BN5A 3T8TA 1YS7A 4B8XA 5E1ZB 3IL2A 2ESHA 2NYXA 5ERIA 3WODF 1YQAA 2ZJ2A 6PAXA 4RB2C 3MCZA 4YG2F 3EYIA 1I1GA 3E6MA 2HKXA 2DJWA 2TDXA 1IN4A 2O61A 2CSOA 4RB1A 1I5ZA 2STWA 1QBJA 5LEJA 5FFXA 5HDKA 1P4WA 5D8LB 3L09A 1HW2A 3BPXA 4L5JA 4GGGA 2O03A 4IRHA 3RKYA 4KUMA 3M7GA 2QQBA 3FXQA 2EB7A 4KN4X 2XAHA 1BC8C 3KFWX 3B73A 2YU3A 2JT1A 4MQVA 1E2XA 2JTVA 1LDDA 3QU3A 3AAFA 1WQ2A 4FHTA 2FRHA 2V1XA 2A6EF 2VC0A 2VC1A 2GAUA 5FD6A 1T39A 2MA3A 3I53A 4O3MA 4A6DA 3TDUC 2F5FA 2VBYA 2BE5F 3L2CA 4LLLA 3BJAA 4UNOA 1K78A 2BEOA 3F6OA 1U5TA 1MKMA 4BAYA 3RYRA 4U0VA 2Q8KA 3JSPA 4RGRA 2QYOA 4M72A 2IRFG 3VB2A 1FBUA 3S2WA 4DNCA 1XSDA 4Q4ZF 2ADUA 3WU0A 5BPIA 1MDMB 4XLPF 3K9TA 4KN7X 2CO5A 1Q1HA 2RDPA 2VONA 2OZUA 1JXSA 3BOQA 2FMLA 4RB0A 4XSZF 4D0PA 5HDGA 3BPVA 4EQQA 2VBZA 4ETSA 3KZYA 1TQPA 1B59A 1JHFA 1CF7B 4CDGA 2V79A 1MJBA 4IVNA 3PQJA 3GW2A 3IKVA 4KIBA 2PG4A 1ZLKA 4N0BA 5LGNA 1PDNC 2MH2A 1GHCA 1H9TA 3EYYA 2CQKA 1FZPB 2Q2EA 3I59A 3L7WA 1MJAA 4HF1A 2DFIA 4KT5C 2W25A 4BYYA 4LGWA 3GFLA 3SFZA 4U0WA 3PQKA 5JI6A 1G6NA 2CWEA 2VBWA 2E1AA 4WX9A 2HDCA 3W6KB 4BNCA 2Z3YA 4L0YB 3LAJA 1D3YA 3I54A 2QVOA 4EGYA 2BV6A 3HYIA 1YIOA 1ZH5A 4IHSA 3FF5A 4Y13A 3DP7A 1XMAA 2DO7A 1XSVA 5ICCA 1D5VA 4JQFA 3RJPA 1IN5A 1FWZA 3ZMUA 3TO9A 1GXQA 2QWWA 4KYWA 1LNWA 3KEOA 1L0OC 5LRRA 4HLYA 2G7UA 1R58A 4A5MA 4HX4A 3OOPA 1U5TC 2R7FA 2X0LA 3L00A 1U78A 3E5UA 4XLNF 4ESJA 1XGSA 3E6BA 3FMQA 1O57A 1SFUA 3ZMVA 2B0LA 1FY7A 1O7FA 1XMKA 4QLCU 1KYWA 5L3BA 1ZG5A 4G6DA 1WWXA 1FYMA 1HBXG 3F23A 1W7PB 2XHKA 1EH7A 4MNUA 2FBIA 3N97A 3LA2A 4L5IA 3RDIA 2VN2A 5D4SA 3IC7A 4RGSA 1VTNC 1XDUA 3RKXA 2DPUA 5L3DA 3LA3A 2ZCWA 5ILUA 1B9MA 3F6VA 4UV8A 3HTUA 3ECOA 3LFKA 4CZZA 3GO5A 4BHPA 4YFNF 2F5DA 4EMSA 1HKSA 2IVMA 3GFIA 4G9YA 3FHZA 4ZYEA 1XCBA 4P9UA 3TO7A 2MLGA 2M30A 2XKPA 1K6OA 2A6HF 1TQIA 2L3DA 2WC2A 4FX4A 1XGNA 3K1MA 1KQ8A 3KP4A 2FXAA 3OV8A 1FOKA 4ENJA 3RPQA 2ZMEA 3ZQ7A 1OYYA 4E70A 1R36A 4KIFA 1YW7A 3F8BA 1CF7A 3ML6A 3IHUA 2BGCA 2HEOA 5L3EA 2FMYA 1PP7U 1TTYA 3IWZA 2KIFA 4M9XA 2Y75A 1T98A 1S7AA 5J6XA 1BOAA 4MGRA 5JR3A 1QQIA 2M1BA 2NS0A 4G7HF 3ZMSA 1SMTA 5E8IA 5D5XB 2Z33A 5BS6A 4TV7A 4YFKF 2A5YB 2MLKA 4A2UA 1F1ZA 2PBIA 1R1TA 3FZVA 5LHHA 2ISZA 2XAJA 5D8KB 4Y17A 1YW8A 1K78B 3D5LA 2X4HA 1F9NA 1SD7A 2EV6A 1QZZA 3DPLC 3BJOA 3HRTA 5HLGA 3FMRA 4I0AA 2Y48A 2R3SA 3QP5A 2JSXA 2GXBA 3TOAA 4XRFA 3RKWA 4ENNA 1X3UA 2LF8A 2K02A 5A2QZ 1WRJA 4MEYF 4MTDA 4A0YA 4BHCA 1W5SA 2BYVE 1U6GA 4OIRF 2DI3A 1LJ9A 4LJZF 1XB4A 3KE2A 3DV8A 1G3WA 4IRIA 2NNYA 1R1VA 2HOEA 2F5CA 2Q0OA 2EFWA 1QGPA 3IRRA 3GF2A 1BJAA 3GZ6A 2M5WA 2GA1A 1I6XA 3PFIA 2J5PA 2VT3A 4PGGA 4UV9A 1Z9CA 1OYIA 1NHAA 3QU6A 2EA2A 4I7HA 5TRDA 1J75A 3I4PA 2PJPA 2QBYB 2EFOA 2P7CB 4M6YA 1IAWA 5CVVA 1IUYA 4HDVA 1EH8A 2HQNA 4PCQA 2ZBCA 4EJUA 2L54A 2ZKZA 5DCMA 2IA1A 5CLSA 4EJOA 5ICGA 3BWGA 4WXDA 2GXGA 3BROA 3HSRA 3E5QA 1BI3A 2CFXA 1KA8A 2L4AA 1LEAA 5FB2A 3FXRA 1HW5A 4PGHA 1FYLA 4AIKA 1ZGJA 5DD8A 1SFXA 2HTJA 5IT9K 4BQAA 3WTSC 1Y0UA 1Z6TA 2RV8A 1KQ9A 1YW9A 4P5OA 1EV7A 2XASA 1XDSA 4LG0B 2H6BA 4EVIA 3VEPA 2IJLA 4IHTA 2DU9A 5ICEA 3LAPA 4HLXA 5CVRA 1O3SA 2DQLA 1RIOH 5AIPA 1HW1A 4EGZA 2A61A 2E1CA 3J81Z 3F8CA 3DF8A 1HSJA 2Z4PA 4IJAA 3GZ5A 3O6BB 3HRUA 4WCGA 3J7AO 3HRSA 3F21A 1R5GA 3BDDA 1LDJA 1K7AA 3ZN0A 2HYFA 4P55A 2WV0A 2F2EA 3CUQC 5HS8A 4AWXB 4R79A 5DDGA 4LK1F 3KP5A 3FM5A 2C6YA 1I1SA 1FP1D 2IA2A 2FNPA 2VT2A 5HS7A 2XAGA 2HTSA 3T1BA 4HF2A 4WWCA 1U3EM 3R6SA 2M8EA 2P6SA 4RGXA 5ILSA 5BQTA 1J59A 5FFZA 1DDNA 5CVIA 3E3VA 3C1DA 3F8NA 3GX4X 3I5UA 3C18A 3SQNA 4EM0B 4AIJA 1D8KA 2DQRA 4OMYA 4EM2A 3SZTA 3I59B 1SD4A 4HX8A 2W85A 1ON2A 3JSOA 1G3YA 1B1BA 3I58A 4MHGA 1XN7A 5L3CA 2VOPA 3HHHA 4Q48A 1YTYA 4HDUA 2IP2A 1AOYA 4P96A 1RUNA 3SHFA 2FA5A 2P6TA 3NRVA 4KFCA 3IRQA 2K4BA 2OBPA 1W5TA 2PEXA 3DEUA 3I0TA 4AIHA 4U7BA 1MGTA 3M1EA 1DP7P 5FLXK 4OMZA 4KMUX 1TW2A 2QM3A 3WTWC 1CGPA 4I02A 4IRGA 3V7CA 4EJTA 3DPTA 2VOOA 1IXCA 1V3FA 3G3ZA 2HWVA 3JW4A 3B02A 2KJBA 3WU1B 5HS9A 5BPDA 1FNNA 1SMYF 5K5RA 4HBLA 1H9GA 4CYDA 4N9IA 5J8CA 4G94A 5E18F 2W57A 2UWMA 4U7DA 1J5YA 3HSEA 3QPTA 3ABTA 2H6CA 5LLQA 4O6JA 4YFXF 2HYGD 1TNTA 4HZFA 3U9GA 5BMZA 3WTTC 2RGVA 3ULQB 3BY6A 1YG2A 1J2XA 3MZYA 5FO5A 3J80K 4UHTA 1UHWA 4A6EA 4S05A 3LQRA 4B09A 1KU9A 2OD5A 5DEQA 4HQEA 4R8HA 4UUVA 3R0AA 3TGNA 4HV5A 4FT8A 4U0YA 2FEZA 2XGXA 4XSXF 5L3GA 3LSTA 5FD5A 4OIQF 3CO6C 2QBYA 2GA2A 3JAMK 2MD5A 3G73A 4PDKA 1D8JA 1FBSA 5LGUA 2FU4A 4I98B 5KK1A 1GVJA 4HQMA 1AWCA 3TKYA 5K1YA 3U2RA 3LWFA 2J5OA 2D2WA 2EJRA 3BJ6A 4ASNA 1FYKA 3EQLF 1FPQA 3O2PE 2E1NA 1PP8F 1B6AA 3FX3A 2BBYA 1HKQA 5LEKA 2HQRA 1BI0A 2O0YA 2DBBA 3QPHA 5F1RA 3CUQB 5H6QA 2PLYA 1IZ1A 2HZTA 3MZHA 4GCVA 2D1HA 4LLNA 2VXZA 3WG9A 4Q47A 1JHHA 4LG0A 2JPBA 4ON0A 2H94A 1JGSA 2PN6A 2ISYA 3H3UA 2EFPA 5EEHA 3T5XA 4G7OF 2A69F 1TQMA 3IWFA 3CJNA 4KMFA 3N4MA 3SXYA 1YYVA 2DPDA 5LBQA 1XCVA 2HR3A 2V6CA 3FM3A 1U8RA 2OA4A 3LA7A 4LK0F 1P4XA 3WTVC 3HTSB 1QNTA 1SFEA 5HLHA 2EA4A 2MH9A 3KLOA 2EK5A 2D1VA 2KKOA 5D4RA 2QZ8A 4HF0A 2L4MA 2LNBA 2XKOA 2EV0A 2A3SA 1UFMA 2FBHA 1IN8A 5E8GA 5E1XA 3KP7A 1J0RA 3F3XA 1R22A 2ZFWA 3CUOA 3DQVC 1T38A 5DCFA 3GXOA 5JFRA 1Z6RA 3TO6A 2HS5A 4WXHA 2G9WA 4WK8F 3ABUA 4AVPA 2O8XA 4M73A 1J9IA 1S6LA 1IRGA 3MAJA 1XD7A 3VFZA 5JVTA 2PMHA 1W7PA 2LSOA 1S7OA 3ISPA 4OINF 3NQOA 3M8EA 2DW4A 3GVAA 5DUIA 3KEQA 2DT5A 2V1DA 3V8LA 1R7JA 5LRSA 3WE2A 5DUKA 2YR2A 1G3SA 4GXOA 3EDPA 3HUGA 2P8TA 2LF7A 4G7ZF 5IT3A 2PFBA 3P7NA 3H92A 3QOPA 1SD5A 4UVBA 1RNLA 4L0ZB 1U2WA 5LHGA 2YX4A 1ON1A 4HYEA 4RAYA 1LVAA 2DK5A 1FC3A 2IW5A 4M9SA 2OAZA 4CXFA 3QAHA 1H0MA 2VODA 1Z05A 1ZREA 2F5EA 3FWEA 4H0EA 1OR7A 2FNAA 2AS5F 2W24A 2VE8A 1T2KA 1TNSA 3GWZA 3EUHA 5HDNA 5EEGA 4ZYHA 4GYGA 5DCMB 1I27A 4CO8A 3FXUA 4F7ZA 1FBQA 1IXRC 4BHBA 4Z2YA 4YIIA 4HV6A 3E97A 2NNNA 1V4RA 1YLFA 2NRAC 4HA8A 3O3KA 2MBFA 4A0XA 1TBXA 3QRFF 3JTGA 1BI2A 1QPMA 2MC3A 3WGGA 2WTEA 4Q5SF 4UXNA 2QQAA 2M45A 1R1UA 2Z9OA 5KVRA 3CDHA 4NB5A 2EFQA 2QENA 2QUFA 2Z99A 2ZXJA 1W7PD 3K1PA 4ZZLA 1MZBA 2STTA 2Z5UA 4CHUA 4M74A 4MEXF 4KIGA 1KU2A 1O3TA 1MD0A 5ICFA 5K5OA 2CW0F 2P7VB 3P9KA 4RS8A 1BI1A 1R00A 4LFUA 1YFHA 3KCCA 2P4WA 2XV4S 2FSWA 2FE3A 1F4KA 4EV0A 1QO0D 3Q9SA 3HIFA 3M9AA 2OZ6A 3I64A 4ESBA 2RC4A 3R0JA 1P2FA 4M71A 4XBFA 4ZYGA 2DAOA 2CVIA 1B9NA 3RTRA 2YPRA 5IT9Z 2A07F 2PQ8A 3BZ6A 2VBXA 3DFGA 3EETA 3ZN1A 4DQ2A 1BM9A 5K5QA 5CYVA 1ZRCA 4NHJA 3MWMA 2R7DA 2DTRA 1OYWA 2GQQA 1Z91A 4JBAA 2ZNZA 2XRNA 3GYHX 1S29A 5CVUA 4R1HA 1LDKB 4LMYA 1O3RA 2PI0A 3WTXC 5AIQA 2FQ3A 4AD9A 3QP6A 3V8KA 1KQ0A 2LDUA 1BIBA 3CUQA 1G4DA 3K69A 4G6QA 2UZKA 1P4AA 5CJ9A 4EJWA 5AONA 1RUOA 2H27A 2WWYA 1HKTA 2FF4A 4IF4A 1USTA 1ODDA 3E6DA 5BOXA 1L3LA 3F8FA 5H6RA 1S3JA 3GUDA 3DXJF 3WE3A 2RN7A 4LB5A 3CTAA 2A68F 3M8FA 3RPUA 3V7RA 1FX7A 5LGTA 1F5TA 5L3FA 4M9ZA 1KU7A 4G8XA 4GO1A 2ZO4A 4ZZDA 3U1DA 2QQ9A 5D5WB 3KP3A 2GZWA 5D6EA 1ONVA 1YS6A 1UB9A 3V4GA 1ZGAA 2L02A 4A0ZA 2XUBA 3GFJA 5FGMA 1G3TA 1O7LA 2P5VA 5D6FA 3P9CA 3HOTA 2OQRA 3Q5FA 4S04A 5DYMA 2ESNA 2W84A 5D5UB 5HLIA 3KP6A 1WSUA 3T8RA 3VOEA 2K4JA 2GWRA 2CYYA 5F6FA 4EJVA 3IKTA 4KDPA 3ZMTA 5A2QK 2KRFA 2YX7A 1FP2A 2EWNA 1WKMA 1ULYA 3WGHA 1YO5C 2NAZA 3ZP5A 2PMUA 2O6GE 1USSA 1SD6A 4P9FA 1MDMA 3V7SA 1GXPA 1ZLJA 2P5LC 2UXXA 2HKOA 1FSEA 4I01A 2V9VA 4QWQA 2QLZA 3R4KA 3RI4A 1BIAA 2JRTA 2CGPA 1T6SA 1TLHB 3BP8A 4L9JA 1XGMA 3WTUC 1P92A 2EFNA 4OIOF 1ZG3A 3GLXA 2D45A 1MJ9A 3JTHA 1WI9A 1FT9A 3T0YA 4U88A 3TDZC 2KIMA 3WTYC 1OPCA 3I71A
chains in the Genus database with same CATH superfamily
4MTEA 3GG1A 3OYBA 4HNUA 4ED3A 3ZQFA 2E7WA 3DTEA 1NO8A 3S1NJ 1TFWA 2CPYA 1D0YA 1R23A 2Z56B 2QLXA 4B9NA 4N8NA 3OL7A 3AT1B 3FUYA 2OQGA 4J01A 2ACJA 2FOKA 2OPQB 2RRNA 5I42B 1O3QA 2AXLA 4U6PA 3DLGA 3WHBA 4ZYDA 4ZPDA 4HX7A 2PMZD 3H3ZA 5DGAA 3K5MA 1U02A 3GV7B 2E7XA 1RHQB 1XGOA 2W00A 4JX6A 1W4MA 2IPQX 1IXKA 2W2PP 1IN7A 2VG7A 4MFDA 1TFYA 4M5NA 5IS2A 1TWAJ 3ZZYA 2B7CB 3W1YC 1T3NA 1RT2B 3CB4A 4ATNA 3W6JB 3W7BA 5A6WA 3V42A 2XY5A 4USHA 1YX2A 2QMUB 4G1PA 4JI4F 2VXDA 1JKQC 5JHFA 4DR7J 4D9JA 2F8EX 4Y33A 1VQ4I 1U2RA 1H2TZ 1I50J 1TWHJ 2IGKA 1HNIB 1WG1A 4NXNJ 4HAMA 1GDTA 3R61A 2NVYJ 1UEKA 3EGVA 1Y7PA 3FFIA 4ZVRB 4A5NA 3UCZP 3NCRA 1Z7UA 2DTZA 1S1UB 4JI1F 1REPC 3HBLA 4IH7A 1FOXA 1T9XA 1FKPB 2ZH7A 5J2NA 2RNJA 2QSFA 1HXDA 5CCLA 2WA0A 3OHBA 2R7OA 4AIDA 3H5XA 3K2ZA 2XAFA 1NHKL 1HI8A 2AGOA 4ZPCA 3HZEA 4RNMA 3MR6A 5KFHA 3NS5A 4PFOA 5FKLA 4AUKA 4DF8A 1WC4A 3PFYA 2P9EA 2RVCA 4EUVA 1B0VA 4DS5A 1UVLA 3AH6A 1XJWB 3QJLA 1K79A 1PUEE 3BR0A 4X62J 3COAC 2COBA 2M34A 1HNXJ 3CESA 2XZWA 1LW0B 2AD9A 2CQ7A 4ED8A 1R0AA 4USUA 1FE0A 2E2JJ 1T05A 3WTZA 3GFMA 1P6RA 4IQMA 2HNDB 2W7OA 3MWBA 4KICA 4NQWA 3BKUA 5FJ4A 4BKXA 4ILLA 3HGGA 4P75A 2YQ1A 5C24B 5EHHA 1K0TA 2CQNA 3DI6B 1IKYB 1FDBA 4MLOA 4AC0A 5EDWA 1BC6A 2K86A 3LFUA 4PG4A 5DV5A 4A3FJ 3IM8A 4W97A 1JLBA 1DUXC 1IKXA 1IM4A 3QQCD 4DMZA 3ZC4A 2P8IA 1LKZA 3NS6A 4I09A 2ZWOA 3UN2A 3NAUA 1RLDA 4ZCIA 2W4DA 2ZXHA 1TZ0A 3FDSA 2XF6A 5B1AH 1T0FA 4UUWA 1IF1A 4DX5A 1HNWJ 3L9FA 4KE5A 5GTHC 2V1UA 3J7ZT 1Q86T 2PX9A 2Q1LA 4IZZA 4U8YA 2DR5A 4C0BA 2VKRA 3OOUA 2Y8YA 1STZA 4I0BA 3HOVJ 5J2MB 4DHVA 2OSQA 1RU2A 1Y4ZB 1FA0A 1VK8A 4M6XA 1ZHFA 1XK8A 4WXCA 3HX9A 3D1NI 1KQGB 4UT4A 1S6QB 3T41A 3CVKA 4Y28C 2OU2A 5CKTA 1VJQA 2JA5J 4G65A 2RVJA 4DR6F 2KXFA 2OPSA 2VE9A 2A0FB 3ERED 5GADI 3AL0C 3NNAA 2IRXA 5BNGA 4A3EJ 2VJIA 4WE1B 5BYRA 3QRRA 2DGOA 2YXLA 4RUBA 3QIPB 2C2OB 2CVEA 2WVCA 2GOXB 1SL0A 2DOAA 2XGCA 1DTQB 2VJVA 3ILIA 2QE5A 1R71A 1HSTA 1CS4B 2CKWA 1FWPA 3EDRB 2N7YA 4O0IA 3J81K 3RAMA 5E3OA 2LH9A 4S0MA 3F8MA 1IR0A 3FCWA 2MDAA 3PSFA 1NMEB 3SCKE 2ICWG 5F1JA 2M9KA 1D8ZA 3UO0A 3C3WA 1FKOA 2Y9ZA 3K0LA 1R8BA 4A8WA 3CMQA 4UY85 5CYMA 5CVJA 1ZN2A 2QGFB 1ACIA 2KIUA 1U6ZA 4L3NA 2PFFB 4PJLA 3R7NB 4ZH4F 3V6DB 1CG2A 1B8IA 5E3MA 1KRPA 3HJVA 5DJBA 2DK8A 4KISA 4NNJA 3HHLB 1SKRA 3R5JB 1JB0C 5TJJA 4NCGB 4XPEA 2C28A 3T8TA 3O8WA 5EWEA 2ESHA 2B4VA 3LL7A 2TCTA 1FRHA 3H9GA 3W8PA 1G6BA 1RHMB 3LNQA 6PAXA 3MCZA 2AIRB 5LT5A 1MBHA 1I1GA 1WDTA 2DJWA 4QJVA 3OYAA 4J9QA 5LEJA 1VR6A 1P4WA 1X31C 1HW2A 2M52A 2I6WA 4IRHA 2BV3A 1YK9A 2Z16A 4FYDA 1QAXA 1TL3B 1JLAA 4PWDB 2QQBA 3QPLA 2ZJQF 2ZH3A 3BTIA 1U9NA 4X6AJ 3FXQA 4KN4X 3KLHA 2M4KA 3NCPA 4YQWA 1S0MA 4AXJA 1NK3P 3RRHA 1I51B 3OS2A 2BJ3A 4DR1J 2W2MP 1FD8A 2Y9HA 3D7SB 2BM1A 4ZIWA 2UUWA 1M0SA 4L75A 1E2XA 5FLVA 2JTVA 3PNIA 1LDDA 3L95X 3POTB 3QU3A 4MYTA 3AAFA 2FRHA 2HHVA 3PFOA 1A0OB 2FZKB 3I6PA 2VC0A 1UCNA 3NKYA 2GAUA 1T39A 2H1KA 1LWXA 3SSRA 1OYDA 3IWLA 2WRMA 4FS1A 3CCQS 1ETKA 1H88C 2VBYA 3T9ZA 1Y56A 4QPTA 3CD6S 5KT6A 1X4EA 1IRZA 4DX8H 5FLXY 1QZEA 2V8VA 3A8EA 1YIJI 5ETQA 1OSCA 3EZOA 1GT8A 4BDYA 3GJTB 1RAFB 3FXMA 1PG5B 4ED4A 4V2GA 4DNCA 1XSDA 2ZXWH 1DHMA 3BG5A 3KKFA 2D3UA 4DFMA 4CSWA 2FVCA 1NEEA 4DG1A 4XLPF 2ADBA 1V55H 2F4OB 3TQ1A 1Q1HA 2V9WA 1P7JA 4LITA 2KQRA 3BSAA 3CCQI 2VI6A 1ZPWX 5E5NA 2FMLA 1VQPS 2Z8QA 2YNHB 3GYGA 1BY9A 2M8GX 2UZAA 3D66A 3W3CA 2FDNA 2A5WA 4BBYA 2H5EA 2W8LA 1TQPA 1B59A 1JHFA 1CF7B 4CDGA 2BXJA 2HWIA 2VQHA 1ZBTA 1HBMB 3CCJS 5F8JA 3C15B 2XWXA 4OJHA 3CDWA 2OPTA 4BHQA 3EYYA 3MMAA 3EXCX 4IFYB 4QQBA 1FZPB 3Q23A 3I59A 3SQGB 5HLFB 3S1RJ 2V68A 2DFIA 1NH8A 5F08A 4X62F 5JJBA 4BYYA 3C19A 4DQSA 2WVEA 3IBCB 1O4XA 1T9YA 1FMVA 3DLLF 1O5JA 5HP1A 4DYQA 2MZ1A 3SFZA 2IMWP 4AL7A 3V2UC 3EGNA 4JV1A 2A10A 1G6NA 2KFNA 1OO0B 4F93B 1LFBA 4JYKA 3KYDB 5KT5A 2EK6A 3SYTA 4WX9A 1D0ZA 1Y8QB 2HDCA 1QDUB 4KY3A 5E3RA 3SDEA 5I3UB 4X0GA 3SFGA 2AHQA 4AYBN 2ADCA 2MD0A 1AKHA 1VRTA 4CCMA 3DRPB 1IR1A 4M63A 3UVJA 5JLWA 2E5ZA 3C2BA 4EGYA 1S1XB 2BV6A 1XNRF 5BYSA 3MEDA 4NA3A 2FY8A 1ZAWA 4L6V3 2Z2ZA 3D1HA 2VB6A 1NPRA 5IWAJ 2FVRA 4HTJA 2CIMA 1POGA 1N0VC 5HQMA 4XOTA 1H73A 3H4BA 3ZMUA 1Y3KA 2FQQB 4NEZA 3VZIA 4RNFA 4F04B 1VQ8S 2B7EA 4HLYA 4RU9A 3KK2B 5A76A 1U1RA 1R58A 1PKUA 2XYHB 4DLEA 1U5TC 3BQYA 2QEXI 2R7FA 2X0LA 1H7XA 1U78A 3A0HC 4DL6A 2DD8S 3GJSB 4XLNF 4ESJA 2YX1A 3FBCA 1SFUA 2JN6A 5HLTA 4EBCA 3ZMVA 2NUUG 3S3NA 2UV1A 1LE8A 1O7FA 3K59A 2DHXA 2H9ZA 1ZG5A 1JLCA 4LIWA 2CNNB 1WJ5A 4HRIA 1UJ5A 2XHKA 1EH7A 4C8YA 3EMTA 1K83J 5JVGQ 4MNUA 2L0KA 2KVQE 3RDIA 2KVIA 3UI3A 1YJ9I 4EZ6A 3OY9A 4KGKA 2XMAA 1IRXA 4ZPAA 2NR0A 2GIZA 4BJ5C 3M07A 4MK7A 4U87A 3H5NA 3W5ZA 5B0BA 3PW5A 4KYZA 3LA3A 2KFYA 2J9DE 4AQYF 2NLWA 4ZDNA 3H9QA 3M30A 2ZCWA 4LQ3A 1FFSB 1M1KT 5K8PA 4CLLA 1B9MA 3ZNUA 3F6VA 1WHWA 2BHZA 3IN5A 2VPXB 4CI0B 4F4WA 3IP0A 3GLLA 3LFKA 1WC3A 3MEKA 3H9JA 2VQEJ 1I5OB 3R97A 3G8TA 4A8MP 4CNYA 2QF7A 4HTIA 2H1LA 3HVAA 2CQPA 4GKKF 3CCSI 1GTEA 3VDXA 3IRWP 3ZCOA 2DMNA 3GZ7A 1K6OA 1RRJA 1S12A 1FE4A 1OCCH 3T1HJ 1TQIA 3J7ZI 4UUTA 2GIQA 4QWEA 1K0VA 1U2FA 3ABKH 4USWA 3K1MA 1KQ8A 4HEA2 2W9BA 1HBOB 3RR7A 4NE9C 1FOKA 2NVXJ 2VG6A 2DNRA 3RPQA 2IJRA 4PJNA 5HVFA 3NS7B 3AXKA 3IR7B 3OV7A 2WONB 4RJVA 4HNVA 1Q0NA 1AW0A 2YU9J 2W7AA 2YKMA 5M5WJ 5E3LA 2RF2A 1KHVA 4WU2A 2BANA 1TTYA 3BQ0A 1NXIA 2KIFA 4CO5A 1UETA 2RNGA 2Y75A 2UXDF 1X7VA 2W2NP 1NK4A 5ETSA 5FLMJ 1FERA 3H5UA 1JLQB 4ZK7M 1QQIA 3CCLS 4J9PA 3QPSA 3MVPA 2M7SA 1IUFA 2NXJA 2J7UA 2ZSHB 5E8IA 2ACYA 4P2FA 5BS6A 4TV7A 4DDFA 3HC7A 1AZSA 3G6YA 2B0GA 2ZH8A 2AU0A 2HBRB 3AOCA 5AXMA 2PBIA 4PQUA 2K9QA 3M8PA 3FZVA 1Y5IB 3IR5B 1DTTA 4M5IA 1BLUA 4C7QA 4NLRA 2MQMA 4Y4RA 1QHHD 2ZDPA 4E7IA 1PSDA 2EV6A 1SKSA 3DPLC 4WKYA 3HRTA 3ZO7A 5HLGA 2AEFA 3QP5A 2MG4A 1U4BA 2DGXA 3ZZ0A 2OPSB 4C8NA 3RKWA 4DWIA 5B0FA 3PXGa 3W2WB 3W9JA 4DV2F 3FXOA 2RQMA 2HZVA 2ID3A 1XNQJ 2JVRA 3PYFA 5H2FC 3D1OA 3V81A 1YJ9S 4OIRF 1LJ9A 1XB4A 2WAQD 2YUSA 5K9FA 4DR7F 4F0MA 2NNYA 3PKYA 1R1VA 2JMWA 2HFNA 3M2UB 2YKOA 4DV4F 3K5LA 3J7AY 3GF2A 3RQIA 3GZ6A 5BYQA 3RU0A 3MCSA 2J5PA 2VT3A 2RIJA 3BTLA 2XF5A 3OLBA 1ZTTA 5FKMA 3MKZA 4K4TA 4C8KA 1NHAA 3MD3A 4J9SA 2WSCC 2M70A 3OUYB 1BR1A 1J75A 3HG9A 1WEXA 3GCWP 3LSIA 2WV1A 2AQEA 2EFGA 3C6TA 2V9PA 2CQ1A 2DGTA 1IUYA 1NK8A 1T7PA 4FXWA 1RHRB 3RW6A 2IAIA 2L54A 2ZKZA 2IMOA 5DCMA 4IHVA 1ELOA 5J40A 4WXDA 5ETTA 4PJMA 5DRKA 4LF4F 4GFBA 2CFXA 1YJVA 3I0SB 1KA8A 3M4XA 3AFHA 4GVBB 1HQUA 2GVZB 1J5OA 1FYLA 1CJKB 5D4LA 3BR2A 5DD8A 2HTJA 1DBDA 3OR1C 1VBXA 3Q0VA 3WQPA 5ETVA 3Q22A 2O67A 2DDBA 2EQRA 1EV7A 2XASA 1WJ9A 5E7OB 3FNNA 3TAMA 1D9FA 4Y6IA 1ZAXA 4EVIA 3KMQA 4LRCA 4Z7CA 2GS8A 2VKHA 1U8BA 3TWZA 2DU9A 5ICEA 4HLXA 5B1BH 1EA3A 4OYZA 4IHWA 4MMOA 2KT3A 1HW1A 2HOTA 3BTCA 1J5EJ 2A61A 2BW3A 3J81Z 1RT2A 5HO4A 2WOMB 5JLXA 2Z4PA 4XDDA 2IYIA 1QRYA 3HVTB 2YNIB 1WOOA 3QFWA 3BDDA 4PK4A 1K7AA 1IV6A 1NRKA 1KTQA 1QVTA 2IA6A 1CJTB 2HRYA 2HLTA 1BXNA 4ZYAA 1WUUA 2NPIA 3CUQC 1SXLA 3Q8SB 4DN0A 4AWXB 3QFHA 4LK1F 2HHUA 1VZ0A 1OQ3A 1YRTA 3QGGA 5HS7A 2CQXA 3OJSA 3LP0B 2XAGA 3AD7C 2ZB9A 4O4GA 4HF2A 4WWCA 3MM6B 2ASDA 3MPVA 1WKJA 2JDJA 1KOOA 4OL8A 5BQTA 4B3OB 1YBAA 3W5XA 4RLFA 1VFJA 1NJYA 2R7UA 3VVUA 1VF9A 4WPAA 2LCWA 2F9DA 3LSMA 4EM0B 3FVYA 1VQ8I 1NSKL 3SZTA 3CJSA 5J1PA 1SD4A 3THTA 4C6AA 3CCVI 5KAFC 1ON2A 3JSOA 5B09A 4WP8A 5A0YB 8RUCA 3TUJC 5LMNJ 1VI0A 3C15A 3I58A 3M8SA 4MHGA 2WB1N 4CLTA 3UN3A 2ILYA 2VOPA 3GE9A 2MTLA 2MZTA 1AOYA 2BHYA 1RUSA 3M7VA 5EX3A 4K0KF 3N28A 2DOEA 3H0GJ 2HHHJ 2Y1LB 2CJAA 4WCEQ 4AU7A 1VDHA 1W5TA 2IHR1 1S9GA 2PEXA 1XMQJ 4TY8A 2E34A 4WFAQ 3I0TA 1DU6A 4CH0S 5B7WA 4C3LA 4N7TA 4A4JA 4QPQA 1B99A 4OX8A 3DLKB 2VICA 5IT0A 2WY7Q 1EETB 2C3MA 2RQCA 3K6GA 4QR2A 5L9XA 3NGDA 3FK4A 1FRLA 4E7KA 1IXCA 1SC3B 3MPDA 3G3ZA 2O1PA 3PYGA 1EQMA 5FRMA 1IBLJ 4OHVA 4ZPBA 2GC8A 5FROA 4X64F 3M32B 4X4UA 3PSIA 3M8WA 1SMYF 3RW7A 5K5RA 3LQVA 4RM3A 3PJ9A 4N9IA 4AFFA 2N82B 3MMBA 2XPUA 2MJUA 2V2KA 4U7DA 5TGTA 2VFRA 3T3FA 1FTRA 4A3CJ 3ABTA 1WPKA 5LLQA 5C4XJ 3TZWA 1RESA 2B51A 3I4HX 4RW7A 4EBDA 4JV5F 2L48A 1APLC 3CJQA 3VWBA 3X3UA 3KUEA 2ZH6A 5KT3A 4Z2XA 4F91B 5JUMA 1J2XA 2KHCA 5KG7A 3MURP 2MY8A 3PDNA 3LPEA 3POTA 5EZGA 1VQNI 4A6EA 2ZOFA 1YE9A 2ZD1A 3LQRA 4B09A 2UVUA 3MN2A 3MAAA 4HQEA 3M8YA 1OCRH 3ABMH 5IY5H 1Z3YA 1AA7A 3Q83A 1UW4A 3US5A 1YRUA 2ROGA 3HMJG 3G1MA 2DHHA 2ZBRA 4CCHA 4H4KA 3BC8A 5FD5A 2E36A 2DXEA 3CO6C 3GCMA 3IAS9 4IOAQ 2ZUAA 2IDEA 2F8HA 3RBZA 1RP5A 5HODA 2JRMA 1D8JA 3MM7A 2NOJB 4C9YA 4OI2A 5GP9A 4UY8I 3MM8B 5KK1A 4IQJA 5AE1A 1T11A 1GVJA 3G82B 4RUHA 3GTYX 4CT9A 3KIOA 3TKYA 3G86A 2Y2ZA 1PIEA 2ZC4A 2HHQA 2YH1A 2IRYA 5LMUJ 1HWJA 3FMWA 3EQLF 5KFUA 4UZBA 4HDGA 2VPWB 3BT9A 1B6AA 4JP8A 2BBYA 4TYAA 3JQKA 2DVIA 1BI0A 4TY9A 1WJDA 1RT3B 2JZ5A 2MW8A 5HROA 4QYZK 4TU7A 5F1RA 4X4PA 2HIYA 3SSQA 1RGVA 2Z2LA 3CMMA 4FKXA 1XR6A 1PYVA 3MZHA 1WVRA 4GCVA 1H6KX 2VV5A 4LLNA 2VXZA 1KDNA 3WG9A 1ZR4A 4DV1J 1S0OA 4LG0A 2C2MB 5JXSA 1MBKA 2ZJRQ 1JGSA 2GAGC 2EBEA 3EPZA 3T6BA 4XR6A 3PNYA 2IRUA 1JMTA 2HI3A 3R3TA 2A69F 4NLXA 4RLQA 4P7TA 3IWFA 1X5SA 4USKA 2MYFA 4B3XA 1XBWA 3N4MA 1D9AA 1XCVA 5IQ6A 2CUFA 4J9RA 1FIAA 2HR3A 3W65A 2DR9A 3FM3A 4U8VA 4XKBA 2OA4A 2DXFA 1SJ3P 3ASOH 1P4XA 3WTVC 5CYJA 5HLHA 2PMWA 5CAAA 3K89A 1HHSA 1IM6A 2D1VA 2KKOA 2M8DB 4DQRA 9RUBA 4HF0A 1DLOB 1U9OA 2E5NA 2CJKA 4C8LA 3BSCA 2V0NA 3EYZA 3SQOP 2A3SA 7AT1B 1UEVA 3DRSB 1IN8A 1ETXA 2VU5A 1S9GB 3F3XA 3S6EA 2ZFWA 4CP5A 4I56A 4C48A 1KFDA 2JSPA 4CM0A 1FFWB 3BO3A 2M3DA 1T38A 3TO8A 4BDPA 3JYTA 4NXMJ 3H8YA 3QWUA 2K3KA 4ZITA 3DLKA 2HKEA 2E60A 2JC1A 2IS6A 4WK8F 1U1LA 3B6BA 3ABUA 4C2TA 3TA2A 2UXCF 5F8HA 5L1LA 2XC9A 2M3AA 4PG5A 1S6LA 3JS9A 2UUCJ 3F0NA 3DXSX 1PC5A 1CQNA 3MAJA 1F36A 3HXLA 3X2QH 4F4ZA 3Q8PB 5JVTA 1YJWI 4OYWA 3FBBA 1NSQA 1S7OA 5IOLA 1HCRA 4D5FA 2MGZA 1GUUA 1T05B 3S2HJ 4GO5X 1GMVA 1UFWA 2K9MA 1RT1A 2LECA 2NS8A 2DGUA 1IBMJ 3KEQA 1JTYA 2WHOA 2MYSA 4QW8A 3FRZA 1CQTA 4QZVB 1Q5YA 2MKJA 2VIXA 3WE2A 4YELA 2CQIA 5DUKA 4O3QA 1R89A 3HSZA 4IRCA 2IGOA 2XF7A 3HUGA 1FNXH 4G7ZF 2Y0BB 1FIPA 2KG1A 1TMMA 2G0CA 3IS9B 4KITB 1SD5A 4UVBA 1RNLA 1W7WA 1D0EA 3HPOA 4LSNB 4Z37A 2F5VA 3W2AA 1YJWS 1UAAA 2YX4A 2G1DA 4HYEA 4B3TF 2B6AA 5C2GA 2DK5A 1FC3A 2IBDA 4NYOA 4M9SA 1JLGB 1H0MA 4E8UA 3J81Y 2XLKA 1Z05A 2KYXA 3Q2SC 1URRA 2R7RA 3OD2A 3GIJA 2F5EA 1WJFA 3KDOA 3FWEA 4H0EA 3X1LB 1UELB 1WORA 3CJ5A 5FDLB 5KG4A 1EX8A 3IG1B 2HHSA 2QFIA 3ISNC 3GWZA 4C3IJ 1XNQF 1O6XA 4OX9J 4ZYHA 1S48A 1IJFB 1H72C 4F7ZA 1UPPA 3L2QA 4BHBA 3T1YJ 2PMZA 1M1HA 1IBMF 5K8MA 3WU2C 1UTAA 2BANB 1W25A 3BYRA 1V4RA 1YLFA 1N32F 2NRAC 3CCTA 4HA8A 2WBRA 3O3KA 3RZDJ 4X1EA 5J3LA 3QRFF 2VL8A 4UUSB 5IV4A 3JTGA 1NSPA 4CDIA 1AUDA 1S6PA 2EPIA 3KX2A 4PXBA 2FJWA 2B4OA 2QQAA 4O3NA 2ZZMA 2BUNA 2CUYA 1N5TA 1RTIA 5LSOA 1YJ7A 2Z99A 3UFCX 3CDIA 1R3NA 1QE1B 4DJAA 1Y9OA 1VLYA 4Y3CA 3Q89A 1VQMS 3C2HA 2CG8A 3BV8A 3SFIA 2CQ4A 1UPMB 3B6CA 2PFDA 1YJUA 1DURA 3SEQA 4M74A 4KIGA 1FJGF 4O3PA 1O3TA 5KFSA 1MD0A 5KFKA 1FEEA 2CRGA 4CLZA 2VUMJ 3V4IB 4JBCA 4DG1B 3BR1A 2FSWA 4EV0A 4URQU 3HIFA 1DTQA 2OMOA 4XTTA 2OZ6A 1HDPA 4C3HJ 3S3OA 3UN5A 5LSLA 3M9NB 3M30B 4KGXB 3R0JA 4M71A 2R7SA 4XBFA 4ZYGA 4EATA 5KFJA 1GVDA 1VQOS 4CT8A 2C42A 1IV8A 4PXEA 2PQ8A 3QNWB 3DI6A 3DFGA 3EETA 3ZN1A 1U0HA 4Y2MA 1FJCA 3QYYA 4RPFA 3UD3P 1LW0A 1O0PA 2M4GA 2O7OA 3C16A 2VFUA 3M1VA 1RB0A 4C30A 1QU3A 2PJRB 5I3QA 3I87A 3D54A 4KKOB 4W90B 2ZITA 2ZNZA 2J76E 3GYHX 1S29A 4R1HA 5C24A 3DLLQ 1PYOB 2CQCA 1IO2A 5DLFA 5KFZA 3EX7B 4FS2A 4JYAJ 4ZJLA 4OWRB 4R5PB 1S49A 3S17J 3CCVS 4IFYA 3WZ0A 1BIBA 3BGRB 1B72B 1X3ZB 3K69A 4CCLA 1S1VA 2R2RA 3QT6A 2X7IA 1EJ7L 1REVB 1R7IA 3LGMA 1RUOA 2KM8C 2MABA 3DYAA 2G9OA 3VWSA 5KT2A 4FXDA 1ODDA 1FTCA 1L3LA 1ZTWA 2KTQA 3FQKA 5LOQA 2MKHA 2J8SA 3F8FA 1RTHA 1EP4A 3K4CA 3QWPA 4N47A 4ZVSB 3WE3A 4LB5A 3UVJB 1RWKB 2XO7A 3AD9C 4I76A 4NYZA 1FX7A 2M9HA 1RTJA 4M9ZA 7FDRA 4DLGA 2VQLA 2ZO4A 2AYGA 3SSSA 4RBTA 4LT6A 3ONQA 5D5WB 5D6EA 4L74A 1YS6A 3LAMA 2XUBA 3Q8UA 3J81j 2OJED 5FGMA 4IOAF 3DHXA 3KPHA 3HOTA 3N5BA 3O8GA 4OJ1A 1FKPA 3OL8A 3J7YU 3Q5FA 4MAKA 1AT1B 2AZ1A 2XO6A 1NB2A 2V94A 2LC2A 2Y30A 5D5UB 2UUBF 1FXRA 1OQ6A 2ZHBA 5E79C 2YTCA 3VOEA 5F6FA 1VQ5I 3TANA 2QJ3A 2HNHA 1D1AA 1K1SA 3ZMTA 2BW2A 2VQGA 4M94A 1VYAA 5A2QK 4KFBB 2CPDA 2MHNA 1HC8A 1FXDA 3JAMU 2R9LA 2IM0A 2V69A 2EWNA 3WGHA 2OPRA 3NAIA 1Q82T 3ZP5A 1SD6A 3TUIC 4V1Ak 2VQEF 3UCGA 4WFNQ 4CLYA 1REGX 5IM0B 3BO2A 2OI2A 4XDCA 1NKBA 3MPWA 2XMVA 2WSEC 2HPMA 2M2BA 1JX4A 1FSEA 1AFIA 1QSSA 4IL6C 3C2GA 4A3IJ 2QL5B 4QWQA 4O4GB 1ZPVA 2DT6A 4ZLLA 3TP0A 4E98A 1XMQF 4OV6A 4F4YA 3M2VB 1MH3A 5K7FA 1YZ7A 2YWGA 4OIOF 3ZRGA 3EVWA 1S7IA 1MJ9A 1GXLA 4YP3A 4LFBF 1FT9A 4U88A 3CCMS 1YI2S 3WTYC 5F0WA 2O3DA 2HXOA 3MFHA 3N6LA 4F7VA 4NLUA 1ZRDA 3R1HA 3JAMZ 2LRDA 4LLGF 3HOSA 3Q2TC 4X66J 4J5OA 1MW7A 4OYBA 1B4AA 2MLXA 2UUAJ 1RHUB 1TQLA 5C42A 5FKOA 2QSGX 4UVAA 4MKAA 1EH6A 4FP9A 3U27A 3CJRB 3D4JA 4HYKA 2HMIA 2COMA 3JXOA 4C9DA 2EV5A 3KOAA 3EUAA 1UMQA 3I0RA 4EWTA 5KFBA 4ED7A 3JB9k 2OKQA 1GLNA 3HOUJ 3OYJA 3C16B 3J80Z 2X85A 2E1MB 4BCAA 1GV2A 4KPCA 2B63J 1TUWA 3KLNA 2HVRA 1MSWD 3ELKA 3CDUA 3DLJA 1HA8A 3RIRA 1D09B 2DISA 2ZKTA 2CV1A 2VJ5A 2JHEA 3VPRA 2N4DA 1FJ7A 2ZXIA 3DOMA 2R0QC 2EG1A 3OR1A 4NPOA 5F27A 4RWXA 4XLHA 1TV6B 4LB6B 4DL0C 1REVA 3IWNC 2RKIB 4K7QA 4XK4A 4K8RA 4U96A 3JCUC 2UVVA 4RBUA 2GHPA 4PUOB 2LQBA 3F72A 1XMXA 4E4HA 5JHUA 1BBYA 2H3EB 2I5JA 4PQUB 2DYSH 2XYGB 4IG0B 5K7HA 3Q8YA 1F0XA 3ZTPA 2BMBA 2HZCA 3GFYA 1J5EF 2HFHA 3Q3SA 2RKHA 1KZHA 4XAKA 2WAQA 3K1NA 2DB1A 3R5DA 2PEHA 1IW7F 2LP0A 3HF5A 5H9EJ 4AM3A 2K1RB 4RGUA 4IO1A 1TMJA 2LDIA 4A46A 1PILA 4RW4B 1VQPI 3RZOJ 3LA0A 5KFNA 4RW6B 1YBUA 2GIFA 4C2UA 3IGNA 3ZQGA 1TW3A 2DJNA 1T0TV 2M4MA 4B1RA 3D6FB 4ECQA 1VC5A 1RA7A 1KGSA 1Z1DA 4RU2A 4YOEA 1KU3A 1X19A 2MSTA 4AYBD 5HOOA 1N6QA 5BR8F 3AJ1A 4TU8A 4XK8C 5FLXZ 2O9LA 3PM9A 2NZ4A 3MEXA 3ECHA 1H98A 2MKIA 3S93A 4JI4J 3NCQA 2V4QA 3D5SC 2BACA 3C6UB 5DD4A 2NYIA 2AJ1A 1L3SA 4IXAA 2JA7J 4LMZA 3AB2B 4L9NA 3BN4A 3KETA 4ZVOB 5T14A 3PR5B 1UWBB 3FMSA 1RTDB 2JUCA 3MGJA 4USMA 3KK3B 2XWYA 1HBOA 3LQQA 4WE1A 3AJDA 3ZZUA 4DR3F 3H1CA 1IRFA 2VKDA 4MJKA 4ZCLA 1PYTA 5F0UA 4ZIVA 3L2UA 1RT6A 2I1RA 4H4KC 1Q8LA 5C2CA 2AQ4A 4FYWB 4UVCA 4OU0A 3VF0B 1W36D 1RZ4A 2AO9A 3NBPA 3K4NA 2JWNA 1ZZFA 3AJ2A 3M2VA 2QA4G 3KG0A 2ASYA 1ZGWA 1K8AT 4I2OA 5A8RB 1T3OA 2FUG9 3N0VA 5HVQC 3VCDA 2M2EA 3MKWB 1KLNA 2UUTA 4ZTFA 1LQ1A 2LEBA 2KT0A 4FYXB 1VI7A 4LSZB 2W8KA 5CYQA 2YPZA 1Y3JA 1E6YA 4NCBA 3CD0A 1NK6A 1YJRA 2O3FA 4CCJA 1GX6A 1UVJA 5DLGA 2GNKA 4WF2A 1IG7A 3HGYA 1E6VB 5HAOA 3EPGA 1Z3XA 2OAUA 4ZLNA 2OTJI 4BH9A 4XRSG 4XQFA 4RW7B 5CH7B 3REOA 2BE2B 1JGGA 2PEBA 4YIFA 1WI3A 4RB3C 4ED0A 1NAQA 5ED4A 4DUZJ 3PTWA 1OJ4A 1ZYRF 1RI7A 2E5JA 2ZC2A 4K2EA 3H35A 1C0WA 2KL8A 2LTPA 3R2CJ 2DNYA 1DPRA 3MR2A 4JOMA 2NPFA 4J91A 2YBVA 1YX3A 4KV8A 3SV4A 2KB2A 4RO0A 1JUSA 3MPYA 5F3ZA 3B78A 3H98A 4F2SA 2CG4A 4RAGA 4F3MA 4IHYA 2PSZA 4QCLA 4QIEA 1RADB 1BN5A 2WZ1A 5LM7E 4Q0BB 5D4NA 1T03A 4FE4A 1ETOA 1QVFR 1YQAA 1LWFA 4BQQA 5D8HB 1HNZJ 4YG2F 3QMQA 5C7PA 2FJDB 3Q24A 1IVZA 1JLAB 4XM3A 2CPZA 1TAQA 1IN4A 2VUGA 3B4DA 2L9SA 3NAHA 4HI2A 5FFXA 3BS9A 1OPIA 8ATCB 5GAGI 3VHQA 3L09A 3BPXA 2XBPA 5E3QA 2A18A 2Q66A 5KFIA 3MZIA 2YQ0A 4KHPJ 3Q86A 3E2EA 2U2FA 4DUYF 2FLPA 5A8WB 3B73A 3DEEA 2JT1A 1JKHA 4Q43A 4MQVA 6AT1B 1TWGJ 2JLFA 1XPXA 4RX6A 4LBIA 2V1XA 4UQGA 4JI0F 5J1EB 1FEHA 3NNHA 4BY1J 4EO8A 3U02A 1S9HA 4A6DA 5ETNA 1DTTB 1HBNA 2F5FA 4X2BA 3I5CA 1Y1VJ 4NXNF 3L2CA 1NDKA 4UNOA 3Q0AA 5G0RB 3Q0UA 2CU7A 1F60B 4W98A 3N9UC 1U5TA 1MKMA 3UQSA 3OYDA 4TY8B 4CCKA 2CZVC 2Q8KA 2B9EA 3I55S 1XTAA 1K9MT 4O3SA 4RM2A 3CCJI 3MECB 2XNQA 1D8YA 3LSPA 1K44A 2HVZA 3MDFA 4X66F 3JR9A 3I31A 4R0EA 3S2WA 3U1LA 3TJAA 2VQCA 1KN6A 4M5DA 3A0BC 3WU0A 1QUVA 4Y2AA 2ATLA 3HVWA 2AEJA 2H51B 4DBRA 3R6GB 2H8WA 5AE3A 4IG3B 1WHUA 2JC0A 2QLJB 1V5IB 2VONA 2FLLA 1S1TB 4F4AA 4V19X 3JRDA 5A6PA 1NDCA 3BOQA 3GV8B 2XI3A 3G87A 2BQ3A 1Z1ZA 4XSZF 4D0PA 2J9CA 5L46A 3WBZA 4EQQA 2VBZA 1F1BB 4ETSA 2CV2A 2V79A 1UP1A 3OFFA 3TQEA 3IKVA 1N36J 4KIBA 2AV5A 1BR4A 2L2OA 4G6TB 1N5YA 1S0NA 4RAFA 3CDEA 4YEAA 1ZLKA 1IN0A 3F9KA 1BQXA 1RWUA 3L1PA 3M9OB 1RHJB 2Q2EA 3ZQIA 2R8JA 3OXFA 4KT5C 1NH7A 3GFLA 1B0PA 4DV3F 2E71A 4RZRA 3TAPA 4F0KA 4ZA1A 2ZOGA 4JI5F 5AXLA 5DM7Q 3MEDB 4CLPA 1KKHA 2JJ4D 2E1AA 1R0BG 5D4OA 1KD1T 3IAM2 1G4CA 2Z3YA 4C97A 3LAJA 2HFVA 1SH3A 1VCTA 3IRXB 1M5VC 1D3YA 3PKMA 3I54A 3HJFA 4TN2A 3FBIB 3MM7B 5KG1A 2GX8A 3BG9A 3NL0A 4WP9A 1YIOA 5I42A 4ED6A 4NC6A 2FZCB 1FT8A 3JAMY 2K7JA 3FF5A 2X1DA 1RHKB 4Y13A 3AG4H 1RKTA 2M0CA 1GEHA 1WELA 3OVAA 1UEUA 1XSVA 2XMMA 3DXBA 3OR2B 3MTJA 1D5VA 2LQ9A 3I5AA 4NLPA 4LF7J 2CZ9A 5JVHQ 1MMGA 3OYMA 5JVGF 4ZKAA 2G7UA 5KFFA 3DU6A 5CA5A 4A5MA 1R8PA 4HX4A 5MLCV 4CTAA 4NYPA 2HFOA 3ILJA 4LF6J 3HJEA 3K8VA 3FFIB 4Z6YA 5IP9J 1UAWA 2QSWA 4OYIA 5K7ZA 3Q8QB 2F4MB 1TVRB 4GKJF 1TL1A 1KYWA 4P73A 1SVDA 1P9QC 1FYMA 3F23A 5HI7A 2J0SD 2HVQA 3LA2A 4A8OA 4DPYA 2A05A 5DETA 1VHFA 4KH0B 1HBMA 3CULA 2VN2A 3IC1A 5D4SA 3IC7A 3BCBA 2FOWA 4RGSA 4R25A 1VQYA 3MM5A 2X6OA 3FEXB 1C4AA 2LVWA 3RKXA 1KLMB 1LK5A 1FVSA 5KNLA 2CJXB 3OS1A 2RMLA 3DOMB 3RBEA 2LFBA 4UV8A 2Q43A 2ZEJA 3ECOA 4BHPA 3G4SI 1FWKA 4DEZA 1EHWA 2J5AA 4XKCA 2F6CA 1HKSA 1ZKGA 2MSYA 4BEHA 4YDDB 3FHZA 2ALZA 2OD4A 4ZYEA 3CWJA 2XKPA 3CLQA 3QYFA 2A3JA 2QCOA 3FIWA 4AT1B 4DSFA 2W9BB 4B9TA 2WC2A 4ES2A 3AQPA 2K1RA 4A48A 3EVOA 4RA2A 3THPA 3BLYA 3A4TA 4LFCF 2C22A 3CJTA 2EC0A 2AWZA 1RDRA 1VC6A 2ZMEA 1RBOB 1UZHA 2P9CA 2ZE2B 5GMDA 2MGZB 1BQNA 3DTKA 3HM5A 1OYYA 1R36A 4KIFA 1YW7A 4DS4A 3F8BA 2ZJPF 3MD1A 2YH0A 1NM2A 1SVMA 4M95A 1HLVA 2FMYA 1PP7U 2G13A 3PW0A 5J2PB 1BQMA 4YB5A 4QIGA 5EX0A 2QSHX 5SUHA 1GK8A 3KG1A 2RHQB 5J6XA 3LSHA 1S1WA 3M8PB 4ZMMA 4KQZA 3S1QJ 4A47A 3G8SA 2NS1B 2IJNA 4MIMA 2NS0A 2CFOA 2QLWA 3ZMSA 1NH3A 1SQGA 2AYBA 5D5XB 5J2NB 1HR0J 3VYSB 3M8JA 2NXEA 1X9SA 4M5GA 1F1ZA 4C3MA 3H4DA 3H5RA 3OPKA 2K3PA 1TT0A 2HBZB 3AY0A 2XAJA 2EW9A 1YW8A 1K78B 4WYLA 4IRDA 2X4HA 1M1GA 1F9NA 1SD7A 3FK6A 2LU1A 2E9TA 3UR0A 1SANA 3E01A 2Y48A 5F8IA 1ETVA 2W7NA 2BYCA 2QA4I 4OI1A 2GXBA 2BEFA 3CEDA 1UA1A 3TBIA 4JI5J 2QTWA 2LF8A 5DDOC 3CMAI 1X2MA 2UVRA 3K70C 4K2XA 1N33F 2J6UA 2XGPA 1FWLA 1RU1A 1X5OA 3DRYA 4ECSA 3P3DA 2W2QP 1R5ID 1BOBA 2F63A 1JUPA 1JQGA 2FLOA 2BYVE 3CC2I 1SBRA 4V19K 2DI3A 1W0TA 3KE2A 3DV8A 3I9ZA 4IRIA 5HL7Q 2VASA 2CPIA 4WIIA 3TEDA 2HOEA 1CJVA 2F5CA 3SCLE 3GP9A 3R7BB 4ZVHA 5RUBA 3IRRA 4CYUB 2CNKB 5D78A 1S0VA 3PRDA 2ROPA 4X84A 4CLFA 2N3OA 4K59A 2V9KA 1U6FA 3KMSA 2BVLA 1OYIA 3BGUA 1R6YA 4I7HA 3PYDA 4P2MA 3V6KA 4GMKA 2RQQA 3ITHA 4DFKA 1C2PA 3O8HA 4Y3OA 5L38A 4N4OB 4A3BJ 1TK8A 1NHUA 3CD6I 1IAWA 1NPPA 1YZ6A 1NDLA 4B48A 4DV6J 4HDVA 3RRGA 1MBGA 3H2UB 5K8NA 3IO1A 3EVMA 3KJFB 4YHHJ 2RJZA 1X8DA 1S10A 4CNZA 2IA1A 4CH1A 1KVJA 2IC3A 1XG1A 4J9NA 1D1CA 3HSRA 4OYXA 4U7UD 3QZ7A 4DPWA 1APSA 2P0WA 3DLHA 1LEAA 5FB2A 5K8OA 1HW5A 3HKWA 3HL2A 3AOBA 3N05A 5IOZA 1MBEA 3GIMA 3RBXA 1X1PA 4FN5A 3HHDA 2XDVA 4LFAJ 1XN9A 3DFEA 3BSOA 3A03A 3MCNA 1SPBP 5M2UA 3WTSC 3RRKA 3ZFVA 5HMYA 4LF5F 1KQ9A 1YW9A 4WIQA 1VRUA 3I4MJ 4F02A 3CT9A 4ZVTB 2GHVC 2KN4A 1VBZA 2L7KA 3HP6A 3AG2H 4LG0B 3LGHA 2DA6A 4ZP8A 1SI9A 2FZGB 2X51A 3OJUA 3VEPA 4EO6A 3BF4A 2IJLA 2MZQA 1SJ4P 1O3SA 2DQLA 3TZYA 1RIOH 1RTZA 3CP8A 3C14A 4EGZA 5JMNA 4NC8A 1OY8A 2D9PA 3BDPA 4ICLA 1MNEA 3DF8A 4K4VA 1HSJA 4IJAA 4B3SJ 1QPIA 3F21A 1N52B 2PD1A 3TUPA 4Q8EA 2R7TA 3DKXA 1P8GA 1HBNB 2HYFA 3CCWA 2WV0A 1O51A 2F4FA 1S7EA 3BSNA 4OI6A 2AMCB 2XSDC 3MUVP 3FCVA 4XMYA 1P9YA 5DDGA 4MH8A 2HS0A 1JKOC 2CJQA 2DA2A 2C6YA 4USTA 1FP1D 2IA2A 3MECA 5DDRC 1WNEA 4BWMA 4BQOA 2R2TA 2D3ZA 2GVDA 3SDEB 2M8EA 2ACMA 1SVLA 3CCUI 2P6SA 4CLUA 2KHMA 3W64A 4YIRX 4RGXA 4LF4J 1N75A 1R31A 5FFZA 3OS0A 1VHIA 4X65J 1VIOA 4I67A 1DDNA 2XMKA 4F3QA 3E3VA 1RWVB 3C1DA 1Q81T 3I5UA 3C18A 2JEIA 1GV5A 1HI1A 1D8KA 3A12A 4WFZA 4F36A 3I59B 1RAGB 2VL1A 4HX8A 2QGUA 1S9EB 3IA0A 3LP2B 4KH1B 1TKZA 5MAOA 1Q16B 4N5SA 4CLWA 3TW6A 6FD1A 4PWDA 4C8OA 3HFZB 3VALA 4ANCA 1YTYA 3PCOB 2BKOA 2FHOB 1NJXA 3HUGB 2FD2A 2WONA 4QU6A 3CGIA 3RZAA 4C11A 2MKSA 1I39A 3P45B 5J4VA 4NI2A 1U0JA 1UL3A 2K4BA 4ALZA 3FEYB 2JUGA 2Q6CA 3IH3A 1D3WA 3DEUA 3OYGA 2D5VA 4AIHA 4U7BA 4OZJA 3DDNA 2NUHA 3O1LA 3M1EA 9ATCB 2GQ2A 3QGHA 4OMZA 4KMUX 2OUGA 2XZDB 4DR2J 1TW2A 4DJBA 2JWTA 1CGPA 4I02A 4R0JA 2LA4A 3V7CA 1NPKA 2LEAA 1SUQB 3DPTA 1ZM3A 1FRJA 4HLBA 3JW4A 3M8RA 4ZPWR 2H4WB 2QX0A 1S57A 2KJBA 4ETZA 3WU1B 2NYHA 4XN3A 1ZM4A 5BPDA 4TXSA 5HBMB 1FNNA 4JV0A 4CYDA 1EETA 3EZ5A 1E3HA 3CZ6A 5J8CA 3BGFA 2XAUA 2UWMA 1WDDA 1JXVA 3QPTA 4ANJA 1SL1A 2LY2A 2CUEA 4O6JA 1WFXA 3HD2A 4YFXF 2HEKA 4DV6F 1Y11A 1TNTA 4HZFA 3IWXA 3U9GA 4NLSA 4RWWA 4F50A 2QEXS 3WTTC 2LLZA 2EEYA 3LSRA 4NLWA 5F0HA 2HHXA 1EP4B 4NDLA 4ILMA 3J81U 4NOHA 3J80K 1WGXA 1R4MB 1AA1B 2RKIA 1GTHA 3OYHA 2OELA 4ECVA 3OFEA 5DQHA 4D7MA 3O2IA 2KMUA 2X1EA 4JI2F 4UUVA 4QWCA 3V4MA 4HV5A 2Z57B 4WU3A 4FT8A 3WHIA 1U09A 2IS1A 1HNXF 4NCGA 2VF3A 4XSXF 3OXLA 1V5FA 1OLTA 3A8IA 4PYDA 3I82A 2QBYA 3HT3A 4F2RA 2ZJPQ 2K5CA 3JAMK 1YHQI 4M3GA 3TW0A 1AFJA 4I98B 2V4JA 2NREA 3J7YI 3KLIA 1Y1WJ 1WTBA 5BXIA 3MUMP 2CQBA 4HQMA 2MGQA 1URNA 3LWFA 3TRGA 1VQ6S 2J5OA 2D2WA 4LIRA 3MPUB 1HL6A 4LF6F 3BG6A 1I6JA 2HFZA 3O2PE 4KTQA 2E1NA 3OYNA 2V2ZA 4MKBA 5C25B 3D6HB 4JV2A 2OEJA 3GYNA 2EXUA 1G2HA 1GNKA 1KS2A 5CZXA 4DSKA 4ELVA 2KXHA 5H6QA 2R42A 3GFXA 2MLYA 2EINH 3BG3A 4NC7A 2OO4A 1JJ6C 4IH5A 1N5YB 1MNDA 4RNNA 2JPBA 1WTFA 2LXFA 2KHDA 4UQTA 2ISYA 3S8PA 1RBLA 4PJ0C 2IS2A 4BC9A 2Z1DA 5CYMB 1TQMA 4FF1A 4WWSA 1OYEA 1RA6A 3M1CA 2H65B 4KO0B 2YKPA 3KHRA 1HYSA 2V6CA 3AKZA 3LA7A 1T95A 3AG1H 2YNFB 3ZXWA 2E66A 1S6OA 3HTSB 3C2PA 4W92B 1QNTA 3UNGC 2MH9A 3KLOA 4N77A 4NZ7A 1IDZA 2QN6B 4RKUC 5D4RA 3K2AA 2EWHA 4XLFA 3MUTP 2EV0A 2QA2A 1F3VA 3V6JA 4I6WA 4DYRA 5E8GA 5E1XA 1J0RA 4DV5J 1R22A 2B4UA 3H2LA 3NP5A 3CUOA 2PC6A 2R5YA 2VPLA 5FLXU 1KSPA 1N34F 3KXDA 3W2VB 5C44J 3K4KA 1DLOA 3GXOA 1M5SA 1CBKA 1VC0A 3LGNA 3JSMA 4LFBJ 2XCAA 1MU2A 4CO3A 1Y5NB 2CQ3A 3OUYA 2XMTA 3H42A 2M8HA 1RT1B 5EDNA 3OSFA 4FBUA 2RDIA 3R8YA 1N54B 1GH8A 2XS7A 4C0OC 4M5JA 2BE2A 1R6RA 3GMGA 3LW5C 3LWMA 3ISND 2FJXA 1S1TA 2HVSA 1OCZH 2JFDA 3VFZA 2L7MP 2PMHA 4LR8A 2PT0A 2QMXA 1WF0A 2E2HJ 3NQOA 3M2UA 2DY1A 1RK8A 3LANA 2DW4A 3QRQA 5HN0A 4NMXA 2V1DA 4B3OA 4F67A 2NXNB 4HSTA 1R7JA 2ZH5A 2V4JC 1V5VA 2ZWPA 1HNVA 5LRSA 2DCEA 3CDAA 3MM5B 1A6QA 5M5XJ 3E51A 2K7KA 3UNYA 3LALA 3MMYB 4LSLA 1G3SA 4GXOA 3GTKJ 5LJ5Y 2GGPA 1H89C 4WTOB 2LF7A 4OQJA 4CA0A 4UOGA 2LXUA 4LR7A 2Y31A 3RG6A 5AJ3J 1P7IA 1QAJA 4KV8B 1LFPA 4GC7A 2B9YA 3TL4X 1V6HA 4L0ZB 2LMDA 1U2WA 4QPXA 4LSNA 2XC7A 1IBCB 1U1OA 1GXTA 3R5AA 1HQ2A 4URSA 1P6TA 1VLOA 1XIQA 1B72A 2VODA 3BGRA 3MEGB 5HMWA 4RW6A 1ZREA 2DOFA 1MMSA 1VQKS 5KFYA 3P8BB 1Q5VA 1S97A 1OR7A 2FNAA 4YR0A 2V8PA 4O3RA 2VE8A 3ZTSA 3RB6A 1WJCA 3IAM9 3PIOQ 1T2KA 1TNSA 1LKXA 3EUHA 2GJFA 5EEGA 5TISC 1VGYA 1GMWA 2BABA 2LQJA 1I27A 1PGZA 4G12A 1X0PA 3NNCA 2IS4A 5M2PA 1FBQA 4OI0A 2X6XA 2KT2A 2FJ1A 4AE5A 4FF3A 4NLGA 1ENHA 1TK5A 4J19A 2L9RA 1P1LA 2KRRA 3M6UA 4I64A 1NK0A 1QPMA 1Y10A 3MZ8A 4ES1A 2WW8A 2MC3A 3WGGA 1JLCB 4NEYA 2HAIA 5KVRA 2FPHX 3SQGA 5IT9U 3MF5A 3QGIA 2FGOA 2L7ZA 3CDHA 3G1OA 2CH0A 1ERDA 3ENAA 2EFQA 1UVKA 3DOLB 5CYQB 1FF2A 3GPAA 1EB0A 1YQHA 1W7PD 4B43A 1M5PC 3K1PA 2K9NA 2XPVA 2STTA 3MR3A 4MEXF 4MK8A 2YVSA 1M1EB 2CPHA 2FX0A 2CW0F 2JVOA 2P7VB 1YHQS 3JSYA 3HOXJ 1BI1A 2LKZA 3EXYA 2KPMA 3C3LA 1R00A 4M5LA 1DGWY 2XV4S 3TUZC 3NOGA 1F4KA 4XPCA 4V19J 1HLWA 2V8HA 2FB0A 4ZCKA 4WZMA 1RWNB 2VZ9A 5L9NA 1Y39A 4M3DA 4ESBA 3AD8C 1K4SA 2HU9A 5HNFA 3BDEA 2ZHAA 3H0DA 1SIZA 2DTJA 3RTVA 3DLAA 3MI7X 4ZJOA 1V54H 2CVIA 1B9NA 2E1MC 2YPRA 5IT9Z 1UZCA 2A07F 3DTIA 3FISA 4BQNA 3N5FA 1BWEA 2CMPA 1OWXA 4IG3A 3LMMA 1BM9A 5K5QA 3SJMA 4GC6A 4E7HA 2EBGA 3LAKA 3U1KA 5FJ8J 2XYPB 3CCLI 2R7DA 2CPJA 1OYWA 3A1YA 4JBAA 1E3OC 1WC5A 3FRYA 5J1UA 3CCMI 3HCXA 2XRNA 3CCRS 1C1BB 5THWA 4NBQA 1IBLF 2X1FA 4LMYA 3UKGA 5ETKA 2PI0A 2AGPA 1EKRA 4K2JA 3R5CA 3C6UA 4AD9A 2JVHA 1DY3A 3V8KA 2E9RX 1RZMA 3BGOP 2LDUA 3PR4A 2KXNB 3QYEA 3EM1A 2Z2YB 3CC7I 5F8LA 1BA5A 2WAQN 2J9EA 4G6QA 2VG5A 4BACA 5KFEA 2ZC3A 2CQQA 5KFCA 2VKEA 2WVDA 3BR3A 2G2OA 4MFEA 4IDKB 3VAJA 2AX1A 3CJRA 2DJIA 4B3RF 2H27A 1T02A 5FDLA 1FHTA 4IF4A 1YLXA 3E6DA 3I55I 1QD1A 4GRSA 2D1CA 5FRNA 3CP2A 1B3TA 3S2DJ 3FC9A 3AA8A 3W60A 1S3JA 4IQ4A 4HHUA 1FJEB 4C11B 3GUDA 1JKRC 1QAYA 3DXJF 3BQ1A 2ZBQA 2DO4A 3RPUA 2DFFA 2CW7A 1HIYA 2C2ZB 3MMCA 3QODA 4CLSA 1F5TA 1YKWA 2DT7B 1VQ4S 1N8RT 4DN9A 4ZZDA 2F1FA 2QQ9A 1WSRA 2Z30B 4PABA 4X4TA 1FKAF 2D3OR 4DPXA 1ZGAA 4A0ZA 4E6KG 2R8IA 3BYPA 4BJ6C 3V4IA 3NRBA 2F8MA 2JOQA 4P2XA 3P5JA 2MJNA 1MMAA 1G3TA 5EF6A 1O7LA 1G59A 2AJ2A 1RPWA 2V4RA 5J47A 1RAOA 1HWIA 1X1CA 2KDOA 1Q8BA 3DWLE 4USVA 4WFBQ 1RYSA 4RMNA 1FCAA 4J7CA 5J1NA 4BU2A 5HNHA 4ZJZA 5HLIA 4ECYA 3KP6A 1IJWC 4OHXA 3T8RA 2K4JA 4I99C 4KSEB 2BQRA 3IXQA 3LSGA 2KU7A 4ID5B 4YDXA 2V6AA 4KDPA 1L3KA 1U0HB 2K9SA 2KRFA 4CCOA 1RWXB 4LVNP 4ABZA 1WKMA 3QWLA 1HD1A 2Y9YA 1ULYA 2B8PA 1N4LA 1USSA 3QGPA 3KNGA 3OTOJ 3DCAA 1AXQA 4TLRA 4LF9F 2P5LC 3BH6B 2UXXA 3VYRB 2BE7D 2JLGA 4XLCA 3MHYA 4AYBA 2JA8J 3R4KA 1W26A 1T94A 1T9TA 1ACMB 1XR5A 2OP5A 3LSJA 4HI1A 1SAUA 3BP8A 2OTLI 4L9JA 4U9RA 3T5HA 1RR8C 1R6VA 2D45A 2HWTA 4OI3A 5HJYA 3ZZZA 1WI9A 3JTNA 3TDZC 1TL4A 4LREA 5K20B 3I71A 3DCFA 1NG7A 4LF2A 2W48A 2BJEA 3OTDA 2ETHA 5L1IA 1RT3A 3C8YA 3EJMA 1JJCB 1LB2A 1RTHB 3J7YJ 4J37A 3BR6A 1KYZA 3ZQQA 1HNWF 1I3QJ 2C2DA 2UUCF 1FESA 3CO7C 4M1KA 1C0UA 1UCRA 4ENMA 4UUSA 4KBIA 3K4MA 4BXUA 4A3LJ 2OCCH 3V6HA 3CJQB 2R7VA 3PVXA 2DEIA 2ZMEB 2ZVSA 3CLOA 1C1CA 4N9HA 1Q79A 1I3AA 3SZGA 3TQNA 3PW7A 3OVSA 4RAZA 2I9SA 4DU8A 4ZVEA 2YSRA 3ILOA 3NY0A 4ITVA 3VYUB 1MNMC 2RQPA 2BQUA 2GXAA 1HR0F 1SC1B 3ROUA 4XLAA 4JI6F 1WHVA 2HFUA 5DG9A 2HYJA 3OWTA 1S1WB 4F8RA 5AXNA 1E6VA 4QIVA 5ILVA 2IAJA 1B70B 2OIHA 1CVJA 4A3MJ 3NARA 4B3TJ 3AB4B 2I10A 3NLCA 3S14J 4OHWA 2ME6A 2CW8A 5KG2A 2Y1JA 3K5PA 2R2SA 5LHIA 2XAQA 1NKEA 3H2VE 3HI9A 2AGQA 2K27A 1U26A 2G1HA 3G6EI 2OH2A 3R60A 2JZYA 4L9VA 2NOGA 3MFKA 4C0HA 1RCOB 4UUXA 2FVQA 3M8QB 4B02A 3TZXA 3F22A 4RR5A 2Y0MA 2DNNA 4OX9F 4ZC3A 1ZARA 4G6VB 2W4CA 4I6AA 1JE8A 3NGSA 2LKPA 1TL1B 3GIIA 3FSIA 4DFJA 5IWAF 4FBTA 2GIVA 4Q0BA 2HHTA 1BC7C 5DO2A 4WK1A 1E17A 1B4SA 2JSCA 1XMOF 2ROEA 5J8FA 2OV7A 3P5BP 4NUBA 2ZBKA 3JSRA 2OCEA 3E0JB 3EE3A 3RYPA 3VODA 3Q0WA 1OY9A 4NZ6A 1DP3A 4DOZA 2W4SA 1RWPB 4ZHRB 4DZ6A 1T8IA 2YS9A 1MG7A 1U47A 2QL7B 3KEYA 1F6TA 3ELHA 1WJAA 5CD4A 5EJCA 2KRBA 3ZQHA 1H3DA 4LD5A 1UW9A 5KFAA 3DEWA 4A3DJ 3DRXA 2XVCA 3MQ0A 5E17F 3D0SA 3ITHB 3IGVA 4N41A 2G7HA 3A4CA 3RJMB 2C3OA 4OX7A 3RYLA 1SVOA 1JK9B 5LSRA 1Q8KA 4II2A 3L7UA 5F8NA 1SAXA 1LFUP 5GAEI 3ENWA 3F44A 1L3TA 4KHPF 5HK4A 3NWSA 5D5VB 1X4CA 2I0XA 1N77A 2DLLA 3SMZA 2G2ZA 5GAGU 5KOXA 4OYPA 3MEGA 2BE9B 1VMBA 1JKHB 1U5TB 1HQCA 4UOCA 1P27B 4UOFA 3SZPA 4AL6A 2DXDA 4L18B 1F2HA 4HOBA 1WD6A 2VJJA 2CDQA 3IBWA 4FPIA 2CPEA 1TU0B 3P96A 3J80Y 1ORKA 2H5JB 2XS5A 4U7UK 5IC4B 1IN6A 1IKWB 1XR7A 3Q9VA 2UVWA 2MY7A 2BJDA 1KVIA 4DGWB 4ZDPA 2JH3A 4ZLPA 1TP7A 4OZ3A 1FTZA 1SEUA 2IT0A 3RCOA 2X1CA 3ZMDA 4O5VA 4WTYA 3DKWA 1YRNA 2DNGA 2DY9A 3DDKA 4KFBA 1U1NA 2MEWA 1MMDA 2DK2A 4A8KA 2FUG2 2B9SA 1UFLA 1AROP 3K8WA 1LUJB 4H4MA 2VG7B 4DQPA 4BWJA 4XORA 1XSXA 2UV8A 1A31A 1B0TA 4JI1J 4OIPF 5EEAA 4ED2A 4WKRA 5CD4H 4L9TA 3CXCR 3DN9A 3BQ2A 4IEJA 3D68A 5E20A 1I94F 3GEZA 2MB0B 1JNRB 4PZJA 4CUGA 1GT0C 2VA2A 1HKAA 2M0MA 1ZAOA 2FVPA 3ZTQA 5CABA 1VQ9S 1YS7A 5E1ZB 3IL2A 2DGSA 4RW4A 5ERIA 3DBHB 1LWFB 3D3BJ 3VAFA 4YEJA 2ZJ2A 4RB2C 5KFGA 4QYRA 4CYCA 3EYIA 3E6MA 2V4JB 4U67Q 3IH2A 2TDXA 2O61A 2DA1A 3PIPF 2STWA 3SCJE 2D3O1 5HDKA 1FK9B 3BR8A 1CJKA 4L5JA 4GGGA 2AJ4A 3G1LA 1CQMA 3G9CA 1NK7A 4U95A 1N25A 3RKYA 1MROA 2ILZA 1JT0A 2IM3A 1ITPA 4NCAA 3KK1B 1S4EA 1W2BR 4DBQA 3A3NB 5ITHA 1RTJB 1HNZF 1WKKA 2RU3A 1G1XA 3KFWX 2GIRA 3OLAA 3OR2A 2YU3A 3CD5A 2KZZA 2QKMB 3J80U 1S9EA 4NI2B 5E41A 1YG0A 2KI2A 1UG2A 3HPGA 1WQ2A 4FHTA 3QO9B 4EMDA 4FNIA 4A69C 3EPIA 1LEOA 3CQZJ 2LR8A 1HQEA 1Q1VA 2W2OP 5FD6A 1ETQA 5GAHJ 4B3MJ 3I53A 4O3MA 5FKKA 3A8KA 2X1AA 1FDNA 1Y0HA 4MKYA 2BE5F 4BL0B 3W62A 4LLLA 3BJAA 4NMLA 4JUZA 1K78A 1HYSB 2BEOA 2DR8A 3RYRA 1OR7C 3H0PA 4IOBA 1BL0A 4HACB 4RGRA 2QYOA 3PIPQ 1D5YA 4W4MA 4ZVPB 1BJZA 5EGOA 3CPWR 3VB2A 3OIQA 4ECXA 1TT5B 2JL9A 4LF8F 1F2GA 1SC6A 4QIWN 4IOCF 2ADUA 2ATCB 1NDPA 1MDMB 1G2EA 2GM4A 3SDGA 1BUXA 3J7Z5 2HAFA 4ECTA 1R27B 2OTJS 4LF5J 2CRLA 2J7KA 2OZUA 3J7AN 4BC7A 3RAQA 4RB0A 1LWEA 3R27A 2W9CB 3BPVA 1GX5A 2FJAB 1ZAVA 4IG0A 1CULB 2QMWA 2WADA 3C46A 1MJBA 2V7FA 1A6LA 2Q1ZB 3LOUA 4B9SA 2PG4A 5LMUF 4HT5A 5B0EA 4N0BA 4XOPA 1IKWA 1PDNC 1GHCA 2CQKA 2I8DA 3VGTA 4O44A 4AD6A 4LF7F 3UWTA 2WVBA 3L7WA 3EUNA 1MJAA 4HF1A 4B3SF 2DCUB 2EIMH 4MFBB 3BGLA 5F9LA 1ROFA 1FJLA 1J27A 5B3SH 1U6BA 3U1NA 4U0WA 3PQKA 5JI6A 2L7FP 2DRDA 3GJQB 4LSLB 3K7AJ 2CWEA 2PA3A 5KFDA 2DT9A 2BOAA 1JLGA 1DQ8A 2CQ0A 4BNCA 2N8GA 1K1QA 5ETMA 1VQ7S 1ETWA 2V26A 2DYAA 2RILA 2FC8A 3KNAA 2QVOA 1RT7A 1D1BA 4W1UA 2VPZB 3VVTA 2XMJA 1WSVA 2XI2A 4E7SA 3L2WA 3HYIA 3NEKA 5C25A 4P2SA 1NSAA 2HMIB 3DYAB 4AXIA 5HVGA 4HT7A 3IH4A 3BEGB 2J6SA 1RT4B 3DMJB 1BQNB 2ZVIA 2DO7A 2MC4A 2ZJQQ 3PEHA 5FD1A 5ICCA 4JQFA 1NG6A 2ZFHA 3OR1B 4NLOA 3LPYA 3RJPA 1JIHA 2KM8B 1FWZA 4DV0F 4TQSA 3TO9A 1WF2A 3H59A 1GXQA 2WB4A 4HVZA 2RRAA 5T7LA 3E3XA 3ASNH 2LY1A 4PXCA 5LRRA 3I0RB 2ZKUA 3DGPA 2BVMA 3BBCA 1XTZA 2H4YB 2K3IA 3OOPA 4F26A 4XO0A 1ZTRA 3ULHA 4DSLA 3NMRA 2MQNA 3VAGA 1UG0A 4IDKA 1XGSA 3E6BA 1O57A 2VFVA 3EWGA 1K6YA 3OYFA 3S01A 1TVRA 1FY7A 4A8FA 2E5IA 3BZCA 1XMKA 1SFKA 4QLCU 1R49A 1NZAA 5L3BA 3N4WA 1LQ9A 1WWXA 2VPYB 3ETOA 3K7RA 2HS4A 1X1DA 4WFXA 4JI3J 2FBIA 3MR5A 3TVZA 3QO9A 4M5DB 1QSYA 2NQPA 4L5IA 3PW2A 5KFPA 4KRWA 2DYRH 3E8OA 1R4NB 4B47A 4P1WA 4ZCMA 3BJYA 2DPUA 5L3DA 5FKNA 3FCHA 1OCTC 5ILUA 5LXYA 4KJZA 2M7BA 1UJ4A 4OLPA 1OJLA 3HTUA 2CA9A 3PY8A 1A7GE 4CZZA 1BW5A 4M5HA 3GO5A 4Q44A 1XEZA 4XLEA 1R9TJ 3D3CJ 2V63A 4J9VA 2IVMA 1RLCL 4ETXA 3IG1A 4G9YA 2HFSA 3CJ0A 2KO1A 1U1QA 3EUKL 4P9UA 3MKYB 2MLGA 2M30A 4B9LA 4BE1A 2DFEA 5D15A 4QTRA 3T5KA 5L1KA 2L3DA 4QOTA 2JEGA 3QT8A 2LYCA 2VJ4A 2LU2A 3Q8RB 3KHLA 1X5PA 3KP4A 2HNZB 2LBFB 1N5SA 1WCMJ 4ENJA 2A2CA 4V2FA 4FNHA 3QATA 2E44A 2EZKA 2IGNA 4X4SA 2ME0A 4NLYA 3P6YC 1CF7A 3CCEI 4ZOSA 2BGCA 4KIAA 1IWAA 1MMLA 4C8ZA 3QT7A 1NK2P 2E9ZA 1WH5A 4FVMA 1N32J 3PM1A 1EF4A 1E6YB 4M9XA 5GAGJ 3QPIA 4A8QA 1JLBB 3CJ4A 1T98A 1WJEA 4RBOA 3OIOA 1HARA 5B0AA 1BOAA 1HMVA 3PEJA 4DFPA 2M1BA 4ECWA 3SZ2A 1UFKA 3KLEB 5IC6B 1MIJA 5F9NA 8AT1B 3S16J 1SMTA 1RWOB 3CUNA 2Z33A 3K5OA 4LG3A 4YFKF 2A5YB 2Z0GA 4EGLA 3R2DJ 1WI6A 4IR1A 2MLKA 3WC0A 4A2UA 3ET6B 4FYVB 1R1TA 3CO9A 2Q3PA 5ETRA 5D6GA 3OMYA 2ISZA 1YVFA 5D8KB 3RB3A 3ZXSA 3AA9A 5KFTA 2XSJA 4L72B 2Z58B 4F0HA 3OYLA 2HPUA 4PUOA 3DBRB 3TOAA 4XRFA 1H7WA 4Y2IA 4X65F 3OSPA 2RHSB 5A2QZ 3FSXA 1C0TA 1QUPA 4MEYF 4MTDA 4YB7A 3HFKA 4BHCA 2VLAA 5L8RC 2W9AA 5J2QB 4LFCJ 2KJWA 2X3GA 2BJ8A 5E0OA 2VDHA 5CHCB 3B8HA 3PACA 1U8WA 1NJIT 1G3WA 1WC6A 1KR4A 4FCYA 2VH7A 1CJVB 2RDJA 4YMEA 2EFWA 4X4QA 1QGPA 3UW1A 1NLKL 4ID5A 1FX4A 1BJAA 4LF1A 2GA1A 3HO1A 3PFIA 3VR1A 4DSIA 2E1PA 4PGGA 1HBUA 1SC7A 3MMJA 4UV9A 4QPOA 2KG0A 1Z9CA 3CIZA 3QU6A 2EA2A 2RAQA 5IT4A 4UB8C 4FYYB 4CYUA 5A2QU 2PJPA 1RTDA 2QBYB 2UUZA 4P9SA 2CS3A 1IR2A 4IKAA 2FD5A 3JQJA 2CAJA 4O23A 2CQGA 5CVVA 1X1BA 2E5LJ 3M4OJ 2HQNA 4PCQA 2YKNA 2ZBCA 3CW2C 4D3GA 4EJUA 5KOWA 3TZZA 3PRBA 1X60A 1WACA 2E19A 5C4JJ 3UD5A 3KTQA 5A8WA 5CLSA 2LREA 4EJOA 1QSLA 5ICGA 2IC3B 4HPQA 3IRXA 3T1AA 2GXGA 3BROA 3MMBB 1BI3A 4TYBA 1IKVA 4ANEA 4FZVA 2YY3A 2RB7A 3FGVA 4ZN3A 1Z0XA 4F4KA 1TWCJ 3UDCA 1N33J 2W1BA 3N01A