2DBBA

Crystal structure of ph0061
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
146
Chain Sequence
b'KLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLGYMYAIVLIKSKVPSDADKVISEISDIEYVKSVEKGVGRYNIIVRLLLPKDIKDAENLISEFLQRIKNAENVEVILISEVRKFEII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative HTH-type transcriptional regulator PH0061
publication title Crystal structure of PH0061
rcsb
source organism Pyrococcus horikoshii
molecule tags Transcriptional regulator
total genus 36
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dbbA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dbbA02
3CO7C 3G73A 4KN7X 2O8XA 1KYWA 2A61A 1ZAOA 2PQ8A 2LSOA 3LFKA 1ZGJA 4M9XA 3WGIA 4N9HA 4KT5C 2O6GE 1XGMA 1IRFA 4EJOA 3BJOA 3GF2A 4GYGA 3GVAA 3GFJA 1G6NA 2O3FA 4EJTA 1DP7P 4G6DA 3GZ6A 5HDGA 2E1AA 4F7ZA 2BBYA 3ABUA 3K69A 2PEXA 3WE2A 2PBIA 2HDCA 3GFIA 1BI0A 5ED4A 2PFBA 2KJCA 3HSFA 2IPQX 2FEZA 1Z6RA 2LKPA 3W6JB 4KA4A 2ESNA 1FSEA 3FHZA 2ZBKA 1IN5A 2ZNZA 2X0LA 3GXOA 1AOYA 2YSRA 1YTYA 2FBKA 4E70A 5LGNA 3J81Z 3ZN1A 5CVRA 1P6RA 2QM3A 4KNYA 3T8TA 2L4AA 3V7SA 1FZPB 1T38A 1BI2A 5LGTA 2HR3A 4N9IA 2DAOA 2BEOA 4IHSA 2EFQA 3CUQC 2J5PA 3V7RA 2GXBA 3LA7A 5K5RA 1XCBA 1BC7C 4OMZA 3VOEA 1H9GA 3F8BA 2XKOA 1YW7A 3GWZA 2D45A 4EGYA 4KIGA 1WKMA 2LNBA 4WXDA 1D8KA 3NEUA 1D3YA 2OBPA 3AAFA 4GYIA 4XBFA 1REPC 2PMUA 3RYRA 2EJRA 2KRFA 3HRSA 4I0BA 3DKWA 4KN4X 4HV6A 4MTEA 5TJJA 4DQ2A 1I1GA 2H27A 3KFWX 2OQGA 2CO5A 4LD5A 4M6YA 1TNTA 1U2WA 1I5ZA 3LA2A 1XCVA 4BAYA 3DPLC 5EEGA 5CVVA 2VE9A 1U8RA 1LEAA 1MZBA 2IJLA 2V9VA 2A07F 4IJAA 1R00A 2A6EF 3WE3A 3LAPA 3ZMDA 5JR3A 4ZYHA 2QVOA 1CGPA 1HW1A 2Z33A 3KP6A 2XUBA 2AXLA 2JPBA 1JHHA 4ETSA 3IHUA 3ZQ7A 2EA4A 4AIJA 3DPTA 2RV8A 2R7DA 5ILUA 2KIUA 1WWXA 1TBXA 1XB4A 3R60A 4U88A 5E8IA 4XLNF 4P55A 1OKRA 1L0OC 3FXQA 4ESJA 4AWXB 5H6QA 4ZYEA 2DPUA 4ZZDA 2L54A 1XDSA 1TQMA 4A6EA 3KP3A 3FXUA 3VEPA 4CDGA 2Z3YA 1QZYA 3I0TA 3C3WA 4CGZA 1TQPA 2OZUA 4JK1X 1BI3A 3U2RA 4U0WA 1IZ1A 3QU3A 5D5XB 3E3VA 1LVAA 1R23A 4Y13A 4HAMA 4RB2C 1UHWA 2VONA 1MDMB 1KA8A 2IRFG 2A3SA 2DW4A 4YFKF 3J81K 5LRSA 5E17F 3J7AO 2UZKA 2GIVA 2C6YA 2HQRA 3K1NA 3HHHA 1HSJA 2JTVA 5ICFA 2M45A 1KQ9A 2QZ8A 4LK0F 3M9AA 1OR7A 3BJ6A 6PAXA 1W5TA 5D6EA 2MLKA 3WTWC 2G9WA 4EM2A 4ASNA 4CICA 2BYVE 3HRMA 3T1BA 4O3MA 3ZPLA 2WC2A 4KUMA 1FY7A 1ZG5A 2KIFA 3OV8A 1KYZA 3ZMTA 1UFMA 2MD5A 3EYIA 2Z5UA 3F6OA 3CUQA 3L00A 3IKTA 2HYFA 2FOKA 4G9YA 2MBFA 1EH6A 1ULYA 1Q1HA 4PZJA 4LLNA 3RKXA 1ZREA 3LAJA 4I7HA 1O3SA 3B02A 2A5YB 1W7PB 2V1UA 3F3XA 2LF8A 4HQMA 1YG2A 4M6XA 2XAHA 1XD7A 4I0AA 3J80K 3H92A 2EV6A 3FXRA 2GXGA 3BP8A 1K79A 2P5LC 3QRFF 3BPVA 4L9JA 4M71A 2XV4S 1DUXC 4IHTA 4G7OF 2UXNA 5HVQC 2P6TA 2OU2A 2L01A 2VOOA 4Q5SF 1R22A 4UVCA 3G3ZA 3L09A 2H94A 2CVIA 1P92A 1LJ9A 1FP1D 3KEOA 2PI0A 3QP5A 3I59A 3KZZA 2NAZA 5DCFA 3RYPA 2RKHA 2DQLA 3C7JA 1R1UA 3V8LA 4XRFA 2QLZA 3BOQA 3KP2A 2W25A 5L3CA 3KZYA 4Y17A 4HF1A 4PCQA 2CW0F 4LMYA 5LHGA 5D5UB 4HDVA 2ADUA 1FBUA 4B8XA 2H6BA 3LQRA 3EETA 4ZYGA 4EV0A 1J9IA 4B09A 4O6JA 1PUEE 4LK1F 1BN5A 2A68F 2XGXA 4ZYDA 4R8HA 5HS8A 3TO9A 2VBYA 3TOAA 1T0FA 1MJAA 2W24A 3RKYA 3KP5A 3TO6A 2E1CA 1S29A 4GXOA 4HX7A 4RB3C 2CFXA 4L5IA 1R5HA 3CTAA 1YQAA 1XSXA 3H3UA 4BHBA 5K5QA 5JHUA 3JSOA 3N4MA 2HTJA 2QWWA 1FYLA 4AVPA 1SD4A 4AIHA 2EA2A 4WX9A 1YLFA 1B9MA 2RQPA 1HW5A 3GO5A 3L9FA 4ENNA 3HSRA 5BPIA 1BBYA 3QPTA 2DU9A 4FT8A 4IRIA 1ZN2A 2JT1A 4HW0A 1R1VA 4KMFA 3GX4X 1HQCA 5CVIA 1VTNC 2HKOA 3O6BB 2PN6A 5HOOA 1K78A 3HUGA 2H6CA 3V7CA 4MTDA 1E2XA 4L0ZB 1QBJA 2CQKA 1NHAA 2V1XA 1BC8C 5BOXA 1EV7A 2FBIA 1ZHFA 1PP7U 1RZ4A 3ZN0A 2XASA 3K1PA 2YPRA 3T0YA 1IUYA 5ILVA 4L0YB 4ENMA 4OIQF 2DFIA 2EFOA 4S05A 1R5GA 2XRNA 1GXQA 1O7FA 1SFUA 1Z91A 5ILSA 4MQVA 3EYYA 1U3EM 1C0WA 1WI9A 4KIBA 1FT9A 2QQ9A 1QO0D 3TKYA 3I58A 4A0ZA 2RGVA 2UXXA 3K1MA 5CVUA 1BOAA 3BWGA 3HRTA 5H6RA 4UV9A 2P6SA 2XAFA 5L3GA 1HBXG 5FFZA 5HLGA 1J0RA 1ZLJA 3F21A 4OMYA 2RC4A 2D2WA 3PFIA 5ICEA 2DI3A 3B73A 2VODA 1KU9A 4IRGA 4G7ZF 2QENA 4ENJA 2PLYA 1KQ0A 1G3YA 5CYVA 3HIFA 4YG2F 1WSUA 1H0MA 3V4GA 3ABTA 5F1RA 3M8FA 4M9ZA 1R58A 5AONA 4HZFA 1QNTA 4KIFA 2ZMEA 1L3LA 1T98A 1F1ZA 5F64A 2P5VA 3HSEA 2M8EA 4MHGA 1KU3A 2ESHA 2FNAA 5DDGA 4IPAA 3RKWA 3E97A 2H09A 1XDUA 4I98B 3WGHA 1RUOA 4WXCA 3CUQB 2D1HA 1QQIA 2MLGA 2IT0A 4CZZA 2JSXA 2VBWA 2FU4A 5DEQA 2XAQA 2HFHA 4LB5A 4Z2YA 5CLSA 2WTEA 2FE3A 1WRJA 2JPCA 4BH9A 2DK8A 3WTVC 2DPDA 1O57A 2V1DA 3WG9A 3T5XA 1I6XA 2QQBA 4BYYA 1SFXA 5ERIA 2NNYA 5L3DA 2OAZA 1TQIA 3R4KA 1YW9A 1DDNA 1U5TC 4Q4ZF 5E8GA 3P9KA 1SFEA 3J80Z 1B6AA 4I01A 2VOPA 2V79A 2NYXA 3QPHA 3O3KA 1USSA 4P9FA 1ON2A 3NQOA 1SMTA 4JBAA 1LNWA 4YIIA 2HQNA 3BDDA 2ETHA 4ESFA 1FC3A 3BJAA 2EB7A 2GQQA 1PP8F 2QQAA 5E1WA 3I59B 2IW5A 1KQ8A 5HS7A 3P7NA 1A04A 3ZP5A 3DFGA 3LSTA 4MEYF 3LQQA 2F2EA 2G7HA 3WU0A 5ICGA 1HKSA 4ZZLA 5H20A 1UHMA 1MJ9A 3WODF 2FXAA 5D8KB 2QBYA 1IXRC 4CXFA 2M87A 2Q8KA 2DLLA 2YX4A 1MGTA 1J59A 3BY6A 4A5MA 3BPXA 1IXSB 3W6KB 1YIOA 5IT3A 1YS6A 2A6HF 1ZRFA 5BMZA 2R3SA 3O2PE 3FM3A 2E7XA 1FSHA 1B1BA 3M1EA 4M72A 4ON0A 2F5DA 2XAJA 1IXCA 3HHGA 3ECOA 4MNUA 2CGPA 5BPDA 4A12A 2VC0A 4U7BA 2K27A 3U1DA 1BJAA 4ESBA 1Z1DA 3ZMSA 1CF7A 2RNJA 3WTYC 4NQWA 5DUKA 5K5OA 2ISYA 1I1SA 4OOIA 2ZJ2A 4FHTA 5D8LB 1B4AA 2GZWA 4LLLA 1YYVA 1EH8A 5LEKA 2LF7A 2EFWA 1ZRCA 5DYMA 3KETA 4HF0A 1K78B 5E1XA 2JRTA 1LDJA 2VC1A 2ZO4A 1USTA 2NRAC 2KIMA 4LJZF 4GCVA 4I09A 1MJBA 2VT3A 4HA8A 3REOA 2VBXA 4EGZA 4M73A 4LG0B 1S3JA 4WCGA 4BHPA 1DPUA 2E7WA 3WTSC 2XKPA 4EJVA 4QLCU 3DF8A 3S2WA 1U5TA 1Z05A 3WU1B 3TQNA 3MCZA 5LHHA 1XN7A 2MA3A 1KU7A 3RPUA 2TDXA 1XMAA 2FMYA 4U0VA 2LDUA 2Z99A 2UWMA 3CDHA 4Q48A 5FO5A 1KU2A 1UCRA 3Q9VA 2E1NA 4HX8A 4UNOA 4MEXF 5DV5A 3GUDA 5J6XA 2HKXA 2Q0OA 5J8CA 4RGRA 1T39A 3CLOA 1SD6A 1W4MA 3TOBA 4YFNF 1W7PD 4R1HA 2ZNYA 3KP7A 4U0YA 1FBSA 2CWEA 3HOSA 4HX4A 4HBLA 5D4SA 3WTUC 3VODA 3IRQA 2DK5A 3E5QA 1ZG1A 4P96A 4L9VA 4LB6B 3TDZC 4KFCA 1P4WA 2CSOA 1BIAA 3R6SA 2HEOA 2ZMEB 2XROA 2VBZA 3JAMZ 3K9TA 3DQVC 3CO6C 2P8TA 3IRRA 1ZH5A 2B0LA 3FF5A 5ICCA 1SMYF 2ACJA 4NB5A 3MEXA 3RTRA 1J2XA 3K0LA 1KGSA 2DTRA 2COMA 4M74A 3RI4A 4OIPF 1MDMA 2HZTA 4KDPA 1IF1A 2F5FA 3FMSA 4A0XA 4FX0A 3Q9SA 2MC3A 4QWQA 3GYHX 4S04A 3C18A 4A0YA 4GGGA 3L2CA 1BI1A 3MWMA 2BGCA 2WV0A 5FD5A 2CYYA 1YS7A 5HLHA 4LLGF 4BNCA 4L18B 2GWRA 1F9NA 3IC7A 5J8FA 1LEBA 4BXUA 1V4RA 5DCMA 1ON1A 2K7LA 4HOBA 1J5YA 1SAXA 3F72A 5LLQA 3QAHA 2HS5A 3DEUA 3ERED 1FOKA 4RGSA 2FNPA 4TV7A 2Y0MA 1FLIA 5IT9Z 4CO8A 3DV8A 5KK1A 2WWYA 2D1VA 1IN7A 1RUNA 2L3DA 5BQTA 5K1YA 1FYMA 4UUVA 1ONVA 2O61A 2CG4A 1G3TA 1G3WA 4UV8A 3JTGA 2YX7A 3I53A 4LGWA 1Y0UA 4MGRA 2RN7A 2V6CA 2M5WA 1W7PA 4U7DA 4NHJA 1YFHA 3P9IA 2Z9OA 3VB2A 4BHCA 1GVJA 2GA2A 3HOTA 5JVTA 1R7JA 4KMUX 2FA5A 1W5SA 1X3UA 2QYOA 4I2OA 5HDKA 5LHIA 2XHKA 1OMIA 3MZHA 4MQ9F 3CUOA 2STWA 3GFLA 4N0BA 1O7LA 2MH9A 3FM5A 5BS6A 3FMRA 3KLNA 3GEZA 3I5UA 1B59A 5LGUA 4ZH4F 4HQEA 3RDIA 3QP6A 1ZRDA 1V3FA 5A2QZ 1FYKA 2F5EA 3IL2A 1BM9A 4R79A 4G8XA 1ZYRF 1J75A 3JAMK 2BV6A 3I54A 5JI6A 2ZCWA 4RGUA 4EJUA 4RAZA 2A69F 2Q2EA 2GA1A 1J7KA 4M9SA 1LQ1A 3D5LA 4RAYA 5LBQA 1CF7B 3E6DA 1OYYA 5AIQA 1RIOH 2Y75A 5E18F 1EH7A 2IP2A 1HW2A 4EMSA 4OINF 4L9TA 4EQQA 1ZG3A 2DBBA 3I71A 4LFUA 1U78A 4L9NA 4OIRF 3PQJA 3T8RA 1P4XA 1OYIA 4KICA 4UVAA 1ZGAA 1Z7UA 2AS5F 5D5VB 3KEQA 2FMLA 4A6DA 3QU6A 4H0EA 5D4RA 5KVRA 5DD4A 5DUIA 1SD5A 5F6FA 3ISPA 4CYDA 2FF4A 5L3EA 5EEHA 4EJWA 5FB2A 2DJWA 1F4KA 2EV5A 4P5OA 3SFZA 4CHUA 5FLXK 1XMKA 5E20A 1ZARA 2XAGA 2PG4A 1FWZA 1WQ2A 1PDNC 3LA3A 3K2ZA 3MAJA 2HTSA 1U6GA 5IT9K 4XSZF 3BROA 1XGNA 2EWNA 4HLXA 1IRGA 3F6VA 2EFPA 1OYWA 3GLXA 3SZPA 1U5TB 3R0AA 1MKMA 3EDPA 2XIGA 5LRRA 1RI7A 5JFRA 3SQNA 3ML6A 4BQAA 1GXPA 1FPQA 4PDKA 1SD7A 1S6LA 2OD5A 3KCCA 3WTZA 2BE5F 3U9GA 3P9CA 5CVJA 3E5UA 3E6BA 2J5OA 2OA4A 1H9TA 2IA0A 3F8FA 1S8NA 4HDUA 3ELKA 1XGOA 4A2UA 2M1BA 3ZMUA 4XLPF 1MD0A 1QPMA 2DQRA 4RGXA 4UHTA 3F8NA 2VT2A 4WXHA 1O3TA 5A2QK 3HYIA 4PGHA 3E6CC 2IA1A 1STZA 3KE2A 2IA2A 4EVIA 1O3RA 2EV0A 1FBQA 3ROUA 5TRDA 2DT5A 3Q5FA 2K4BA 2MH2A 4IRHA 1JHFA 2P7VB 4HLYA 2P4WA 2O0YA 1LB2A 1HSTA 3SXYA 3HRUA 2QUFA 3FX3A 1GHCA 2VN2A 1IN4A 4O5VA 2W57A 2L02A 2FQ3A 3E6MA 2M30A 1S7AA 4P9UA 1TTYA 4AIKA 3VFZA 5FD6A 1IW7F 2W85A 3OOPA 4IXAA 4RB1A 4WK8F 1XSVA 2ZBCA 4ENKA 5DCMB 3SHFA 4HV5A 1DPRA 5D5WB 3D0SA 3HTUA 3FWEA 2HGCA 3N97A 1UB9A 3RJPA 5D6FA 2R7FA 3IWZA 4XSXF 3MZYA 2YR2A 1F5TA 1T2KA 4KYWA 2Z4PA 3COAC 3RIRA 2VXZA 4RS8A 4GO1A 4UVBA 5HDNA 4HYEA 1R1TA 3M7GA 4YIFA 3EUHA 2JZYA 2OZ6A 3LWFA 3DXJF 2EK5A 1LDKB 1D8JA 2G7UA 3GFMA 2ZKZA 3DP7A 3GZ5A 1P4AA 4G6QA 1TNSA 2W84A 2FBHA 1XSDA 2KKOA 3KP4A 4IF4A 3ZMVA 1YW8A 1JE8A 1E17A 1HXDA 3I64A 1AWCA 3IWFA 5CJ9A 2KJBA 2RVCA 2ISZA 2HWVA 3TO7A 4JQFA 4Y15A 2Y48A 1IN8A 1HKQA 3QOPA 2NS0A 3F8MA 1O3QA 1G4DA 4OU0A 4EM0B 2NNNA 4UXNA 3ULQB 4RB0A 1ODDA 3SZTA 5LEJA 3PQKA 1HKTA 5DD8A 2ZXJA 1P2FA 1IAWA 3WGGA 4DNCA 2PJPA 1G3SA 1Z6TA 3ECHA 2XVCA 1RNLA 2GAUA 2ELHA 3JW4A 3F23A 2VE8A 1I27A 2RDPA 3E5XA 4EM1A 3R0JA 3NRVA 3M8EA 3EQLF 1K6OA 5E1ZB 3TGNA 2K02A 4K2EA 2K4JA 2P7CB 3ZMZA 1R36A 5FFXA 2EFNA 4WWCA 1TW3A 2HOEA 3RPQA 3BZ6A 4I02A 4Q47A 4D0PA 2YU3A 2OQRA 1OPCA 3KLOA 3FMQA 1YO5C 4YFXF 1S7OA 2STTA 5L3FA 1QGPA 4PGGA 1TW2A 2IVMA 4IVNA 1B9NA 5FLXZ 3R61A 1LDDA 1BIBA 3TDUC 3CJNA 3JTHA 4L5JA 2X4HA 2L4MA 3FZVA 2P5KA 3HTSB 1FP2A 5AIPA 2DO7A 1XGSA 3MFKA 1FX7A 5FGMA 5HLIA 4OIOF 5HS9A 1QZZA 3L7WA 1Z9CA 4G7HF 4FX4A 4AD9A 3V8KA 2PMHA 3IKVA 2ZFWA 2JSCA 4G94A 1JGSA 2O03A 5L3BA 3H3ZA 3V8JA 3WTXC 1TLHB 1D5VA 1JXSA 1K7AA 4HF2A 4A5NA 1FNNA 3C1DA 3WTTC 3MQ0A 4LG0A 1ZLKA 2FSWA 3GW2A 3I4PA 2HYGD 1T6SA 3JSPA 4WF2A 1IN6A 3F8CA 2FRHA 2F5CA 3F22A 2QBYB 2K86A
chains in the Genus database with same CATH superfamily
3RB4A 4Z7YA 4Y2MA 1VQYA 4F04B 3PRVA 1ZAOA 4M9XA 2MLYA 4N9HA 2RQKA 1KQGB 2KLOA 1LPQA 4PG7A 1S9FA 1IRFA 3HEFA 4A3DJ 3SXLA 4X4PA 4NRUA 1G6NA 3C2BA 2J7WA 4K4UA 2HS0A 3K5OA 1YG0A 2CUZA 4Q8FA 2QO3A 3BQZA 1UJ8A 1IBLJ 4A3JJ 3Q8YA 4OYIA 4B3RF 2MZTA 3DFEA 3PX6A 4G1QA 3HSFA 1S0NA 2L9DA 1SFKA 2YNFB 2OPPB 4J9LA 3W6JB 4KAIA 2MG4A 1BQNB 1FSEA 2ZBKA 5U47A 3CW2C 4PABA 2OFGX 1RT7A 3DWLE 4RNFA 2ZNZA 3MMBA 2RNGA 3CQZJ 3TO8A 1RADB 3GXOA 2JEJA 1XNQJ 2Z2ZA 3Q8VA 2FBKA 2LD5A 4NMXA 4RO0A 3QBCA 3P3DA 3VGTA 2Y0BB 3IP4B 2PI5A 3M05A 4BXXJ 2R2TA 2L4AA 3LGMA 1JUPA 5CQEA 4DV4F 1GTHA 2HGNA 3KWMA 1Y0HA 3CSKA 1YI2S 5KCMA 5DGBA 4FF2A 1OWXA 4YFUA 1NDPA 2HPIA 2Y8YA 1FKOA 2BEOA 1D1UA 1LWFB 3ZTPA 4IHSA 2EFQA 3HD1A 1WI8A 2XZTB 2JC0A 2VQGA 1D0XA 1XCBA 2CQ1A 2VG7B 1FK9A 1BC7C 2FJAB 3KJQB 3MM8B 2XNQA 2YKPA 1H3DA 1VC5A 3CD6S 4DLEA 1Z0XA 3A3PB 3M2RB 2XBPA 5GAHI 4K4SA 2QF7A 4OJ1A 4I69A 4EGYA 2KH9A 3NEUA 4PG5A 1D3YA 2OBPA 4GYIA 2H5JB 1REPC 2OPRA 3BBBA 3HRSA 2F4OB 1ZM4A 2DHXA 4XIUA 2ACYA 4HV6A 4WK3A 3OR2A 3BQ2A 3ZTSA 3SIPB 2DMUA 1FIPA 4M5IA 3UN2A 1J2VA 3I4NJ 3KFWX 3VVTA 2HLTA 2OQGA 2CO5A 4LD5A 3M9MB 4E7HA 1SV5B 4HEA2 2RILA 3PYEA 4BAYA 3EPIA 3CZ6A 1HYSA 3S7RA 1I94J 5CVVA 4NLOA 2DR6A 1U8RA 1JLFB 3FMBA 2V9VA 2CQ7A 3UDCA 2A07F 3AXKA 1D0YA 5KFOA 2FHJD 4AXIA 1MMLA 3T6BA 1VRQC 3BR1A 3CMYA 2IJNA 2QT7A 4F2RA 2JL9A 1XIQA 1HW1A 2B4PA 3M4XA 3Q0UA 4ZN1A 2ZH7A 2AXLA 3QO9B 4DZ6A 5C44J 4C97A 4DR7F 3MPYA 3PX4A 1AFIA 3ZQ7A 4CO4A 1U1NA 2L7MP 5FDLB 4DR4J 3M6VA 3OIOA 1NK2P 3ZQCA 3FEYB 2QSWA 1WHYA 5BXIA 3C14B 1LUJB 3CMES 2HVDA 5E8IA 1IR2A 5EWFA 1OKRA 3ET6A 5IOYA 1U4BA 2HGLA 2R7QA 1A6QA 2H54B 2EFGA 4M1KA 4C2UA 2D9OA 4AM3A 2M2BA 3QJLA 2YKMA 3PNIA 1NK8A 5B7WA 1UG0A 4DUTA 1D9FA 2L54A 1TQMA 1RLCL 2JX2A 4N47A 4CDGA 2Z3YA 2FQ4A 4LF9F 3BQ1A 1YBUA 1TR0A 4DL7A 1TQPA 3K4JA 1SKSA 4ER8A 1UEUA 3UVJA 5D5XB 1HBNA 1ETOA 1LVAA 2DGXA 3CE8A 3U21A 1WJFA 3HT3A 2OJ3A 1HCRA 3EWGA 3KLIB 2J9DA 3CDWA 1T0FC 1YX5A 3GWCA 3VAJA 1S0OA 5LRSA 1IBMF 4DZPA 3J7AO 1Y56A 2R7WA 3TX8A 2UZKA 3FBEA 4PR6A 2GIVA 1BQMB 3KLFB 2HQRA 2JTVA 1CULA 2M45A 1KQ9A 2OF7A 3M9AA 3A4TA 5B0FA 2JRSA 1TKTA 3JSRA 1RU2A 2VDIA 4KV8A 4EM2A 1H38A 4IFYB 1WF2A 4NA2A 3LANA 3W5YA 3RAXA 2WC2A 1DRZA 1FY7A 1ZG5A 3ZMTA 2MD5A 2Z5UA 3CCLI 3R1HA 2OGUA 4YY3F 2XS7A 3QATA 2Y1LB 1KR4A 3L00A 5LL6d 4EUVA 4EATA 1WACA 2MBFA 2BVZA 2E66A 3RZDJ 2J76E 1ZREA 1X4OA 4NWBA 1O3SA 2JLGA 2HNYA 1IV6A 3UDVA 1E3OC 3TEDA 2ZJQF 3GILA 4K4ZA 3MR3A 4XDCA 4B17A 2XS2A 3PEJA 3Q0WA 1ITYA 2BE2B 1PC5A 3P45B 4HACB 2PO4A 3H92A 1T9WA 3FXRA 2MABA 3BP8A 1K79A 2DNLA 2FHKA 1IKWB 1N36J 3MAAB 2XF5A 2IY5B 4J19A 2CJJA 4P2MA 2P5LC 4WTOB 1M5SA 4LRDA 3SSQA 4M71A 2BW7A 3A8JA 4F3MA 5F8MA 2RUSA 3EZUA 1DQ9A 4ZLPA 3MM5B 1VS3A 4G7OF 4CA0A 5D3GB 1UAAA 2I5JB 3L2QA 1NPKA 2IYGA 1WDTA 4UVCA 3G3ZA 4HNVA 3KLHB 1CJVA 3KTQA 3KMSA 3MAQA 4LRCA 5KFIA 1P7JA 3L09A 3MMAB 4Y2AA 2YWFA 3OYCA 4USVA 5E3CA 2DA5A 1HNVA 3GYXB 3VAHA 3GTOJ 2VLAA 4DX7A 1DHMA 4O3SA 2KTQA 5DCFA 3VR1A 1CS4B 2RKHA 3K70C 3HM5A 3V8LA 2EZKA 3TEGA 4A93J 2PMZD 5ETQA 1DTQA 3DGPB 3HSGA 1S6QB 5IY5H 2Z2SB 2DDAA 4OIXA 5L1LA 5HLTA 1FWKA 5HATA 2Q1LA 2MYFA 4LF4J 5LM7E 5RUBA 1S9EB 5EDNA 2CQGA 1HA8A 1PJ7A 4A8OA 1J9IA 1YX3A 4B09A 3LSGA 2HHSA 2CW7A 3PM9A 3SCJE 2Z2YB 2W4CA 1U8SA 2A68F 8RUCA 1QE1A 5EGYA 3FBCA 4R8HA 4IX7A 1O0PA 5HS8A 3E01A 3NARA 3TI0A 3TO9A 2RD5C 3T41A 4YR2A 2QLWA 1T0FA 1FJGJ 4P6QA 2W24A 3RKYA 2WBMA 2W9AA 3AB2B 2M0MA 2OKQA 1U8BA 4RB3C 4C8OA 3DRXA 2E60A 1YQAA 3DLEB 1W36C 1XSXA 1JJCB 3QRRA 1JXVA 2HFZA 3MKYB 3OTDA 4I2PA 3HXLA 1RWOB 4N8NA 1SD4A 2UXDJ 4Y28C 4WX9A 1KEKA 2QKMB 3SFUA 1REGX 1YLFA 2KZMA 4CRJA 4A46A 3G96A 2E29A 2ROEA 3GTLJ 3VALA 3GO5A 1IQZA 3L9FA 1UCNA 2Z2LA 1BBYA 2YWKA 4YB1P 2ZH8A 2DU9A 4IRIA 4KO0B 1ZN2A 1RU1A 4QW8A 4HW0A 3DLAA 1YRNA 1R1VA 3BGUA 4DR6F 4EK2A 3GX4X 1WHWA 2G0EA 1JIHA 2WB1D 4CT9A 1VTNC 2HKOA 1MU2A 3HUGA 2E1MB 2E7VA 4MTDA 2QA4I 1NH3A 4L0ZB 1YZ7A 2QMWA 3LSJA 2LKSA 3MM6A 2FBIA 4RMNA 4PEOA 3EGVA 4R8UA 1ETKA 4NLSA 2HK2A 4LF8F 4B48A 5ADZA 1RZ4A 1R0AA 3ZN0A 2B4UA 4HTIA 2BEFA 2M5YA 5J2MB 3GCMA 1UVJA 3NGUA 1E3HA 4BDZA 5F3TA 2K8GA 1R49A 2XRNA 4DFPA 1O7FA 1SFUA 2ASLA 5T7LB 1V55H 4ZVEA 3BN4A 2KFZA 2DXFA 5F27A 5KOXA 4TYBA 5LT5A 1WI9A 1NSPA 1N5YB 4I6YA 1BLUA 3K1MA 3D4JA 5CVUA 2CZ9A 3RRGA 1BOAA 4MH8A 3HRTA 5H6RA 1IV8A 4UV9A 4F52A 4I6AA 2BBEA 3MPVA 1IBLF 1ERDA 4OLOA 5HLGA 4J9QA 3LGNA 1ZLJA 2ZKTA 3PJXA 4OMYA 1RAIB 2D2WA 2ZFUA 3OY9A 5F8LA 1BGXT 1HQUB 2QFJA 5IWAJ 5ETPA 1URNA 1PSDA 3MTJA 2VODA 2J6SA 4IO1A 2QENA 1Z3XA 3HG9A 2ZFHA 3I56I 5L38A 1V54H 2VASA 2PLYA 1U45A 1G3YA 2ZUAA 4YG2F 4QWEA 3ABTA 1UVLA 5F1RA 1FEEA 3M8FA 1XNQF 1P1LA 4A3LJ 4M9ZA 1X4BA 3CCJS 1ZM3A 2GJ2A 1XG1A 1QZEA 4ANDA 3VWSA 2C22A 1IJWC 4KIFA 1JB0C 2GGPA 1G1XA 4YR0A 1LE8B 2P5VA 2A6MA 1FJEB 4TLQA 1C4CA 4MHGA 2RIJA 4HI2A 2HBZB 4FVCA 1R43A 2FNAA 5DDGA 2MTLA 2XY6A 1CQNA 3MMCA 2H4YB 3DDIA 2H09A 1T9YA 1KVKA 4WZMA 4F67A 2C2KB 4DBRA 1U9NA 1XDUA 1JKQC 1QVUA 4CYCB 3RRHA 2VA2A 2ZB9A 1P1TA 3UN3A 2AHQA 3CJ4A 4IUFA 4CZZA 2C3PA 4U9RA 1OISA 2HFHA 5A2QU 1NDCA 5KFPA 3M9OB 1FMWA 2GMJA 1ROFA 3L2VA 2IPOB 4ZPVR 1Q8KA 2RF2B 1LW2B 3JSMA 1M1EB 1JXLA 2DHSA 4DLGA 2UZAA 3CJKB 2DPDA 2FTRA 5KT2A 1WJ5A 2VJJA 4RM3A 1I94F 1U24A 4BYYA 5J2PA 3BSCA 2JEIA 5ERIA 2VPRA 5L3DA 2OAZA 3SBMA 1K4SA 1YGYA 4DL5A 2RT3A 3J7Z5 5FRNA 1CJTB 5IV4A 4D5CA 2B4VA 2XZWA 1TTHB 3DBLB 3PO2J 5DQGA 4JX5A 2K9QA 1MMGA 3W66A 3V81A 3KYCB 3P9KA 3ZZZA 4J9SA 2QL5B 2F4VF 4AD6A 2JK3A 3OR1A 3PKYA 2L9RA 3UD5A 3EYZA 2DGUA 3TA0A 4A48A 1SC7A 5FKNA 2ROGA 1WJDA 2CV1A 4DR4F 2E1OA 1X4HA 4XL9A 2ZD1B 1SVLA 5FKKA 2LDIA 1HBOB 3CCQI 5M2UA 2ETHA 2GNKA 1R4NB 2XGCA 2R9LA 1FC3A 3BJAA 2GQQA 1WEZA 1KP6A 2IW5A 1WORA 3UQSA 1HKAA 2HNDB 2NYHA 1A04A 4KPCA 3VCDA 3ZP5A 3DFGA 3LSTA 2MJNA 4J37A 3IV5A 4K5SA 3B6CA 4Q8EA 3OLAA 2G7HA 5ICGA 4OV1A 4CCKA 4XM3A 3ISNC 5H20A 1UHMA 2Y3YA 4B9MA 1UA1A 1SB6A 1X4EA 5D8KB 2R5ZA 1U1RA 3CMAI 2YPZA 2EBEA 2JVGA 1MGTA 3G6VA 1MWYA 1U26A 1WJCA 3BY6A 4A5MA 4NLVA 2OTLI 3CVKA 4FYDA 4WBFA 1OY6A 3CJ5A 2QFIA 4ZVPB 4NZ6A 3M8QB 5L9NA 1WG4A 1ZZFA 5AJ3J 3B82A 3O2PE 1X5TA 3SV3A 2NS7A 1X60A 5KG4A 2X1BA 3FKBA 3O6QA 4K4XA 4C9DA 2IBOA 1DZ5A 3HHGA 1UP1A 3ECOA 2F4FA 1XERA 4MTPA 4MNUA 4W1UA 5L8RC 4A12A 1PYOB 2VC0A 2RMLA 4XTTA 3D1NI 3QLHB 3PO4A 2K27A 1RACB 1TL1B 4ECWA 1BJAA 1F9FA 4UUWA 3FUYA 4EO8A 2HG4A 4E7SA 2WVDA 3GLLA 5DUKA 4ZVQB 1I1SA 4LBPA 3FMWA 1T9XA 3HSDA 5K8OA 2LYVA 4LF6J 3IP0A 4F4KA 3PIOQ 2ZJ2A 4FHTA 4RX6A 2QQ8A 1B4AA 5IV3A 4J7CA 2J8AA 1L3VA 3OBIA 3CJSA 4CO2A 3DRSB 2HVSA 3S3OA 1YYVA 2EFWA 3D7SB 2CQIA 3S1RJ 5DYMA 1NZAA 3TQ1A 3KETA 3RCOA 2BRLA 3ULHA 3AFGA 2CPXA 2QSFX 2LVSA 5E1XA 2HEKA 2CNNB 2JRTA 1SVDA 3MM9A 3OYEA 2VC1A 3QYBA 2Y2ZA 2NRAC 2W01A 2RU3A 2MQMA 2MW8A 4I4BA 2YKNA 1KDNA 4F55A 4KC5A 3G4SS 4NI2A 3RQIA 3REOA 4EGZA 4NLPA 2NOJB 1N36F 1BR1A 1POGA 1U0JA 1NH8A 3UR0A 3CC2S 1Y5LB 2M3AA 2RREA 2FJDB 1X5PA 9ATCB 3OYLA 2WVBA 5IYBJ 3WTSC 1RWKB 2V8HA 2ZE2A 4EJVA 1NHVA 4JI2J 1YK9A 3W62A 1Z05A 3TQNA 3MCZA 1GMUA 3DLLF 2IS1A 4M5MA 3UNGC 3RPUA 1N56A 2UUWA 4CUGA 4KJZA 1OJ4A 2NXUA 2CUEA 1HHSA 3AHPA 2DEJA 3ISZA 4Q48A 4ZP6A 2F6CA 3H25A 3Q9VA 3I55S 5DV5A 1WSRA 3KKFA 2ZH1A 2LOOA 4NLTA 1QLNA 4F25A 5FROA 3PFOA 4ECUA 3HOZJ 3MEGA 4X4NA 3K59A 3RG6A 1TKXB 2BQRA 2FC9A 3PRBA 2YNHA 5CAAA 3S6EA 3Q8SB 1VI0A 5J47A 1SD6A 1HNIA 1RISA 4LF4F 1UETA 1N75A 4YFNF 1X4GA 3HZGA 5CCLA 4R1HA 2LKXA 4ZDPA 3KG4A 3HOSA 2B7BB 3CCTA 2ZJRF 5D4SA 4USJC 4ZVFA 2K9LA 1JLQB 3VODA 2XB0X 2H65B 3E5QA 5F8NA 3FFIA 4EZ9A 3QGHA 5CCMA 1RBLA 4Q0BB 1S97A 1R8PA 2CSOA 1BIAA 3R6SA 4P7TA 1S12A 1WHXA 4ZJOA 4JBCA 1FJGF 4LSLA 2GJIA 3M32B 3IRRA 1SC6A 2ZITA 2B0LA 1H88C 1FOYA 3MF5A 2FHMA 2ACJA 3MEXA 3RTRA 3HKZN 3IH2A 1VQ7S 3G1LA 4RW9B 3HULA 3K0LA 3DMJA 5DO2A 1D8YA 3DHXA 3GJSB 2JVOA 4A4JA 1NEEA 4CI0B 2OFHX 2UXDF 1IF1A 3FMSA 4FX0A 1I51B 2YTCA 1UWBB 4EO6A 2X3DA 4ZN3A 1CVJA 4OI0A 2HZVA 5J2QB 1BQMA 3OYAA 3NOCA 5CZXA 2F9DA 3M8WA 3I5BA 3IH3A 1TAUA 1WTBA 1VQ8S 3RUBL 3BKTA 1OCPA 3EUKL 5FD5A 1TMMA 1NRKA 2V7FA 3BF4A 3MUTP 5HLHA 4LLGF 1MSEC 2K5CA 4RW8A 3ZQFA 1LEBA 2A6TA 4BXUA 2ZZNA 5KFGA 3CUNA 2BM0A 3QAHA 2HS5A 2W4SA 2LECA 4TV7A 2Y0MA 5K8MA 1FLIA 1R7IA 1JKOC 2R93J 3ZFVA 2VQCA 2V69A 1RAAB 3NGRA 4C3HJ 1IN7A 1RUNA 3HLUA 2JHEA 4UUVA 1VLOA 1ONVA 4NMLA 2O61A 3ZQQA 2CG4A 5CZVA 5KG3A 2F9JA 2YX7A 1OPIA 3HSZA 1NK5A 2RN7A 2V6CA 1YHQI 2M5WA 3H1CA 1OYDA 4KQZA 4QQBA 4RW6A 4DU7A 4IOBA 2VPYB 3IR6B 4Q5VA 1Y8RB 4OHWA 3AXMA 4HACA 2M7SA 2IDLA 3OS0A 1GVJA 2GA2A 3KOAA 4NCGB 4C98A 4Y0FA 1W5SA 3N05A 2NREA 3A03A 3PHEA 5LHIA 5LOQA 2VFTA 4MJKA 4F4AA 4AXJA 2F8EX 2XGPA 1IO2A 5IWAF 5A8WB 3V6JA 4N0BA 3T1AA 1O7LA 3A3NB 4KHPJ 2FD2A 3KLHA 1LWEB 1A0OB 1BQXA 3FMRA 5KAKA 2CQ2A 4HQEA 3QP6A 1S5LC 3CTRA 1Y10A 1MSWD 2PX9A 1FDNA 5A2QZ 1FYKA 4QOTA 4BY1J 4R79A 2Q6BA 5CABA 5KFQA 1J75A 3I54A 5I3UB 3DGPA 3EPZA 1S6QA 1RTHA 1WC6A 4ID5B 4OYPA 4Y33A 5EHHA 3SFIA 1LQ1A 4CCOA 4K8RA 3TP0A 3E1SA 1RTIA 4ECSA 3FDYA 1NHUA 1X1CA 1YJ7A 4XMYA 1CF7B 1RIOH 2Y75A 1TL4A 1EH7A 4DQPA 2D3OR 3BGRB 3MDFA 3SCIE 3ESWB 2IAJA 3PQJA 3G8SA 4DPXA 3T8RA 3DTIA 1WI6A 1OYIA 4KICA 3QT6A 1ZGAA 5C3EJ 2AS5F 1H0HB 5D5VB 2HXOA 2FMLA 1YJ9I 2WAFA 1N78A 2UVVA 4OHYA 2BJ9A 2FF4A 5EEHA 2DJWA 3FK4A 2EV5A 1XEZA 1GT8A 3QYYA 4P5OA 2HQAA 1YDLA 1CC8A 1WUUA 3J7ZT 1XMKA 4I7FB 4CIOA 2PG4A 1W26A 1FWZA 3BQYA 1WQ2A 4AL6A 2BKOA 3MOJB 1FD8A 4V1Ak 2O01C 2UUTA 3CEDA 1VI7A 2O7OA 3D67A 3N5FA 4O0NA 1U6GA 2VD3A 2BY0A 5IT9K 1GT0C 3C2GA 4BBRJ 3VPRA 4BE1A 2Q66A 4CLYA 5D15A 2M0CA 4RPFA 3P4UB 4KBIA 4B9SA 3PKMA 3ILJA 3RZOJ 2DNQA 5BR8J 1HBUA 1OQ6A 4YHHJ 3FDSA 1Z2ZA 2NYIA 2BJ1A 3CF5Q 1MKMA 5LRRA 1IQTA 4USIA 4IG3B 4ZP7A 5C5JA 1PO6A 1RI7A 2JWTA 3SQNA 3ML6A 5MLCV 1JKPC 1HQEB 3CC4S 4M3FA 3IAS2 2HBYB 3KCCA 1RB0A 2JMWA 5CVJA 4F36A 4LUBA 5HP1B 3TZWA 3D9BA 2J5OA 5KAFC 4F4ZA 2ZDOA 4RW7A 1VQ5I 3F8FA 2HZAA 5CQGA 5HMYA 1SQGA 2IRUA 1N4LA 3MMJA 3D0GE 2GM4A 2V0NA 1C0TA 2EILH 5T41A 2M8HA 5T7LA 2V8GA 2J7KA 4JI0F 4XLPF 2MKHA 4O44A 1QPMA 2DQRA 1QY7A 4RGXA 1N5YA 4YEAA 4WXHA 1O3TA 4PGHA 3E6CC 4MKVA 3KNGA 5AJ3F 2IA2A 3AG2H 1N6QA 1FT8A 1TUVA 2EV0A 5D4PA 5D8HB 2H1KA 1DP3A 1NLKL 2ZC4A 2DMPA 1QJHA 4UZBA 5C4JJ 2MH2A 2CRLA 1RWNB 2ZSHB 3M2UA 1EIYB 3K4KA 2BA9A 3DOMB 4BC7A 3SZ2A 2O0YA 1HQUA 2MKSA 3BM7A 2RQMA 1S9GA 2LRDA 3FX3A 1AXQA 4DSIA 2WB1N 3DU5A 2VN2A 5M3FJ 2VKZG 4NBQA 2ALZA 4X65J 2L02A 2HWHA 1YJWI 4LFBJ 2FQ3A 2ZXIA 2MY8A 3FK7A 2GVZB 5F41A 2ZVIA 5FD6A 4DR5F 2EBGA 5LSOA 3IR5B 1K83J 2KJVA 5GVQA 3PNYA 2IS4A 3CGIA 2DCEA 1QAJA 2UU9J 1C1BA 3UKGA 5EJCA 4RB1A 2PC6A 2OSRA 4PG6A 1NO8A 1V5VA 1XSVA 2DO4A 2CPFA 2L5QA 3OYDA 4ZITA 5CYQA 1Y3KA 1R6YA 4ENKA 2H9ZA 3N28A 2OTJI 1ZM2A 3FWEA 2EC0A 3N97A 2C2ZB 2R7UA 2LA6A 3BZKA 4LSNB 1D3WA 2CADA 1AHDP 4CYCA 1YI2I 1KWMA 1HL6A 2XTJP 4FKXA 2UXBJ 5B1AH 2B4OA 5IT0A 2YR2A 2BXZA 2ICWG 1OO0B 4L75A 3TAMB 5CHCB 3VTIA 4GO1A 3S01A 3IC1A 5HNFA 3W2WB 2EEYA 1NMEB 1LDKB 4CH0S 3GV7B 3SDEA 1S48A 2K3FA 1F5BA 5IC4B 1KLMA 5KFHA 2GHWA 3DYAB 5K5MA 2G7UA 1GV5A 2POKA 4MIBA 3N6MA 3FBNB 1RKTA 2W2MP 4DOZA 3CESA 2JLEA 1N5SA 2RDDA 3SZGA 3K5LA 2IRYA 1RP5A 2IYIA 3S1TA 3C15A 1EQMA 4MK9A 3DXSX 1U6ZA 2GZOA 1PG5B 2CA9A 2EKYA 4D7MA 4RA2A 5KAIC 2HZDA 3D6FB 2BJEA 3LP2B 1HXDA 3CCRI 2O1PA 1YOVB 1AWCA 3IWFA 5DQIA 5EUHA 5KFVA 4C3KA 4DG1B 3TO7A 2ZXWH 4JQFA 2BM1A 3QOPA 1HBOA 4RM2A 2HPUA 2XHWA 2HQGA 4MFBB 4EI2A 2XSJB 1NK6A 4FKYA 1MBKA 1RYRA 3MEDA 4EM0B 2UUAF 1NHKL 3I5CA 4DSFA 4RB0A 4ZP8A 1ODDA 1FNMA 5LEJA 2P2CB 4DMZA 1T9TA 2BKNA 5E3LA 1X1PA 1P2FA 1FWLA 3MCMA 4A8SA 1WTFA 1K0TA 3CMEI 4NLGA 2B9EA 2AZ3A 1HARA 3GIIA 3ECHA 4OZJA 3KIOA 2GAUA 4Q7AA 2ELHA 3ILIA 3F23A 3POTB 3WC2A 1SH0A 2FLNA 3W5XA 3E5XA 4C11B 1CG2A 4EM1A 4EYIB 3M8EA 1K6OA 2FZKB 1FIAA 1H72C 3TGNA 3PR5B 5IP7J 5HVHA 4Z2XA 2K02A 2YNIA 2XG8A 2P7CB 3Q8PB 2HQFA 2BE7D 3ZZPA 3DDKA 2J6TA 5EZGA 1EP4A 1OYEA 2CJXB 5A6PA 4G3IA 4C7QA 5HQLA 4D0PA 1TQLA 4MFEA 3QMQA 5FKLA 1R6RA 4OYMA 1SANA 2L9NA 3TANA 1XR6A 3QLHA 3D2WA 2L9SA 2M4GA 1YO5C 2VV5A 1NNDA 1B72B 2MZJA 5EX3A 1QPIA 3SSRA 1QGPA 2ME0A 4B9VA 4D1QA 1VOMA 4F4WA 1TW2A 1NPPA 4FP9A 3MN2A 2GQCA 3CJQA 1VRTB 2ZZMA 3BGLA 2X4HA 2KFNA 1N8RT 2P5KA 1AT1B 4OZ0A 2W9BB 2CMPA 2NVTJ 1U1MA 3N79A 4NZ0A 3BZCA 1FX7A 5FGMA 3EE3A 5KFBA 2DJIA 3CJ2A 5G0RB 4NEZA 5CD4H 3DI6B 4NLYA 1FFWB 3V8KA 3M6WA 2G1HA 2ZOGA 4IOCF 3AB4B 2JSCA 1H98A 1JGSA 1B7FA 3V8JA 5ETTA 2AMCB 2VKVA 2ZUGA 2AP6A 3WTXC 4USMA 1IKVB 5KT7A 4A5NA 1FNNA 4B3SJ 2E9ZA 1IKYB 2O9LA 3CDUA 3VYRB 1ZLKA 1F9EB 1NG7A 2FSWA 4BXFA 4QR0A 5KT3A 3B6AA 4E2FB 4M5JA 1CQTA 1Y8QB 4IH6A 2UV8G 4FS2A 2HQIA 3M30A 4JX4A 4KHPF 2BR0A 2ATCB 4KN7X 1LVKA 5F8JA 2A61A 1NSKL 4X4QA 2LSOA 2ZHOA 3R2DJ 4IHVA 2CPZA 5B66C 3WGIA 1BOBA 3QT8A 4KT5C 4M3BA 3V6HA 4UUTA 3K2AA 1R89A 3VYSB 2GA7A 5DM7F 2ALYB 1XGMA 1TVRB 3BJOA 3GF2A 1NM2A 1E6VA 1Y39A 3MPUB 2O3FA 5ITHA 4EJTA 3D28A 5HMZA 5HDGA 4ETZA 4F7ZA 5EG0B 2CPHA 2PEXA 1IRZA 4IO9F 2HDCA 3GFIA 2MQLA 2AJFE 1BI0A 1WVRA 1NJYA 5IM0A 2A6OA 2XB5A 2L7KA 4P7VA 4WIIA 4YB7A 2FEZA 3R1LA 8ATCB 2DA7A 1PYSB 2ESNA 1DJ0A 1ZZNA 1RT4B 1O6XA 4NQWB 2IDEA 3LUYA 1IN5A 4IFVA 5L1JA 4CP5A 2E2HJ 3ENVA 4U6PA 1DY3A 5DGAA 3K4NA 4K5RA 5GMKa 1AOYA 5GP9A 5C24B 2ZJPQ 3AL0B 4E70A 1CC7A 3J81Z 2OD4A 3PW4A 3LAKA 3ZN1A 5F0WA 2Z8QA 2OCEA 3QQAA 3B78A 3L2RA 2VB6A 4KNYA 2R7XA 4U87A 2LQBA 1T38A 1XNRF 2WK4A 3HBLA 2HR3A 3M2VA 1WOSA 2DH8A 3D1OA 4M5DB 3T5LA 3JREA 3M1VB 2Q3PA 1IUFA 3M8RA 3MD1A 4BACA 1ETQA 2V26A 2AGQA 1JGGA 4HDGA 1RABB 2LG4A 3V7RA 1YRXA 3LA7A 1T94A 5K5RA 2P0WA 3L7PA 3VOEA 5AE1A 4S0MA 1MN7A 4OAZA 2XKOA 2U2FA 4P52A 2QGUA 1YW7A 1RT3A 4OI3A 3IWNC 2IIHA 4E7KA 4KIGA 1D8KA 2M70A 5A0YA 3RYRA 2A0FB 4UOGA 2FJVA 3DKWA 3OXGA 1RJJA 1WG1A 4KN4X 3VF0B 5BR8F 4YHHF 3W64A 2FQQB 1GUUA 3NNCA 6AT1B 5E3PA 2Q43A 2V1NA 2RHSB 1TNTA 3C46A 1VQ6S 4UOFA 1OCTC 3GR0A 1TL7A 2EIJH 2NPIA 2VE9A 4MKAA 3BSOA 4ECRA 3NWRA 1LEAA 2OPTA 2IJLA 2WSFC 2V50A 3TJ9A 4IJAA 2WOMB 4DL2A 1R8BA 1LV5A 3WE3A 4G6VB 5H2FC 3LAPA 3OVSA 1OJLA 3HC7A 5ETOA 3V4MA 5F9LA 3ZMDA 1K44A 2BJ3A 4HHUA 2AJ2A 4ZYHA 2XDVA 3J7YJ 3KP6A 2XC7A 3KUHA 2DMTA 1ELOA 2JPBA 3PIPF 1X0FA 2NVQJ 2XMTA 4ETSA 1SJ4P 3IHUA 1WJEA 1VR6A 2B0GA 4O4GB 3HHLC 3DC2A 1FTRA 2R7DA 5ILUA 3IWLA 1XJWB 3C6TB 2KIUA 1XB4A 3OUYA 1S4FA 5HBMA 2BQ3A 5GAGJ 3FSXA 4ESJA 2CQ3A 4HHJA 2ZEJA 2IC3A 1IKXA 4CLTA 5B0CA 2DPUA 1PIEA 4LF5F 1KQFB 3TW6A 4ZZDA 2O3DA 5MAOA 2MQOA 3OPKA 3M1CA 1RA6A 1GNKA 4Y4RA 4MIAA 4LQ3A 3H36A 3OQ2A 5F08A 5L46A 1SJFA 2EXUA 1Y00A 4YQWA 2I8EA 1BI3A 2DA2A 1LWEA 1TL5A 3U2RA 4HVZA 5DDOC 3S1NJ 4XLAA 1UW4A 4X65F 4Y13A 3HHKA 4HAMA 3AD7C 4YEJA 3QWUA 1UHWA 4LFBF 1U1PA 1KA8A 3DM2B 1WWHA 3FSYA 1C4AA 1MWZA 1Y7PA 1FRXA 2HDWA 4NA1A 1MLAA 5I3UA 1RCOB 4X1EA 2UU9F 4Y7NJ 5TISC 2WW8A 4ID5A 3IBFB 5ICFA 3CMQA 1EHWA 2MC4A 3JXOA 2VFVA 4LK0F 3DKYA 3TNVA 3BJ6A 2V67A 6PAXA 4TU9A 1RXOB 1ZA2B 2OPSA 3CCJI 3QWPA 1EJ7L 3I9ZA 2M4KA 2FJBB 3CJRB 3U27A 3BO4A 2R7TA 3DHWC 3H5NA 4O3MA 3S14J 3ZPLA 2DDBA 2YX1A 5DZ6A 4KUMA 2KIFA 4FPRA 4PKDB 3JSBA 3OSNA 1UFMA 2N4CA 3F6OA 2XYHB 3UDEA 3JTPA 1CBKA 3I0RA 5K8PA 2Y0SA 2QA4S 3G9CA 2ACMA 2I8DA 4PG8A 4XKCA 2FOKA 4TXSA 2M8DB 5CYMB 1NJXA 1HW8A 1EH6A 1ULYA 1H2UX 3NWGA 2E5HA 4U7CA 3C66A 2F63A 4XK4A 4E7IA 4BEHA 3B02A 3KHGA 3UFCX 4D9JA 3F3XA 2WTFA 3CCES 2HDDA 1XX5A 2XAHA 1XD7A 1PAUB 4I0AA 3JQMA 3J80K 3FKJA 3MR6A 4IHXA 4ED6A 2EV6A 1SXLA 4FETA 1TKZA 2DD8S 1JNZB 4Y2KA 1HBMA 1U1LA 4LIWA 4LBIA 4TN2A 5DM6F 2DN0A 2LKZA 4KGZB 3T9NA 2QA4G 2W82A 2IJFA 4PXCA 1PJ6A 4XOTA 2P6TA 1JKHA 4E0DA 2A2DA 2OU2A 2L01A 1ZAWA 4II3A 3GTJJ 4Q5SF 1BY9A 1NTCA 2AX0A 3ZQHA 2Z2MA 3ZTQA 3TZZA 2DPJA 1IUJA 4A3IJ 1P92A 2GAGC 5TGTA 2LYCA 3NNHA 2PI0A 3HHLA 3QP5A 1OCZH 1FEXA 1NSAA 4LSZB 2L9WA 2I6WA 1JJ2R 1R1UA 3SDGA 1MMAA 1HR0J 1TWFJ 5IT9Y 2RRNA 1TC3C 1EKRA 4NYZA 3JTOA 2XLIA 3GJRB 4G1QB 2HZCA 5LXYA 5GAEU 3DLJA 3OVAA 5LHGA 1R3NA 5D5UB 4HDVA 5HNHA 3OL4A 4URSA 4JI3J 3GTPJ 1K1QA 2FVRA 3CJ3A 3HZEA 2HHWA 3LQRA 3FEZA 1LOUA 1R4MB 2KM8B 2E36A 2VA3A 4DV1F 1E6YA 1RT7B 1ZK8A 3MMBB 2YQ0A 1ZA1B 3ABKH 3NEKA 3EZOA 2V4JC 2BE9B 1IXKA 4LRFA 1FHTA 4Y34A 4DUZJ 1R8HA 3QYEA 1F36A 4OHVA 2XMAA 4XLCA 4DSKA 1RUSA 2HS4A 4UB6C 2CJBA 2XSDC 4KT0C 1A36A 1S29A 1FKOB 1ZAVA 1MN9A 2C3OA 2DEIA 5KG1A 1GX6A 3GTQJ 3PW2A 1GDTA 1R5HA 5KG7A 4A8MP 3OFEA 5K5QA 3D68A 2VJUA 3GTMJ 3PV8A 1T95A 1FK9B 3N4MA 2HTJA 2V34A 1F2GA 4L76A 2EA2A 2GVZA 2EG1A 3OTOF 1J5OA 1UPMB 4DHVA 2DNOA 2RQPA 5GTIC 2AQFA 2OPRB 3N6LA 1HW5A 5D4LA 1S10A 2GIZA 4ENNA 5BPIA 4YDDB 1TP7A 2HS3A 3Q89A 2V2QA 3OR2B 3ASOH 4KMFA 2K3KA 3CCYA 3JAMU 2XS5A 1RGVA 2QG9B 3O6BB 3UNYA 5HOOA 1K78A 2H6CA 1XMOJ 1HYSB 1JUMA 2K9NA 4BWJA 2QL9B 1BC8C 1KC8T 4URGA 5HROB 3FIWA 4CLSA 3RRKA 2BVMA 1YJUA 3FISA 7FDRA 1VNDA 5JVGF 5EZHA 3R9LA 4DWIA 5IFMA 3TAMA 2XHCA 1DGRM 2R2UA 2OJED 3K1PA 2QMUB 1IM6A 3T0YA 1RTZA 5LD2C 4L0YB 3BPDA 1VMBA 3C16A 4MLOA 2BJDA 1GXQA 2VFUA 2AGPA 3QGGA 2HYJA 4MQVA 3CC2I 4H4MA 3T19A 1AROP 4USUA 3ET6B 5C42A 1RHUB 1U3EM 4KIBA 3BR0A 1QO0D 3I58A 2DGVA 4A0ZA 2DT7B 2KXHA 1YBTA 2YKMB 3P49B 1R71A 1MBGA 3K89A 1NK9A 3ZTRA 5KFFA 3I0SB 1HBXG 1N5VA 3BH7B 2ZOFA 2NXEA 2EK6A 3RYLA 2HOAA 3I55I 4LITA 4Q2MA 1YJTA 1WC5A 4MFBA 1VFCA 1HBNB 3UR3C 1PC4A 1FI4A 2C42A 1HOMA 5CYVA 3HIFA 1S1TA 3V4GA 4OI6A 1OQYA 3CCUS 2E5NA 2I0XA 4BQNA 3T1YJ 5GPAA 4JI1F 3HVWA 1HI8A 1CJKA 3TP3A 5C2GA 2HQDA 3L2WA 3G71S 3MKZA 1CULB 1KFSA 2Y9YA 2V4JA 2YWGA 5EN1A 1RT6A 1L3LA 1TKTB 4TY9A 1T98A 4AC0A 3H7HB 5F64A 2ATLA 2VQFJ 4KV8B 1S0VA 3OT9A 2LY2A 1U49A 2ESHA 3AOBA 4C11A 1EAYC 4YS2A 2AF6A 3E97A 2LQ9A 3KHHA 4A47A 3BG7A 4ZTJA 1MBFA 2XCAA 4XOPA 4P2SA 4ZS6A 1KLNA 1FXRA 1UMQA 5IP6A 2MGZA 1VQ7I 1IJEB 2D1HA 2MLGA 2KHMA 2BX6A 3FQKA 4LBHA 4OYBA 1S57A 1NAQA 1N33J 2XAQA 3R5DA 3QRPA 3VDXA 1W1WE 3Q24A 4WTYA 3K0JA 2AU0A 1N48A 5CLSA 4K2JA 3H5YA 1WEXA 2HNYB 4BUPA 2FE3A 1EKEA 2PIIA 1WRJA 2JPCA 4KITB 2HHHJ 2DK8A 2E2IJ 1RAEB 2I10A 2HBQB 3O3LA 4BQOA 4I6ZA 4XICA 2I1RA 4X66J 4DN0A 3WG9A 1VQ8I 2WSCC 4D3HA 1EETA 1S1WB 2GV1A 7FD1A 1MNMC 1OY9A 4HKQA 3PL8A 2ZH3A 1TMJA 2L7FP 4QPQA 3R4KA 1YW9A 1IDYA 2VPLA 4OI2A 1U5TC 1D1CA 2HVQA 3IXQA 2K1RA 2F3JA 5LXRA 1YBAA 3R5JB 3Q0AA 5LFAA 3Q8UA 5C25A 3DLHA 5JLWA 3KUEA 1ON2A 4GO5X 1CJVB 2DOAA 4ECZA 4JBAA 3PR4A 2HQNA 3BDDA 3DBHB 4ESFA 4ZCKA 5A6WA 4E7LA 3GMGA 3HCXA 1QVFR 1HNVB 2AGOA 3H2LA 4ICLA 4MEYF 1G2HA 3TJ8A 4DV7J 4PRFA 3GSIA 4NC7A 5AE2A 5J4YA 2F2EA 4Y2CA 3EDQB 3WU0A 3CXCR 4I6WA 2VPZB 3AY0A 1MJ9A 4QTRA 3PUBA 2NR0A 2FXAA 2DNKA 2RKIA 4CXFA 2PT0A 1S6OA 2LCWA 3NWTA 1A35A 2YPYA 2DLLA 1UVNA 4DFMA 3GG1A 4WFYA 2OV7A 1U9OA 1J59A 2NZ4A 3BPXA 2M7AA 5FLMJ 4OX7A 4BDPA 1YIOA 2BKPA 1P7IA 4I1TA 1U1QA 2OO4A 1YS6A 2D3O1 4RNMA 5BMZA 2R3SA 2CPIA 1Q4RA 1FD2A 1RKIA 1OCRH 1U6FA 3E01B 3EJMA 1RZMA 3W65A 1VJQA 1RK8A 3LSIA 2K9MA 4M72A 3CDLA 4ON0A 3CD5A 4FDFA 2FX0A 2FPHX 5DDRC 1A6IA 1IXCA 5BPDA 2IS2A 2DITA 3NLCA 3HKZA 5B0BA 3GONA 2R5YB 2W7PA 4I2PB 1QM9A 5K9FA 3GTYX 1RPWA 2F48A 3HDDA 1HPZB 1FTCA 1Z1DA 3IM8A 2DH9A 4JYAF 3WTYC 4NQWA 3FGVA 3TAPA 2X6YA 2QX0A 1OCOH 2MKYA 2C3UA 1T8IA 3BEGB 4GDFA 1GX5A 1PUFA 5CKTA 4BWMA 2FHJA 1Q79A 4F0HA 2JVRA 1WDDA 1IVZA 2GZWA 4C0OC 1RWMB 1YRNB 3GPAA 5LEKA 2CH0A 2LF7A 1JT0A 1ZRCA 5DQHA 1VQKS 4WE1A 1UG2A 4HF0A 4AU7A 4M5DA 4P9SA 4K4VA 5KG0A 3PFEA 1MU2B 3HUGB 2CAJA 3DRPB 5KT6A 2ZO4A 3ZZYA 1SEUA 1ACMB 3MM6B 4R8UB 1ZTTA 2NVUB 2IXSA 2CNKB 2WW4A 1R0AB 4ANEA 4RWXA 4YP3A 4I09A 1KVJA 3GE9A 1FRIA 4F02A 3GFHA 2BACA 4L74A 5HO4A 2F5VA 1VQMS 1MROB 3W8GA 4PFPA 1DTTA 3LMMA 4WCGA 1DPUA 2E7WA 2JJ7A 2UUBJ 3MKWB 3J7YI 3FXJA 2FGCA 4QLCU 3DF8A 2PSZA 4B47A 1VRUB 3S2WA 1U5TA 4PFOA 3H5AA 4PUOA 2CFOA 2MEWA 3WU1B 1M5PC 4OX6A 2NLWA 2ADBA 1A9NB 2IGKA 2MA3A 2IEKA 1G6BA 2TDXA 2FMYA 2K85A 2HOSA 3QZ7A 4KJIA 3UCUP 3QT5A 4U0VA 4E7ZA 2M88A 4IOCQ 4HHHA 5GAGI 2DA6A 3W60A 2E1NA 1QU3A 4MEXF 3LQVA 3GUDA 5J6XA 4I67A 3OL7A 3TEHB 3MM7A 1NJIT 2RH3A 2PEBA 2AWZA 5J8CA 3H3VK 4X6AJ 1DURA 3R27A 2RUGA 3IG1A 4PQAA 1QHHD 4JI3F 3QPIA 1W4MA 4XRSG 1M1HA 4CYUA 1FE4A 3HVTA 1P27B 2KIQA 2ZNYA 4U0YA 1FBSA 2B5JA 2CWEA 2KXFA 1YE9A 3DNCA 4UUXA 2YNGA 4B3AA 3WTUC 2QE5A 3E2EA 2YBVA 2DK5A 3RBXA 2LEBA 4P96A 2VG6B 4LB6B 3D0IE 2C3YA 4DUZF 1KFDA 1HQ2A 3ZGKA 1P4WA 5KG5A 2GGPB 4ID8A 2HEOA 5HQ8A 1WELA 3UD4P 2XROA 2VBZA 3JAMZ 4BY7J 3GZNB 3K9TA 4DI6A 3CO6C 4B3MJ 1VQOS 5GPCA 4EZ6A 2GIRA 3EX7B 3V4IB 3MMCB 2BY3A 3HJEA 3VYUB 1SMYF 2W7AA 5I42A 1T3NA 2A10A 4H4OA 1KGSA 2DTRA 2AV5A 5K20B 2HZTA 4KDPA 3JRBA 4RZRA 3TAQA 1P6TA 4A0XA 3TX0A 3KK1A 4NXMJ 1QSSA 3A8EA 4HH0A 4KHMA 4G1PA 4CH7A 2MC3A 1JTYA 4QWQA 3GYHX 3THVA 4A0YA 2DCUB 4B3XA 2I5UA 4PAAA 1I3AA 2V4RA 3MWMA 1MMDA 1K8AT 1C0UA 1UL3A 3JSMB 3NRBA 3MEEB 2G9OA 3QAEA 1HFEL 3IC7A 3CJRA 5HL7Q 1M1KT 2JA2A 1V4RA 3KJVA 1XMOF 3H5XA 1PGZA 1ZETA 5DS7A 2IFXA 2MKKA 4HSTA 5J2PB 5LLQA 1EARA 4KGXB 2FNPA 2DNZA 4JI5J 3I3LA 3ZNJ1 1HLVA 3TP2A 3H0GJ 3DV8A 4XLEA 3FVYA 3BQ0A 2X51A 5F9NA 4JUZA 1X1DA 3RKQA 2L3DA 1FYMA 1LKZA 2XC9A 5K7ZA 3JTGA 2E5LF 4LGWA 1RE1B 1ENHA 1JLBA 3QOEA 4J00A 5FD1A 1VQ5S 4QYRA 3IR7B 4NOHA 4A3MJ 3K8VA 3OFHA 5CA5A 2DK2A 3P6YC 3GU0A 4DUYJ 4BHCA 2QN6B 4HLBA 2E2JJ 5JVTA 2LP4A 4KMUX 1TK8A 2FA5A 2YH0A 1ZTRA 3WU2C 4DGWB 4NC8A 4OZ2A 3WG7H 2RHQB 5AXNA 3M8YA 4PWUA 5HDKA 5FIIA 2ZKUA 4K50A 3MZHA 2R7SA 2R5ZB 1R31A 3PW0A 4Y65A 2HPMA 4DFJA 1HWIA 3K5NA 2MSTA 4XONA 1DQ8A 1VQNS 4LFCJ 2UXCJ 5IT9U 2L0KA 1MMSA 2GLOA 2MH9A 3FM5A 5BS6A 3H4DA 4N8OA 2HVIA 1FJCA 4ITVA 4ZHRA 1XN9A 3PJ9A 2DPIA 4ZH4F 3VWBA 3FCVA 3RDIA 1XMQJ 3R6GB 4ED7A 4TYAA 2BXYA 1SJQA 4EMDA 1MBHA 2F5EA 4M8LA 3ZZOA 4YB5A 2WAQD 4ZVGA 4G8XA 5F04A 2BV6A 4QPTA 4CLWA 2LA4A 4X4OA 4ILMA 3LP1A 1YJWS 3J80Y 3OYJA 1BC6A 4EJUA 2CQDA 2MZ1A 5F3ZA 1CJUA 1K6YA 1MMNA 2Q2EA 2Y30A 2FC8A 3AD9C 4OJ3A 3CP8A 3IAS9 3D5LA 5LBQA 5KFZA 1QTNB 2ZVSA 3E6DA 1OYYA 5AIQA 4HDHA 4WFZA 5E18F 4EMSA 2Z58B 4OINF 2VHGA 2NXCA 4L9TA 4CT8A 9RUBA 1ZG3A 3I71A 1Q1VA 3FXMA 2VL1A 4MK7A 4P71A 2OTJS 3GLJA 2JFKA 4O0IA 3KK2A 5KFMA 4UVAA 1FNXH 4NXNJ 3G1MA 4AL5A 4BDYA 3TOQA 3O8WA 5HJYA 3QU6A 4ED2A 3S2HJ 4PZVA 1TZLA 5J3LA 3JQJA 2MKCA 4GVLA 1SD5A 1FJ7A 3ISPA 1B64A 4K0KJ 5L3EA 4C9YA 4EJWA 1F4KA 3MM9B 2X1AA 4J9MA 1F0XA 3CDAA 4DL0C 2HHHF 1YRUA 4CHUA 2AJ4A 5FLXK 1TL3A 5E20A 2Q1ZB 3OXLA 2WHOA 2RVJA 1Z1ZA 4KFBA 2YKNB 3K2ZA 1QVTA 1TELA 4NI2B 2FZCB 2G4BA 4DV2J 1Q78A 4J9RA 2J0QD 3I4MJ 3LW5C 4A8QA 3BROA 3GJTB 4OI4A 3OIPA 2ILYA 2ZE2B 1U48A 2EFPA 1OYWA 4QR2A 4PYDA 1FVQA 2CQ4A 2R7VA 1N25A 4OYAA 3R0AA 2MQPA 1HWKA 2XIGA 1BUXA 5M2RA 2KB2A 4X2BA 1QUVA 3CCRS 4JYKA 3WDOA 1FPQA 1RAOA 5HROA 2OD5A 2HFSA 2UUCJ 3VGVA 1QHGA 1T7PA 2BE5F 2NCKL 4DV7F 3OYIA 5B08A 1A5JA 2J9CA 3MEGB 1PBUA 4PXEA 3QIPA 3AJDA 2IA0A 1OY8A 1S8NA 4HDUA 2KHCA 2YNHB 3BYRA 5KFYA 1NSQA 5GADU 2M1BA 1VISA 1M90T 1HNIB 4I56A 2W2QP 4C8NA 2ZBPA 3K4MA 1MD0A 5JVHQ 4GKJJ 2EWHA 5L9XA 5KFKA 1PAEX 4UHTA 2QEXS 3F8NA 1J27A 3T3FA 2VT2A 3FFIB 3RBDA 1RYSA 5A2QK 2KT5A 3HYIA 4C0HA 3WHIA 2E5IA 2J0XA 3MCSA 3R7SB 4EVIA 5F0HA 1O3RA 3ZZ0A 2BZTA 4LSLB 3I0SA 1JWWA 1JHFA 2P7VB 4HLYA 4LR8A 2P4WA 4BJ6C 4YR3A 1VHFA 1HSTA 1YJNI 5J40A 2XCPA 1SC1B 4RR5A 4DQQA 3PW5A 2DO0A 3N6NA 3CJ0A 3DMJB 3TBIA 3C19A 1J5EJ 3G2XA 1IN4A 4O5VA 3HO1A 2GVDA 2DFFA 4OHZA 2UV1A 3LGHA 3GSDA 5D4NA 2UVWA 4UB8C 3T1HJ 3VFZA 2IMOA 2PD1A 4X4SA 1I39A 2KHDA 2VZ9A 4OQJA 4Z6YA 1MBEA 3QPSA 2GC8A 4XO0A 3OL6A 2PGCA 3TYTA 1OFCX 3HPOA 4RW8B 3FC9A 4JI7J 5E3NA 4WJBA 5B1BH 2EFVA 3NGKA 4CH1A 3HB9A 2RDJA 3HTUA 3D1HA 3O1LA 1R0CB 1W25A 1VQSA 1G7CB 2IMWP 2HGCA 2R7FA 3IWZA 1K73T 2AYBA 5F8IA 3MECA 1WD6A 1SIWB 3W9JA 3UO0A 4FNHA 4OJGA 4Z37A 3W9HA 4DN9A 1D0EA 3MZYA 3HOVJ 1TU0B 1F5TA 4DQIA 4KYWA 1OIAA 2VXZA 2VPXB 4WYWA 3QRQA 3A2KA 3KDNA 2NZCA 1F3VA 4M5NA 3PO5A 2M2EA 4HYEA 1UVKA 4YIFA 1OQ3A 3PSFA 1TK0A 4FNIA 4JI6F 2OZ6A 4ZLLA 2L08A 3LWFA 3V5RA 1RTJB 4QWAA 2RRAA 4RW6B 4FBUA 3BG6A 5E5NA 1YITI 2XY7A 2ME6A 4O3NA 1AB8A 3KLEA 1S1WA 4C8ZA 3IM9A 1NDKA 1TNSA 4NLQA 1VQLS 4BKXA 1AZSA 3NS5A 3OL8A 4JI8J 3ZNUA 1Q81T 2KI2A 4QBUA 3CPWR 4KSEB 3A13A 3A12A 1VQ6I 3S15J 3WIVA 1E17A 3B8HA 3EICA 3JRIA 3HVRA 5JVGQ 5E3MA 4OYOA 2BY1A 4RL1A 3EZ5A 5KFSA 3KYLA 2MHEA 4UTGA 1APLC 3IO1A 3F8MA 1O3QA 2I38A 4QYZK 4NCAA 3I87A 1D1AA 1VQPS 3OL3A 4M5KA 3RGIA 2X1EA 2LY9A 3DOLB 2VKEA 3CD7A 1RKJA 3SZTA 4IDKA 1HKTA 3HKWA 4KR0B 4FF3A 5DD8A 2ZXJA 3O44A 3CCWA 1RTHB 1IAWA 2H5EA 4NL5A 2WVFA 3WGGA 3L95X 4FE4A 4IQXA 2IJRA 1G3SA 1SC3B 1U0HA 4B3MF 4P72A 2MLXA 2HAFA 1KNZA 2XVCA 5JHFA 1RTIB 3D6TB 4RNOA 4GVBA 1I27A 5D0RA 1VF9A 2B6AA 3R0JA 5JLXA 3OHAA 1DARA 2IAJB 2K9SA 2JN6A 3G87A 1FRMA 5J1EA 4K2EA 1VK3A 4DV0J 1P8GA 3ZMZA 1R36A 1UA0A 1N0UA 1XMXA 3HPGA 1QAXA 3U1LA 2KRCA 2D41A 2OQRA 1NK3P 5CPRB 1OPCA 3Q83A 2DOFA 3KLOA 3FMQA 2E9TA 4CO0A 2R5YA 1F5AA 2STTA 1SH2A 1HNWJ 2W2PP 1HPZA 4ZIVA 3M8JA 1IM4A 4UW2A 2CQCA 1X4AA 4ZVUB 1XWLA 3DBRB 4XRMA 1BIBA 3IRXA 4JI5F 1ACIA 4C8KA 2L4MA 2DGSA 3I4HX 1ETYA 1TFWA 1DU0A 2I2YA 3GP9A 1G4CA 4OJHA 2OIHA 2DT9A 1SBRA 3IBWA 1HBUB 1VIOA 1ZAXA 2DH7A 2M34A 3MFKA 2M9KA 4EU0A 4B9TA 4OIOF 1SCJB 1X5SA 5HS9A 4ED3A 2RSQA 4GMKA 1QZZA 2FUG2 1LFUP 1D8ZA 3DRPA 1Z9CA 1MIJA 5EGOA 4FX4A 4FE7A 2DFHA 2PMHA 2MJUA 1QD1A 4MKBA 4Q45A 5FJ8J 1K47A 1T08B 1REVA 5T14A 4L5EA 1TT0A 5L3BA 3DEEA 2X85A 3H3ZA 1OS5A 2XQCA 5BYSA 4DUYF 3UN5A 2IM0A 4HF2A 3BLYA 1Y11A 1B0PA 1MROA 3Q8QB 1V3ZA 3CCEI 4RW7B 1GVDA 3I4PA 5AXLA 2HYGD 1MH3A 1SKUB 2W9CA 1Q7LB 4IG0B 1C0TB 4OLPA 1VRUA 2LQ8A 2QBYB 2FYXA 2K86A 4B9LA 4B3TJ 3G73A 4O44B 2LK2A 4NEYA 1KYWA 4HYKA 5GAHU 2JA6J 3KZIC 2GOMA 1ZGJA 1VQ4S 1O8BA 4NLXA 1XMQF 1EQ0A 1N6QB 4B02A 3GQCA 2XGEA 3IMQJ 3BR9A 3QNWB 2OEKA 3GVAA 3AKZA 1DP7P 3GZ6A 3M2UB 3ABUA 3R8YA 3NS6A 3WE2A 2PBIA 1VFJA 4Y3CA 2X1CA 3ELHA 4F8RA 1T03A 3OXFA 4XDDA 1S9GB 2PFBA 4P2FA 1R6VA 1NZ8A 1KVIA 1RAFB 3HMJG 1NCLA 2DODA 2MMYA 1VDHA 1Z6RA 2LKPA 3IA0A 4ZTFA 4V19K 1AYEA 3NCPA 3DLGA 1JMTA 3VV2B 2HK3A 2HSEB 2ID6A 2OEMA 2VG6A 2L9VA 2YSRA 4NXNF 5A8KA 2LFBA 3VAFA 1C1BB 5CVRA 2CWXA 3ETMA 4UY8I 1P6RA 4U96A 2QM3A 1W2IA 2YWHA 1R8CA 1EF4A 3BGFA 4P73A 3T8TA 4I2QA 4DSLA 3V7SA 5CYQB 4K0KF 3NS7B 1FZPB 1X1AA 5LGTA 2CVEA 3V4IA 4N9IA 2DAOA 2XF7A 1RHRB 2HWTA 2H5IB 3MURP 1XMBA 2DMNA 3W2AA 3M6XA 2VJVA 1X19A 3CUQC 2XPVA 4IZZA 4QU6A 2J5PA 5CXTA 2GXBA 4HPQA 4DV2F 3PG9A 1H9GA 4D7NA 3GFYA 3H9QA 2QLJB 1S7EA 4QWDA 2HHTA 1O51A 3GWZA 1SUQA 4ZVOB 3G6XA 2CXEA 2PMUA 1FE0A 4DX5A 2CUJA 2EJRA 4NX9A 3CLQA 2ZZTA 2GX8A 3SDEB 3HDSA 4FYYB 4AYBD 3MEEA 4RU9A 1KLMB 5TJJA 4DQ2A 1I1GA 5AXKA 2H27A 2NS8A 4YIRX 2R7OA 5SUHA 5LMNJ 1B0VA 2KT0A 4M6YA 2BDPA 3NNAA 2RB7A 4QIVA 2H51B 1U2WA 1SC4B 3K57A 1I5ZA 1XCVA 2X1FA 3C15B 3SI8A 4JOMA 2CQNA 5ETRA 4RBOA 3OTEA 1MZBA 2QTWA 5E3AA 1R00A 2MZRA 3KG0A 1CLFA 3H0DA 5JMNA 1ZPVA 4A8YA 2K7KA 1CGPA 2Y0SD 2Z33A 2XUBA 4WKYA 2OLWA 3F56A 4EBDA 4BGDA 2QSHX 4J9OA 2KJWA 2CQXA 2AJ1A 3LPYA 3ZZUA 1JJ4A 1Q5YA 4ECTA 3U7JA 4Y3OA 2Z56B 2EA4A 2XLKA 3MEDB 4HG2A 3MMYB 5J2NB 3DPTA 2A05A 3GIMA 3HOYJ 2K06A 1YQHA 1FKAF 2B3TB 3AODA 3HT0A 2MZQA 4IRKA 1C2PA 4XLNF 1B8IA 4P55A 1SQFA 3LP0A 2CRGA 5IS2A 2AJQA 3FXQA 2DFEA 1X1BA 1H7XA 4AWXB 4IOAQ 2JQ7A 5FLVA 3A3OB 3DLKA 2JVHA 4TKTA 4CCJA 4JV5J 4P75A 2XMMA 1XDSA 3KP3A 3FXUA 3VEPA 3GYGA 2XAUA 2QYGA 4A3FJ 4QYZJ 1CSJA 4ZDOA 5B3SH 3C6UA 3W63A 3SYTA 3J80U 3C3WA 2OZUA 4HNUA 2ILZA 4J9UE 1T9VA 4U0WA 1IZ1A 4LF9J 4LT6A 4ED8A 4R5PA 5KFCA 4NDLA 3E3VA 1R23A 2MQ8A 2YS9A 4FQGA 2DYSH 4RB2C 2VONA 1T9UA 2YNIB 1MDMB 2IRFG 4DYCA 5KHDA 2A3SA 1AKHA 2VG5A 4BS2A 3T1HF 4YFKF 3J81K 1WNEA 1EP4B 1X7VA 1LFPA 4BHQA 3VAKA 5B0DA 3CCUI 4ZJLA 2DGWA 1HSJA 3PHTA 4ELVA 5B0AA 2QZ8A 4W90B 3BR6A 3W61A 3L3CA 1W5TA 4DCPB 3G71I 2G9WA 3M8SA 4ASNA 3KYDB 2N82B 3C3LA 2BYVE 3HRMA 1WH5A 2QLXA 2W2OP 3K4CA 4E8UA 3CJQB 1RKWA 3S8PA 2LFVA 1KYZA 3PYFA 3A0BC 3NY0A 3CUQA 2B51A 3BG9A 2D1CA 2BV3A 2DGOA 4MKYA 2HYFA 2ZC2A 1ZS6A 4Y52J 4BL0B 2P8IA 3KK3A 4OV6A 2XYPB 1F1BB 2COBA 2Q79A 3M6UA 4PZJA 4LLNA 3RKXA 2HIQA 4I7HA 3ZC4A 4IQ4A 1Z77A 2BW3A 1RLDA 3LSMA 3DRRA 2CQQA 1W7PB 2V1UA 4Y6IA 3MUVP 3H5UA 1HW9A 4P10A 3FSIA 3DGVA 2LF8A 4PWWA 4M6XA 1YG2A 3IS9A 1G8XA 4TVAB 4JI8F 1IJFB 2HGMA 2N4DA 4CCHA 2ECBA 2HMIA 1QRYA 1RTDA 4A3KJ 2O67A 4CLKA 1N34J 3ZXSA 2WAQN 4M5HA 3AA8A 4L9JA 3UCZP 1X9SA 4DBQA 3K2YA 1Q82T 2MDAA 4IHTA 3M30B 1WH7A 4OYZA 3G1OA 2UXNA 2OUGA 1X9WA 2VOOA 1OSCA 1QSLA 3LSKA 1WEYA 2JRMA 2HHXA 4GRIA 2CW8A 2H94A 2CVIA 2F4MB 5FLXY 3KG1A 1JJ8C 5EDWA 1NG6A 2LDYA 3KEOA 2FD5A 1E6VB 1KZHA 3I59A 3TR5A 2NAZA 3RYPA 4U95A 2DQLA 4XRFA 2GIFA 2QLZA 4CNYA 3BOQA 1FDDA 3HK2A 3CDIA 1D1BA 2W25A 5L3CA 2HI3A 2SXLA 5IM0B 2ADUA 1FBUA 4B8XA 3H20A 2GO9A 3JCUC 4CLUA 1FXDA 4DF4A 4ZYGA 4IFVB 1JLAA 4EV0A 4RLFA 3PIOF 2ZMEC 4O6JA 5M5XJ 1SH3A 4LK1F 4U7UK 4ZYDA 3UI3A 3K4BA 2J5AA 2FJXA 2VBYA 1GV2A 4F0KA 4CLZA 4FBTA 1MJAA 3M2VB 4V19J 3KP5A 3B54A 4GXOA 2HIYA 1HNWF 3FBBA 3CF2A 3H3UA 4BHBA 4GO7X 2DOEA 1SVOA 4ZP9A 3MKLA 3MGJA 3HOXJ 1RRJA 1F9HA 3M8PA 4C30A 2QWWA 2AHOB 4AVPA 3A01A 2AKWB 1SKRA 1RT3B 4B4CA 5KFAA 2FVQA 3MTKA 3P96A 1UEKA 2A1BA 5A0YB 2FLPA 4AVZA 4LRAA 2C28A 2NQPA 5L1IA 4E6KG 3OVBA 2ASDA 3OTBA 1X0PA 5DJBA 3QPTA 3B4MA 1PKUA 4CCMA 1S1VA 3N01A 2B63J 4M5LA 1FTZA 4O3QA 1HQCA 5CVIA 4QIGA 4ZJQA 1U1OA 5DRKA 1TL7B 1WG5A 3RAMA 3BB5A 3MFIA 3VAIA 1QBJA 2CQKA 2V1XA 1VQKI 1U0SA 1EV7A 1S59A 4B9NA 1ZHFA 1S6PA 1UZCA 5AXMA 3BBCA 3DEWA 4ZPAA 1V6HA 2W4DA 3ADAC 3VGSA 4IEJA 2AW0A 5C4XJ 3ENQA 3JRCA 4FVMA 3H2UB 2YWWA 2JOQA 4ENMA 4YDXA 4JV1A 2DFIA 1RTJA 2GAHC 2EFOA 2KQRA 4S05A 3FEXB 2V9PA 4B3TF 1VQMI 4B08A 1Z91A 1TV6A 5B0EA 1BHNA 2NSBA 1WKLA 3IN5A 3FBFA 3E7LA 3MCOA 3OUYB 3BN7A 5HBMB 4WF9Q 2QL7B 1B70B 1FT9A 2QQ9A 2CZ4A 4KY3A 1M5VC 2IC3B 1L3TA 2APOA 1IKXB 2XF6A 2I9SA 4L6V3 3VSKA 2R8IA 2QV6A 3E0JB 1JTXA 3BWGA 2P6SA 3PDNA 3ZZRA 4AFFA 4DL3A 1GTEA 4UF4A 2XAFA 1V9OA 5IZHA 4LF2A 1HD1A 1QVGR 3SEOA 3BTCA 1UHSA 2DI3A 4XQFA 4WU3A 1UVMA 2CNLB 4IRGA 4G7ZF 4ENJA 3LOCA 3O5TB 4XKBA 1WSUA 1H0MA 3FBIB 3DOLA 3CO9A 2FY1A 2YQ3A 3MI7X 1MH4A 4J5OA 4ES1A 1R58A 5AONA 1Y4ZB 5JUMA 3LSPA 2JDJA 4DR2J 2VDHA 4DSEA 4DZDA 2ZMEA 3NCRA 2OPSB 3HSEA 2M8EA 1U25A 2HURA 3I9V9 1Z4UA 4IPAA 2B9XA 1LFWA 4IR9A 3FXKA 1HMVA 1VQOI 5HI7A 4LRBA 5IP9J 3H40A 3LH2S 2ZH9A 3WGHA 4CDIA 4J9VA 4QIFA 2GXAA 2RQQA 4WXCA 1NXIA 4OZLA 3I0RB 5ETKA 3H59A 3BSAA 5K14A 1QQIA 2IT0A 3RSNA 3E3XA 2JSXA 1FOXA 5DEQA 4LB5A 4NZ7A 1WCMJ 2ZOMA 3TUJC 2AD9A 4Z2YA 4PJJA 1ZBTA 1V3RA 4BEHB 2AIRB 1PYVA 5LMNF 1JXEA 4KISA 3KX2A 2HHQA 3WTVC 2R92J 3HKZD 4RAGA 1S1UA 4ZPBA 4A69C 1UFWA 1I6XA 5HJXA 2WONA 3HI9A 1HNXJ 4USWA 4LVOP 1PJRA 1TQIA 1TKZB 1HBMB 4ZVHA 2C2DA 3K58A 1QTMA 5HVFA 4Q4ZF 4HT5A 2PMZN 4IQJA 2Y8WA 6FD1A 1SFEA 4B44A 3J80Z 4O3PA 3F9KA 2VOPA 1KS2A 1P9YA 1Q53A 1RWXB 2V79A 1JKHB 4HR2A 2F4VJ 4P9FA 1USSA 4BS9A 2CWKA 1SAUA 3NQOA 1SMTA 1I3QJ 4FTHA 2WY8Q 4LOCA 2PE8A 1UPPA 1FF2A 1RESA 4TQSA 1PP8F 2PJRB 2DXDA 3HHLB 2QQAA 3ZQIA 2QSGX 3D3CJ 2ZJQQ 1BJZA 3L1PA 1KQ8A 3D3BJ 3P7NA 2A5WA 2KPMA 3LQQA 4DDFA 4LREA 3OD2A 2R4GA 1HKSA 1RHQB 4JV5F 2O5RA 4KGVB 1QA6A 3WODF 2IGOA 1RHMB 4IG0A 4N56A 3HPHA 3MPWA 2YH1A 2QBYA 3A0HC 3LAMA 2M87A 3MUMP 3HFKA 5LSRA 1NK0A 4IR1A 8AT1B 3SDBA 3RQ4A 2LEPA 3ZTOA 3TW7A 1SPBP 1IN0A 3EGNA 4O23A 1E6YB 4X4VA 3PCOB 5FKMA 2DA3A 5ETMA 3OYFA 1IXSB 3W6KB 4UOHA 3V6DA 4J9KA 1VQNI 3OHBA 2B56A 1OCCH 2HXIA 2N8GA 5IT3A 4J9PA 1RT2A 4ED0A 2A6HF 1ZRFA 1DBDA 4Q44A 1JLEA 2VUGA 3FM3A 4WWSA 1VC0A 2R8KA 3CCSI 2HNZA 1X2MA 3M1EA 3NP5A 4R25A 2HHUA 1SJ3P 2FGOA 3MOZA 4K59A 2F5DA 5I3PA 3K4LA 1JX4A 2CGPA 3F44A 1FRJA 3GV8B 1VQ9S 5F8GA 4A8KA 2DISA 4U7BA 4KT6A 1X9MA 4Y00A 4ESBA 4KKOA 4F91B 5KFWA 3UWTA 4XN3A 1IBKJ 2Z0GA 2DR9A 4LF6F 4ITSA 1X5OA 2HRTA 5K5OA 1J5OB 1S0MA 4ELTA 3SCKE 2IA6A 4FXWA 4QWCA 3BC8A 4OOIA 1Q0NA 5D8LB 5GMEA 3K17A 1UAWA 3LWLA 2LC2A 1W7WA 1UJ4A 3FNNA 4MFDA 3CJTB 4RBUA 2NXJA 3CF5F 2ABYA 1WOPA 3PXGa 4GC7A 4RUBA 2PDAA 1K78B 4C8LA