2DBBA

Crystal structure of ph0061
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
146
Chain Sequence
KLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLGYMYAIVLIKSKVPSDADKVISEISDIEYVKSVEKGVGRYNIIVRLLLPKDIKDAENLISEFLQRIKNAENVEVILISEVRKFEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH0061
rcsb
source organism Pyrococcus horikoshii
molecule tags Transcriptional regulator
molecule keywords Putative HTH-type transcriptional regulator PH0061
total genus 36
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dbbA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dbbA02
2DBBA 1G3YA 2A3SA 2JPCA 1JGSA 3KP6A 1KQ9A 4FT8A 1KGSA 2R7FA 1YTYA 2ESHA 1SFEA 2DT5A 3SXYA 1WI9A 5BQTA 2JSXA 1ZREA 3F8FA 2L54A 5FFZA 1RIOH 1Y0UA 3LQQA 1E17A 2FBKA 3HRMA 1R00A 4HX4A 2D2WA 5BMZA 3G73A 5CVIA 4PDKA 4UV8A 3WTTC 3DXJF 3WE3A 4H0EA 4IRHA 1U5TC 2OQRA 2XGXA 3ISPA 3B02A 1FC3A 4HDVA 2Z33A 4I0AA 3BJ6A 3FZVA 1MZBA 2A6EF 5D6FA 1SFXA 2YU3A 5LRSA 1AWCA 2FXAA 4DQ2A 2HQRA 5HDKA 4RB2C 1YW8A 5E20A 1IF1A 2Z4PA 2GIVA 5DCFA 2P5KA 4MQ9F 2CG4A 1K7AA 2P5VA 2V1UA 1QZZA 1SAXA 4ENMA 5JVTA 3RKYA 5J6XA 3JTGA 3M7GA 4ZZLA 2ELHA 4OMYA 3FX3A 2A61A 2P6SA 3GF2A 1U8RA 3ABUA 1S7AA 5J8CA 2FSWA 2KKOA 4F7ZA 1FLIA 2IJLA 1U78A 1ZYRF 2XHKA 1O57A 1XD7A 4ZZDA 3NRVA 3TDUC 2DO7A 1I27A 1Z05A 4G9YA 4AD9A 1XMKA 2MLKA 2V1DA 4N9IA 2A07F 3DQVC 3WTZA 3VODA 3NQOA 1T38A 3S2WA 3I71A 2PEXA 2FNAA 3QU3A 4L9TA 2A5YB 3KP7A 2CSOA 3VOEA 3ZMTA 4HX8A 4OIPF 4RGXA 2VOOA 2PG4A 3H3UA 4QWQA 3P9IA 3F8MA 1ZRDA 1FSEA 3J7AO 3GFMA 5LHIA 2ADUA 1MJAA 1U6GA 5ICCA 1VTNC 1Z9CA 3IL2A 4Z2YA 4LB5A 1H9TA 3IHUA 1ULYA 3DP7A 4WXHA 3I58A 3RIRA 5L3GA 1STZA 4HF0A 1OKRA 3D5LA 4AIKA 5HVQC 3W6KB 2HR3A 3F8NA 1FBUA 2RKHA 2QQ9A 2UZKA 3FMSA 3TOBA 5A2QZ 1Z6TA 5JR3A 3JSOA 2XASA 2CQKA 2ZKZA 2ZBCA 5AONA 1W4MA 2O6GE 3M8FA 4HDUA 1R36A 1PP7U 4G6DA 4B09A 4EQQA 2CVIA 2PMHA 2P8TA 4MHGA 1LDDA 1BIBA 4A2UA 1HSTA 2H09A 1H9GA 3WTXC 3L2CA 1O7LA 1IAWA 3I59A 3GFIA 5DD8A 3Q9VA 1HQCA 2XIGA 3M1EA 2QZ8A 3QOPA 4XLNF 1KU3A 3JSPA 1K79A 2HWVA 1K78A 3HHGA 5ILUA 3E5QA 3ZMDA 1FYKA 3RTRA 3GWZA 1KQ0A 5E17F 2Z9OA 1UFMA 4EJUA 2W24A 1GXQA 1LDKB 3HSFA 1R1TA 2BYVE 2UXNA 3C3WA 3MWMA 1F4KA 2GQQA 4NQWA 2UXXA 2XROA 4UNOA 1SD7A 4ETSA 4AVPA 4ENNA 1GXPA 2Y0MA 4I0BA 1LB2A 3HOTA 2HEOA 2JPBA 2L02A 4U0YA 1ODDA 5K5RA 3KEQA 5HS7A 3KLNA 5TRDA 5HS9A 4G7HF 1SD6A 4ESJA 5H20A 3WTUC 2XKPA 1GVJA 2FMLA 3IC7A 5ICGA 3E6CC 5ERIA 5LEKA 1XGMA 4LLGF 3QU6A 1CF7B 1TNTA 1XDSA 4KIFA 4KICA 2ZJ2A 3J81K 1ON2A 3GXOA 3J81Z 5DD4A 1XCBA 1YYVA 1I1GA 3HTSB 2TDXA 4ENKA 2L3DA 4G94A 2ZFWA 4G8XA 1QNTA 1HSJA 2CO5A 1J2XA 3ZMUA 3E5XA 2RV8A 4L5JA 2BBYA 3MFKA 4KNYA 4YG2F 2CFXA 2WV0A 4ESFA 5HDGA 1BI1A 3E6DA 2Y75A 3EYIA 2K4BA 2HYGD 2HTJA 4I7HA 5LGNA 3BZ6A 1RNLA 4CHUA 2FNPA 2GAUA 5ED4A 4LG0B 4CDGA 4L0YB 2XAHA 4CYDA 2IW5A 1FYLA 3FXUA 2A6HF 3I59B 4HA8A 5H6RA 1SMYF 5E18F 2FQ3A 4L18B 2VT3A 5FLXK 3CJNA 3TQNA 1Z6RA 3QP6A 2RQPA 3GFJA 3L7WA 4O6JA 2ZBKA 1KU7A 1ZG3A 2DQLA 4L9NA 2MC3A 2Q2EA 5E8GA 2VN2A 4N9HA 4KN4X 2QM3A 3N4MA 1LEBA 2VXZA 1ZLJA 1YS7A 3GYHX 2EA2A 2BGCA 2HGCA 2V1XA 1X3UA 4GYIA 2IRFG 1GHCA 3FMQA 2VE8A 3FXRA 2NNYA 4KN7X 4XSZF 1TTYA 4KMUX 3REOA 2FOKA 5E8IA 2RN7A 1BM9A 1I1SA 1HKTA 1S3JA 2DPDA 3I64A 2QYOA 1UB9A 3AAFA 2F5CA 3BP8A 2VBXA 1XN7A 1EH8A 5LLQA 2QBYB 3H3ZA 2ZXJA 3BPVA 2GA1A 2FF4A 4ASNA 2ZNZA 1IRGA 5J8FA 1BI2A 4WF2A 2K27A 3IKVA 1C0WA 4BHBA 2DPUA 4OOIA 3ML6A 3U2RA 2QBYA 4Q4ZF 2P4WA 2K4JA 4CO8A 2H27A 1IUYA 5DEQA 1F9NA 1U5TB 4HQEA 4LD5A 2DQRA 1OR7A 1ZHFA 5LGUA 1XGSA 1S6LA 3WGGA 4YIFA 3H92A 1ON1A 3QPHA 1JXSA 4EMSA 1JE8A 4A0XA 2K02A 3CTAA 1G4DA 2L4AA 1OMIA 1QBJA 2VC1A 3BY6A 1OYYA 2H6BA 4KMFA 1BN5A 5FLXZ 1T6SA 2G7HA 3WGHA 5D5UB 4M9XA 4UVAA 3LWFA 3IKTA 3C18A 5CJ9A 4RB1A 1J59A 3RKWA 2QWWA 3ROUA 2H6CA 1LNWA 1AOYA 3BOQA 3QP5A 1SD5A 3KZYA 4HBLA 4Y15A 1WQ2A 2P5LC 2A69F 2OU2A 2EFQA 2HDCA 4OIOF 2EV6A 1BIAA 2FBHA 4XSXF 3SZTA 1SD4A 2ZCWA 4BNCA 2RC4A 4S04A 3KETA 2L4MA 1QPMA 4YFKF 1R5HA 4L9VA 3DPLC 4EJOA 2Q8KA 1YW7A 3COAC 3ZN0A 3LAJA 2ACJA 4U7DA 2ZMEA 1BOAA 4OIRF 1R22A 3DKWA 1YW9A 2PJPA 2V6CA 2YX7A 4A0ZA 3ZPLA 4ON0A 2ZO4A 4I02A 2IA1A 3FM3A 1FY7A 3BWGA 1NHAA 2FEZA 1HBXG 5IT9Z 3RKXA 2VT2A 4L5IA 1U2WA 5L3EA 2G7UA 2ETHA 3T0YA 4A12A 1HXDA 3VEPA 1XDUA 3U9GA 3Q5FA 4UHTA 1R1UA 2M30A 3GVAA 1MJ9A 1EH7A 2X0LA 1U3EM 2NNNA 3U1DA 1BBYA 2JT1A 2OZ6A 2OD5A 5ILVA 2HYFA 2EA4A 4S05A 1FOKA 3F72A 5LGTA 4MQVA 1YQAA 1J5YA 4EJTA 3BPXA 1UHWA 2BEOA 5HS8A 2YPRA 4MTDA 3V4GA 2PLYA 3DV8A 2X4HA 3KFWX 3F8BA 1YLFA 2V79A 3WE2A 4HQMA 2VOPA 4HV5A 3T1BA 2VBWA 4MEYF 2FBIA 4Q5SF 5HOOA 2NYXA 5D5VB 1OYIA 2KIUA 3PQKA 2B0LA 1I6XA 1QO0D 3I54A 3GFLA 1DUXC 2VONA 3MQ0A 5L3BA 1RI7A 3TDZC 4A6DA 2STWA 4IHSA 3SHFA 1W7PB 2R3SA 3ELKA 1TQIA 1PP8F 2CGPA 2NS0A 3BROA 1ZH5A 1OYWA 4MNUA 1I5ZA 3EUHA 2HS5A 2VBZA 3B73A 1USSA 1W5SA 2JRTA 5TJJA 2CWEA 2M8EA 3MAJA 1B4AA 3L00A 1IRFA 3WTWC 1K6OA 4Q47A 5AIPA 4KIBA 4Y17A 2XRNA 3MEXA 2QVOA 4PGHA 4RB0A 2JTVA 2BE5F 2DK5A 1DPUA 1BC8C 5CVJA 3WTSC 2QQBA 4HOBA 2PBIA 3E6BA 4EGYA 1PDNC 2DK8A 3CUOA 2RVCA 4KUMA 1JHFA 5IT3A 3GUDA 2RDPA 1J7KA 3KP3A 1XGNA 5HLIA 4OU0A 4M73A 3P7NA 2O3FA 1WSUA 1TQMA 2Q0OA 4G6QA 1T39A 1DDNA 3K69A 2DAOA 3WTYC 3HRSA 2XAQA 2QENA 3HUGA 3KLOA 3ECOA 3CDHA 3FF5A 2E7WA 2K86A 1XCVA 5F64A 2XV4S 3SZPA 2E1AA 2RGVA 1KYWA 2ISZA 1R23A 2W57A 1TW3A 2VBYA 4I01A 5KVRA 4K2EA 5AIQA 4WX9A 4RGUA 4HV6A 5DDGA 3JTHA 4LG0A 2OQGA 3LA3A 3RPQA 2YSRA 2EFOA 4R8HA 4ESBA 4JK1X 3E3VA 2P7VB 3TO9A 5E1XA 1XSXA 3BJAA 3G3ZA 4BQAA 1REPC 4R1HA 1P6RA 1UHMA 1FZPB 3E5UA 5LHHA 1A04A 2QLZA 2MH9A 4HZFA 4A5NA 1XB4A 4HX7A 2JSCA 3K1PA 2VODA 4IPAA 1BI3A 1T2KA 3F22A 3BJOA 3GZ5A 3CO7C 1G3TA 3RYRA 4AWXB 3WTVC 5K5QA 2M1BA 1ZARA 2JZYA 2XVCA 4TV7A 4RGSA 3FM5A 1W7PD 4E70A 1T98A 1YS6A 5KK1A 5FB2A 3DF8A 2J5PA 3EDPA 4IXAA 3V7SA 4ZYDA 1MD0A 1O3SA 2DTRA 1Z1DA 5BPIA 4KDPA 2LF8A 4Y13A 2LNBA 4O5VA 2W25A 2HKXA 4M6XA 4BHPA 1D8KA 2DJWA 1TBXA 4PCQA 1TNSA 5JHUA 1IXSB 4M72A 2HTSA 2DW4A 3VB2A 1FNNA 4LLNA 4L9JA 1KYZA 4YIIA 3HRUA 3DPTA 1IZ1A 2DLLA 5E1WA 4I2OA 1RUOA 4HW0A 4JQFA 2OBPA 1U5TA 5CYVA 2EB7A 2MBFA 1LQ1A 3C7JA 3WU1B 2ZMEB 1T0FA 3ZMSA 3M8EA 4HLXA 1SMTA 1Q1HA 1ZG5A 3RPUA 2OZUA 4GO1A 1G6NA 3WU0A 1KA8A 1YFHA 5LBQA 4KYWA 3MCZA 3I53A 4A0YA 3QPTA 3NEUA 2D1VA 5DCMB 3WGIA 3IWZA 2WWYA 4WXCA 4I09A 3O6BB 3FMRA 2CYYA 1ZAOA 2HFHA 2KRFA 4JBAA 3F6OA 4G7ZF 1QZYA 3ZMVA 4M9SA 3LFKA 1FSHA 2XAJA 3F21A 2COMA 4KT5C 1FPQA 5HDNA 3ZN1A 4OMZA 3J80Z 4L0ZB 3GEZA 3FXQA 1FBQA 1LJ9A 1P4AA 4EJVA 3K2ZA 4ENJA 3P9CA 1L0OC 5LHGA 2EFNA 2QQAA 4U88A 1FP1D 3T5XA 4GGGA 3R4KA 4M71A 1IXCA 3FWEA 5K1YA 4MTEA 3HTUA 2W84A 3J80K 2W85A 5A2QK 5IT9K 3R60A 3CUQB 1EH6A 4GCVA 5L3CA 2Z99A 2MA3A 4XRFA 2F5EA 3LSTA 1B59A 4EM2A 3E97A 3ZQ7A 2ESNA 2M45A 4KIGA 1E2XA 4BHCA 3LA2A 2PQ8A 3WG9A 2P7CB 3IWFA 2O03A 5JI6A 3ULQB 4RAZA 1UCRA 3HIFA 2G9WA 1YIOA 2KJBA 2XKOA 2H94A 3ECHA 1ZGJA 5CVVA 3KP5A 1B9NA 2RNJA 2NRAC 4BYYA 4EJWA 3EQLF 2FMYA 5FD5A 3T8TA 3LQRA 1RZ4A 5D4RA 1IW7F 3R0AA 2PN6A 2XUBA 4M74A 2IP2A 3E6MA 3ZP5A 5H6QA 4HF1A 1G3SA 1BJAA 4FX4A 3T8RA 1SFUA 3PQJA 4B8XA 3IRQA 5JFRA 1EV7A 1B1BA 2P6TA 2MH2A 2KIFA 3I5UA 4BAYA 3EETA 1Z91A 3R0JA 3W6JB 4EV0A 2QUFA 3C1DA 3K9TA 4LB6B 2YX4A 3R6SA 4CICA 2XAFA 1WRJA 4OINF 3RYPA 2KIMA 1TW2A 2AXLA 3IRRA 4HAMA 2ZNYA 3HSEA 4IHTA 1P4WA 3RJPA 4WCGA 1HW5A 3F8CA 4AIHA 3GLXA 1DP7P 2L01A 2LSOA 3TKYA 4D0PA 1J0RA 2IVMA 2R7DA 1O3QA 1D5VA 4UUVA 1S29A 4IVNA 2DI3A 3V8LA 1V3FA 2WC2A 3D0SA 3TOAA 5F6FA 4IF4A 2K7LA 4AIJA 4U7BA 2EV0A 1MKMA 3SFZA 5E1ZB 2F5FA 3DEUA 1FYMA 4KA4A 4UVBA 1O7FA 4LGWA 1J75A 4ZYEA 2PFBA 2PI0A 2NAZA 2GXBA 3QRFF 4O3MA 4HYEA 1R1VA 4OIQF 2J5OA 4IRIA 3QAHA 5FGMA 2IT0A 2CW0F 3EYYA 1MGTA 5FFXA 5DUKA 2DU9A 1ZRFA 1WWXA 4KFCA 4M6YA 3JAMK 1QQIA 2V9VA 3MZHA 2D45A 3VFZA 3V7CA 2FRHA 2FA5A 5HLGA 1MJBA 4MEXF 1XSDA 1KU2A 1USTA 1R58A 4P55A 1MDMA 3KZZA 4LMYA 2GWRA 5FO5A 5ICEA 1HKSA 4GYGA 5CVRA 5K5OA 1S8NA 2VC0A 4U0VA 3KEOA 5F1RA 3TGNA 2BV6A 1CGPA 1P4XA 2EK5A 3K0LA 3KE2A 4A5MA 3ERED 3LA7A 1S7OA 5DUIA 4YFNF 1L3LA 3OV8A 5EEHA 2IA2A 3HHHA 2FE3A 5HLHA 3TO7A 3KP4A 1LDJA 3ZMZA 2A68F 1HKQA 5D6EA 4RB3C 2HKOA 5DYMA 2MLGA 6PAXA 1K78B 1R5GA 1V4RA 3K1NA 1WKMA 1H0MA 4EVIA 2WTEA 5FD6A 1Z7UA 2OA4A 3Q9SA 3CLOA 4GXOA 5D5WB 1W5TA 1ZGAA 4CZZA 3K1MA 3O3KA 4CXFA 4RAYA 3N97A 1YO5C 3RI4A 3GZ6A 1F1ZA 4LFUA 2GXGA 3HSRA 4YFXF 4P5OA 4N0BA 2DFIA 2AS5F 4LLLA 3KCCA 3RDIA 1ZRCA 4ZH4F 5L3FA 2XAGA 4G7OF 4P9FA 3CO6C 1OPCA 4FHTA 2O8XA 1XGOA 4I98B 3F6VA 3F23A 1LVAA 4CGZA 4RGRA 4ZYHA 1D8JA 2EFPA 4XLPF 1ONVA 2E1CA 4EM0B 2GZWA 1O3TA 5D4SA 1HW2A 2VE9A 2E1NA 3R61A 4QLCU 3HYIA 4WK8F 1KU9A 4BXUA 4WXDA 3CUQA 1MDMB 1P2FA 2F5DA 4A6EA 1JHHA 4LK0F 1O3RA 1FWZA 2LF7A 1IN5A 1FT9A 4NB5A 3F3XA 3MZYA 4P9UA 4UV9A 5ILSA 1DPRA 5DV5A 4BH9A 2LKPA 4PZJA 4LJZF 2IA0A 1ZN2A 2YR2A 5DCMA 2EFWA 3GW2A 3V8JA 3PFIA 3HRTA 2EV5A 2F2EA 4LK1F 3LAPA 4R79A 1B9MA 1FX7A 1FP2A 1IN8A 1W7PA 3V8KA 1KQ8A 5EEGA 2EJRA 1LEAA 2IPQX 4U0WA 1HW1A 5LEJA 2LDUA 2Y48A 2Z5UA 1CF7A 1XSVA 1D3YA 1RUNA 1P92A 4IRGA 4FX0A 1BI0A 2FU4A 4HLYA 4HF2A 1FBSA 4IJAA 2OAZA 1J9IA 2EWNA 1TQPA 4WWCA 4PGGA 2ISYA 2HQNA 1IN6A 2E7XA 3V7RA 1ZG1A 2HOEA 3CUQC 5D5XB 1R7JA 3KP2A 3GO5A 2D1HA 1B6AA 4P96A 3O2PE 2M87A 1PUEE 2GA2A 5D8LB 2STTA 3WODF 1IXRC 5CLSA 3FHZA 4M9ZA 3SQNA 3OOPA 1YG2A 3I4PA 4NHJA 5BS6A 1QGPA 3TO6A 3M9AA 5D8KB 1G3WA 3DFGA 5BOXA 4ZYGA 5L3DA 3ABTA 2HZTA 2O61A 4UVCA 2KJCA 5CVUA 3L09A 4UXNA 1F5TA 3P9KA 3JAMZ 3GX4X 2MD5A 3I0TA 1BC7C 1IN7A 2C6YA 1TLHB 1ZLKA 5BPDA 4XBFA 4EGZA 2UWMA 3L9FA 1XMAA 2O0YA 4RS8A 5ICFA 4EM1A 2M5WA 3HOSA 5LRRA 3JW4A 2PMUA 2Z3YA 4Q48A 1IN4A 4DNCA 3BDDA 4MGRA
chains in the Genus database with same CATH superfamily
2DBBA 1Z4UA 3D0HE 3TL4X 2E19A 3GIRA 5D3GA 2A3SA 1WF0A 2JPCA 2V9KA 1JGSA 3PYFA 2WW4A 1M5OC 3K0JA 5KFKA 1KQ9A 2R7FA 2FJWA 2IIHA 2HHTA 3J7YU 2ESHA 1LKXA 3CCRS 3GFHA 8ATCB 3QNWB 5KFBA 1PC5A 1HPZA 3E2EA 2J76E 2Z2SB 5CQEA 2ZH4A 5FFZA 3NLCA 1E17A 2R93J 1H74A 2HQGA 4KT0C 4RNOA 3VZIA 2VQFJ 5HP1B 3KG0A 3PYGA 2E7VA 5CVIA 1RAEB 4YDXA 4HT5A 2XY6A 4WYWA 3M1VB 3WTTC 4G12A 3DXJF 2PX9A 4D3GA 1YZ7A 3F73A 3PNTA 3J81U 4AVZA 1E6YA 1FC3A 4HDVA 4CM0A 1KSPA 4Z37A 2L9SA 1X31C 3CMQA 4C8LA 4ZJQA 4M5IA 1YBTA 2UUCJ 3KK1A 1SFXA 4OI4A 3C2PA 3TYTA 4J9PA 3MR2A 2PMZA 4FBUA 5E20A 2F48A 5IS2A 1QDUB 2XLJA 2P5KA 4P73A 3A8JA 1K7AA 2FUG2 4TQRA 5EGYA 1MMNA 1G59A 1OJ4A 2JA8J 1RT1B 1SQEA 2WSFC 4B3RJ 1QZZA 3K10A 1FKPA 2LYVA 3AT1B 1VQYA 1WHXA 4XNFA 2H5IB 3I31A 4OMYA 3SFIA 1JLCB 3FX3A 2PT0A 2KFNA 4DDFA 2MKYA 1R89A 3ABUA 1S7AA 2FSWA 1IO2A 2AKWB 3R9LA 2DEJA 1TUVA 1KQSR 1Q1VA 4WWSA 4QU7A 2ZVSA 2C42A 1HWUA 3DM2B 2H54B 1V3SA 3Q0WA 1RESA 2IJLA 3BJYA 1RBLA 4ZVEA 3TI0A 3RBZA 1XD7A 5KAFC 2B4UA 4D5FA 3TDUC 2W4SA 3BKTA 5K20B 1HWLA 1I27A 2HBQB 1Z05A 4IFVB 2PJRB 1OYEA 4AD9A 1XMKA 2ZXHA 2XB2D 3NWSA 3G71S 3WTZA 4PQUB 1RTDA 2XYGB 3ETOA 5M5WJ 4Z7YA 2GJIA 1LK7A 4L9TA 2EINH 2RS8A 2L3MA 2MC4A 3ZMTA 2KZVA 1WI3A 4RGXA 2R7SA 2VOOA 2AQEA 2GW8A 4HI1A 3P9IA 3F8MA 1ZRDA 3A0BC 5D8HB 2EH3A 2CQQA 1MJAA 4O44A 1GT0C 1VTNC 3FXJA 4KGKA 4RBUA 4Z2YA 2POKA 1H9TA 5E0OA 1YQHA 4LRCA 1RHJB 2UUCF 1U49A 4DV4J 1IM4A 1WKLA 3V6KA 4IOCQ 2HGLA 1STZA 5H9EJ 1TL7B 1OKRA 2LA4A 3MKLA 4AIKA 3BZQA 1GXTA 5HATA 2HR3A 2EFGA 4Q45A 3MD3A 2OAUA 2OKQA 2RKHA 2QQ9A 3FMSA 3AAWB 1Z6TA 4M5NA 2HWHA 5CYJA 2NVXJ 3QJPA 2GVDA 3JSOA 4ZVGA 2LMIA 2XI2A 2IM1A 2VQFF 2ZOMA 2QGFB 4C3IJ 1UA0A 2H8WA 3AJ2A 2ZBCA 4WIQA 4MFDA 2PFDA 3IWNC 2R7ZJ 4HDUA 1HBUB 2P2CB 4ZJLA 2FVQA 2CVIA 2P8TA 1F43A 2W2PP 3KK2B 4PXEA 3L2CA 2B6AA 4LBHA 3FJ2A 1GX6A 3WX4A 4B9TA 2AW0A 3V2UC 1X9MA 2XIGA 2UUBF 3M1EA 4PXBA 4DR2F 2AP6A 4X66J 3Q23A 4OHVA 3SQGA 4MIBA 3JSPA 1K79A 2VJIA 5KFWA 3A2KA 4ES2A 4CDIA 4A3IJ 5ILUA 2V9WA 4WU3A 4ZCMA 5DM7F 3OTOJ 3BSCA 5E17F 3GU0A 4WFBQ 2W24A 4GFBA 4ITVA 1GXQA 2PEHA 3HSFA 2XF6A 1YRXA 1SV5B 2ASDA 5F9LA 1PYVA 2F4VJ 1F4KA 4LMZA 2NQPA 2GQQA 4NQWA 1VBZA 4HDGA 1FFWB 2UXXA 1FRMA 1SD7A 3IH2A 3JSRA 4DV1J 2ZE2B 2Y0MA 3LP0A 3DLLQ 2M7SA 2L02A 4F2RA 5HS7A 2HHHJ 3IR6B 4MKBA 1SD6A 2IGKA 2L9WA 1N75A 3CCVI 3IXQA 1R7IA 4E7JA 1W36C 2IJFA 5E79C 1VNDA 4LLGF 4ZK7M 4A3KJ 4BE1A 2ZHBA 4K50A 1W0TA 1TNTA 5KFEA 4YP3A 1RR8C 2ZJ2A 3J81K 2FLPA 4FF4A 3GXOA 1IDYA 1I3QJ 3UVJB 3LSGA 1PVEA 1RHMB 1I1GA 1DTTA 2ILZA 1YRUA 4CH7A 1UP1A 3R5BA 1WZ2A 4IRCA 4LIVA 4CLFA 1BQMB 1OR7C 2K06A 2E5IA 5K5MA 2QCOA 3IP0A 1O8BA 4RO0A 2GA7A 3CSKA 3IBFB 4N7TA 1HSJA 3HM9A 1A6LA 1CULB 3PCOB 4USVA 2ERRA 4RZRA 3JSMB 2G2ZA 2RDDA 1R3NA 3KK2A 1XR7A 3T5KA 3MFKA 5FJ4A 3CJ8A 5I3UB 3NCPA 1TKDA 3ESWB 4ESFA 5HDGA 3BO2A 3G6EI 5DGAA 3M6WA 4WKRA 2EPFA 3MM7B 1HMVA 2HYGD 4XAKA 2NS7A 3CD6I 3I4MJ 5LGNA 4E7HA 3BZ6A 1RT2B 1VLYA 1ZELA 3OTDA 4XORA 4E7LA 4FNHA 2FNPA 1VCTA 2J6UA 2GAUA 4HACB 4P2XA 5ED4A 1S10A 3BR9A 2FJXA 3TA0A 4RW4B 4K5RA 4L0YB 3K4NA 3QIPB 4HL9A 3BR1A 2YWFA 3OL6A 4KISA 1JK9B 1HNIB 2OI2A 3MOZA 2Q79A 4XMYA 4ZOSA 5H6RA 1OY9A 1QVUA 2R4FA 3AD8C 1YJRA 2MKSA 2XMTA 4ID8A 1YSJA 3TBIA 3CIMA 3M4XA 4QCLA 5FLXK 4OYAA 3R7NB 3CJNA 3GTMJ 5FKKA 5J2NA 1ETQA 2RQPA 3MCOA 2H65B 2C3OA 2ZBKA 3FRZA 5LMNF 1ZG3A 3H2LA 5SZTA 2Q2EA 5DGBA 4RDUA 2FC9A 1WFXA 4J9UE 3H35A 1TKTB 2E44A 1LEBA 1NM2A 4IYQA 4ZP6A 2NPIA 2PO4A 3GYHX 2WHOA 3RB6A 2FLNA 2HGCA 4NRUA 4XDDA 2V1XA 4CUGA 3C66A 1BQNA 4XLEA 2ZKTA 4GYIA 2IRFG 2CJQA 3S93A 4FDFA 1GHCA 4PABA 3FXRA 3B4MA 4C4WA 4KN7X 4X4SA 2JHEA 5RUBA 1NDLA 5F8MA 2EIMH 2GAHC 1RHQB 1AT1B 3P6YC 3SDGA 4DPWA 1DQ9A 3EUNA 1S3JA 2Z2YB 2M0CA 2VFUA 1N34J 3MPWA 2RU9A 1R0AA 4Q8FA 2X9DA 1RT7A 1NCLA 3BP8A 2WONA 3HJEA 4BQNA 1XN7A 4LRDA 2HHPA 3D6HB 5LLQA 3EXYA 2ZXJA 3BPVA 2ZNZA 2Y1JA 1VC6A 2OMOA 3DHXA 4MLOA 3SEZA 3J81Y 3FDSA 1BI2A 2NYHA 3HBLA 5DS7A 1DTTB 4F04B 5JXSA 4OOIA 3U2RA 1EQ0A 3NGKA 2K4JA 4CO8A 4BDZA 2H27A 3UKGA 1IUYA 1NPKA 4MFBA 5J1YA 2Y0BB 1IVZA 4QWAA 2VV5A 3NBPA 2DTZA 2UV8A 1OR7A 1B0PA 1X1BA 2MKKA 2CQ2A 2BUNA 2GIZA 4AUKA 4DV5F 1JXSA 1PBAA 1JE8A 2KVQE 2EC0A 2K02A 2RJZA 5A0YB 4KV8B 2L4AA 3OR1B 4EBEA 4ED3A 2VC1A 1RWOB 2KRRA 2V4QA 1Q8LA 1ZTTA 2Y0SN 1X60A 2IGOA 1UEUA 5FLXZ 1T6SA 3LWFA 1VQ4S 5CJ9A 4U96A 4Q43A 4ZCLA 4JOMA 2BHYA 1J59A 2XZTB 1SEUA 4UUSA 2B51A 1N5VA 2FHKA 4OI6A 5H9EK 1RCXB 2H6CA 3IR7B 4IOBA 3FC9A 2XAUA 2HFSA 4Y15A 1N54B 1S6PA 3I0RB 2NZCA 3G1MA 2OU2A 3P45B 4IH5A 3W5YA 2BW2A 1CSJA 3IMQJ 5HLFA 4ZHRB 3CESA 2HDCA 4OIOF 4J9VA 3GB0A 1WVRA 2MGZB 1LW0A 2I5JB 3SZTA 2JOQA 2ZCWA 4BNCA 3DLHA 4P1WA 3A02A 1VQ5S 2X6YA 2DH8A 4YFKF 1R5HA 2OPQA 1UAWA 3QGHA 3M8ZA 4EJOA 1R0BG 3NGRA 5EF6A 1VOMA 4M3EA 2CZVC 3ZN0A 3LAJA 3LUYA 3J80Y 2ATLA 3FXLA 4DCJB 2BJ9A 3EPGA 2XYPB 2PJPA 1Q8KA 2YQ1A 4A0ZA 2JFDA 4FE7A 2CU7A 2UXDF 2J6SA 4RKUC 5KT3A 1H7WA 3QPIA 4ON0A 1L5UA 2H4YB 4JI1J 4I02A 4ICLB 2F4MB 5KG0A 4RBTA 3KYLA 4RNNA 2WY7Q 2HNZB 2FEZA 4BWJA 1HBXG 5IT9Z 3RKXA 2AZ1A 5CYMA 4L5IA 3KMQA 4YHHJ 3TMOA 4GMKA 3QWPA 4DBQA 4FYWB 1KVKA 3GE9A 2PC6A 2ETHA 3T0YA 3A3PB 4JI6J 1N8RT 4A12A 3QFHA 3S6EA 2W1OA 4DJBA 2OPPA 3M8WA 2E71A 4IR9A 3BDPA 2R7QA 3VYSB 4ZLPA 3RB3A 2C22A 3C19A 1D3WA 3IS9B 2X0LA 2IS6A 4KIAA 4O3RA 4YUDA 2NNNA 3H5YA 3CO0P 5B7WA 1W2BR 2JT1A 2OZ6A 5IWAJ 2JA6J 2E2HJ 1WKKA 2M9KA 3SMZA 1W0UA 1IV8A 2GVDB 4IO1A 1EHWA 5E3PA 2RILA 1R8CA 1FVSA 2KFDA 3MD2A 1YQAA 1RSCA 4YY3F 2LQ9A 4EJTA 4XLCA 3BPXA 2ZUAA 3PTWA 3AOAA 5KFUA 2CAJA 3QRQA 3V4GA 3DV8A 2X4HA 3KFWX 1CS4B 2V79A 2U1AA 1ZM9A 2LY9A 2X6WA 3WIVA 1SFOJ 1ZTRA 4WFNQ 3T1BA 1ETXA 2M0MA 2FBIA 2FY1A 2NYXA 2CJJA 2D7SA 4DSEA 5THWA 4FS2A 2W7AA 1XMBA 5D5VB 5B0FA 4LRFA 5IM0A 3HHNB 2B0LA 2OV7A 3HVTA 4H4KA 4B3TJ 4E98A 2ECBA 3TJ9A 4UF4A 3MTKA 2VONA 3MQ0A 3GONA 4O0IA 2KT0A 3RW6A 3TDZC 3RGIA 2ASYA 1R4MB 2KQRA 4DUYF 3GTQJ 8AT1B 2R3SA 1Y56A 1OWXA 1OYWA 4MNUA 3EUHA 3QSYB 3NS7B 4DV0J 1H72C 1W5SA 2GS8A 3QYYA 5TJJA 2C1EB 3BQ2A 1R8BA 1BE4A 2WTFA 3FISA 3MOJB 2M8EA 2B7EA 2C2OB 4RW9B 3L00A 1IRFA 2ZD1A 5JHFA 4FE4A 2DD8S 3GTKJ 4Q47A 2CW7A 3OXFA 1VQOS 5F3TA 2QVOA 1S7HA 3DKDA 2JTVA 2BE5F 2HGMA 3KJVA 1JLAA 2DK5A 3WHBA 1H89C 5CVJA 3WTSC 3HHLD 2V68A 1S57A 2HRYA 4JV0A 5GAEU 3E6BA 1YITS 1PDNC 2N8GA 4GC6A 2DK8A 2CPEA 3CE8A 3HZEA 2RVCA 2LY1A 2M4KA 5IT3A 1LWXA 2Q1ZB 3GIIA 4C48A 4U7CA 3ABLH 4UW2A 3DXSX 3MF5A 1NPRA 2DGUA 1U6FA 4ILMA 4AXIA 3PJRA 2LQ5A 1J09A 1IJFB 4P2SA 2Q0OA 4GDFA 3KEYA 1FDNA 1T39A 4MTPA 3AL0C 3K69A 3I5AA 2GO8A 1RTJA 3HRSA 1ULRA 5K8OA 1ZZNA 2XAQA 3ZXSA 3H5NA 2RF2A 2QENA 3HUGA 3BH6B 3W60A 1MN9A 1ZA2B 3SV3A 3KLOA 3ECOA 3G6ES 3HLUA 4P6QA 3BGUA 2UUAF 3SZPA 2JVHA 2BW7A 2JZ5A 4AXJA 2RT3A 2ISZA 1ELOA 2NVQJ 2W57A 1HQEB 3IG1B 3V6JA 1SQFA 1RT5B 5B0AA 1AXQA 1YVFA 4NLOA 4JP0A 1SQGA 4WX9A 1XNQJ 4OYXA 3JTHA 4KTQA 5KFPA 5IOLA 3K4MA 2OEMA 2YNGB 5CH7B 4PUSA 3M2RA 1X19A 2DJNA 4B3SF 2QFIA 2YSRA 3I0SB 3JRFA 2DISA 1WJFA 2BQ3A 2HU9A 3OIOA 2OP5A 1SJ4P 1S6OA 4LSNB 5F8IA 4R1HA 2QGUA 3QGPA 3NNCA 5LHHA 2HVSA 2QLZA 1VYAA 3KLIB 2WV1A 3HD2A 1FD8A 3BS9A 2IC3B 4A8WA 3DNCA 4A5NA 2PA8D 3C15A 2GVZB 4IPAA 1NHKL 3QT5A 1TTHB 1G3TA 4AWXB 4XIUA 4H4KC 1NK6A 2M1BA 4DV0F 1QM9A 1AFJA 2EIJH 4Y00A 1EA3A 3GCXP 4CA0A 4LFAJ 3AG4H 4C3HJ 1DQUA 1DURA 5GMEA 3ENAA 3H3VK 1X5SA 3GJSB 1WCMJ 2HRUA 2WOMB 4IXAA 3MZ8A 1WHUA 4XOTA 3DLEB 4ZVFA 2DTRA 4QIVA 3AQPA 2LF8A 4NLGA 3QJLA 4Y13A 2LNBA 4M6XA 3C6TA 4QJVA 2RNGA 3RAXA 2DJWA 3GYXB 1CC8A 4PCQA 2VPRA 1FE0A 2HTSA 3ERMA 1M5PC 1H3DA 3CCYA 1FNNA 1Y8QB 4L9JA 3FUYA 2Z30B 1WHWA 2G13A 3TUPA 1GXUA 2D74B 5C24A 4F92B 1JKQC 1GV5A 4EEFG 2DXEA 2PMZD 2GJ2A 2HBRB 4BJ6C 5IY5H 5J2QA 4WKYA 2IRUA 1D1CA 4XLFA 2FUG9 2EB7A 2AO9A 2MBFA 4C9YA 5C44J 2DY9A 3TW6A 1IR1A 2HPIA 2FVPA 3M8EA 1X1PA 3M30B 2AD9A 1SMTA 1RRJA 1ZG5A 1MSEC 2DYRH 2YUSA 2CDRB 2EZLA 1DQAA 4BLGA 4ELUA 3F41A 3QPTA 3GTLJ 3D6FB 3NEUA 1JKRC 3KKFA 3BSOA 4NCBA 3BR2A 2SXLA 1X4AA 1S59A 2MGZA 2LLZA 3OXGA 2JK3A 3WGIA 3CCVS 2DA5A 2JLEA 4E7SA 2WWYA 1SBRA 4LVNP 4WXCA 4G6TB 1RHKB 1SJQA 4I64A 1P7JA 3S2HJ 2DRDA 3H4BA 1RU1A 4CT8A 1BJZA 4JBAA 5E3CA 4G7ZF 2DNZA 3ASNH 1FSHA 3ITHA 2DYAA 2XAJA 1NK9A 1B72B 2COMA 4YDDB 4KT5C 3UN2A 3JR9A 3GJQB 3BGRA 4NCAA 3N6NA 2YPYA 4OMZA 9RUBA 3L3CA 4JV5F 1M1GA 4BHQA 5HN0A 4L0ZB 1FK9A 4ED1A 3DEWA 3ZZPA 1QD1A 1P4AA 1VQ5I 5KT2A 2MSSA 4ENJA 2XMUA 3P9CA 1L0OC 1JJHA 2COLA 2OEKA 4IG3A 2EFNA 4JV5J 2B43A 3WX8A 1QVTA 3K6GA 1FP1D 2IVYA 3I9ZA 1MSWD 2F1FA 1JB0C 3DMJB 3ZFVA 4KGXB 4J5OA 3T5XA 4ZP8A 2QJ3A 2X3GA 3MFHA 3R4KA 2YWKA 4MKYA 4M71A 1IXCA 1DU6A 2RSQA 4MTEA 2LKSA 2W85A 5A2QK 3HSDA 1UKUA 1EH6A 4U7UD 2MA3A 2DGVA 1PO6A 3AQOA 2XY5A 4XRFA 1NKEA 3LSTA 4K59A 5CZVA 3R5JB 3DKYA 2UP1A 5CA5A 4ETZA 1TK0A 4XR6A 3HKWA 4Q2MA 2UVWA 5J1EB 1DZ5A 2HMIB 4PFPA 2RQQA 3TVZA 1E2XA 3U1MA 3RUBL 4AT1B 3QQCD 2EVZA 2O03A 3NP5A 1IKWA 1UCRA 1ZGJA 4RW7A 2WW8A 1B9NA 2B4PA 2XY7A 3LTOA 2YKMB 3T8TA 1WSVA 3QATA 1DU0A 1X5OA 5LXYA 4KHRA 1HHQA 1OISA 5CYMB 4ZVPB 3IBCB 4M74A 3ZZOA 3VAHA 5EUHA 3TAQA 1T3OA 4ENOA 3SI8A 5JJBA 3SFUA 1NDPA 3DLEA 3LL7A 3PQJA 5HNFA 3UI3A 2P6TA 2MH2A 3JCUC 5GPCA 3I32A 4TLRA 4YB7A 5EWGA 1JJ6C 1RKJA 3EETA 4KB7A 3RRGA 1VQ7I 2CQBA 3KTQA 4MAKA 4XOPA 3LGNA 3SCLE 1Z3XA 3PM9A 1NXIA 3MUVP 1CJUB 4P2FA 1KLMB 1KD1T 2L9RA 2IS1A 1PG5B 3HM5A 4MKVA 2KVIA 2JLFA 2WVFA 1Y10A 3OFEA 1N34F 3W2AA 1VC5A 2KTQA 3GLXA 2L01A 1FJLA 3TKYA 4Z7CA 1ITYA 3CC2I 3BV8A 4RWXA 2HZCA 5AJ3J 4MYTA 1NK5A 1U1NA 4UUVA 1QLNA 2AYGA 4LIUA 1S29A 4IVNA 2X1DA 3H5XA 3TOAA 5CYQA 2DB1A 2JH3A 1HNZJ 5F6FA 4DF8A 4IF4A 1Y5LB 4A8KA 1JKHB 2VFVA 3Q0AA 3AOCA 4U7BA 5I3QA 4IHWA 3LOUA 3BCAA 5ETVA 2EV0A 1IBKF 1MKMA 3SFZA 1WHYA 2LXIA 3DEUA 1VQ8I 2XCAA 2ZBIA 3Q24A 2HNYB 2YQ0A 4WE1A 1U1QA 2LQJA 1FRHA 4YR0A 4IO9F 4PG7A 2KU7A 2DITA 3C6TB 1JUPA 3QAHA 1T9YA 4A8FA 2IT0A 3VR1A 4MK9A 1C1BA 2M9HA 3DOMA 1NZ8A 5DUKA 3Q8UA 2KHCA 1JKHA 2KRCA 1RABB 2ZM6F 4KFCA 3KDOA 3OYIA 2D45A 1RK8A 3FSYA 3VFZA 2RD5C 5KFRA 3EVMA 1XSDA 5IOZA 4YELA 4CZCA 3A3OB 2J0SD 1RP5A 2R9LA 5HROA 4LMYA 1EJ9A 4K4SA 1DFDA 5HK4A 3ZNUA 3D0IE 4A69C 5CCMA 5K5OA 1S8NA 2VC0A 4U8YA 5F1RA 3KWMA 3BB5A 1J2VA 3CD0A 1JQGA 5KFIA 2ILYA 3PJXA 4N8NA 4CLWA 4UOHA 3LA7A 4IQ4A 1B8IA 2V9PA 1XNQF 1L3LA 1CJVA 1WWHA 1BWEA 3PRDA 3J7ZI 4ECWA 1MMSA 1HDDC 1JGGA 2IA2A 4G3IA 2W4PA 3CO9A 5F04A 5HLHA 3QQAA 2HQFA 2JMWA 2IY5B 5K9FA 1UL3A 2VPYB 1UMJA 3B6BA 4OYOA 3JYTA 5GAEJ 1Y11A 1HKQA 1S9FA 5DJBA 4YRVA 6PAXA 4BJ5C 1R5GA 3K1NA 3SZGA 1L3UA 4PQUA 1G3OA 4J9QA 3LW5C 4MMOA 3OXLA 1R31A 2PJRA 5IQQA 5K8PA 3I9V9 3O5TB 1U2FA 2JEGA 2LVSA 1S0OA 4ZA1A 5KG4A 2GVZA 1ZGAA 3K1MA 1YLXA 1OMSA 3HOZJ 2XG8A 1Z3YA 3UPFA 1LV5A 4WYLA 5F0UA 4OZ0A 1YO5C 2QLFB 2VICA 5HANA 4O44B 4OV1A 3NS5A 3HSRA 4P5OA 4ECVA 1Y5NB 4LLLA 3RDIA 1ZRCA 3MECA 3CO6C 5C7PA 2M2EA 1OPCA 3M8PB 1VJQA 4I98B 3F23A 2HEKA 1LVAA 4CGZA 2VFRA 3KHGA 2EFPA 2VF3A 4XLPF 3I55I 1U47A 2XWYA 5K14A 3EM1A 3ISND 3R5GA 2C3MA 3ZZYA 3HOVJ 2RRAA 1NEEA 2HZVA 4USHA 3UD4P 1HNIA 1S12A 2XWXA 3ZTQA 3HT0A 4WK8F 2HDWA 3I5BA 1MDMB 2MD0A 2B4VA 4A6EA 3VAFA 4LK0F 1O3RA 1FWZA 3BZKA 4ZTJA 1NK3P 3PSFA 3MZIA 4NB5A 1BW6A 3MZYA 4P9UA 1IKWB 2B5JA 7FD1A 1CJKB 3OPKA 5DV5A 4AE5A 1IUJA 2ME6A 5F08A 2E5GA 4PK4A 2FYXA 2IA0A 1ZN2A 2YR2A 1FTCA 3FKIJ 3V8JA 3PFIA 3M1VA 4OZLA 3IGNA 4ELTA 1JIHA 3FKJA 3LAPA 2ACYA 1WTFA 2KPMA 2ZZNA 1B9MA 1IV6A 1H38A 2XZWA 1MU2B 3TQ1A 1W7PA 1KQ8A 2WY8Q 1VQNI 5EEGA 2EJRA 4F3MA 4M95A 1VQPS 4M5LA 2KT5A 5KAKA 4U0WA 5LEJA 1NDCA 4OJGA 3DTKA 2Z5UA 1SC3B 1CF7A 3HOYJ 1XSVA 1D3YA 2LXUA 4IRGA 3KHLA 1X4GA 4EK2A 2FU4A 4RNMA 4LREA 3GTOJ 1NK8A 2FZCB 2OAZA 1J9IA 2EWNA 3HHLB 2JL9A 4PJNA 3W7BA 4WWCA 4PGGA 3HJVA 2BKPA 3CUQC 1ROFA 1VHFA 2GGPA 2L08A 4MYUA 3ZQGA 1H8AC 1I94F 4C8ZA 4J01A 2KI2A 1Q5VA 1Y1VJ 4FYXB 3K5PA 4P96A 3O2PE 2DEIA 4R8UA 4BBRJ 2M87A 4FKYA 3HVAA 2C2MB 2J0QD 1RQ0A 2E1PA 3WODF 3I4NJ 2M8HA 4P10A 4JV1A 1KLMA 4ID5A 4PSWA 2ZH7A 3CDWA 3HHLA 1U1MA 1YG2A 4H54A 3EZ5A 2Y3YA 5J2QB 1OSDA 1QAXA 2AT1B 4LIWA 1H88C 5C24B 3K4BA 3MMYB 2HNDA 3H2VE 2FJBB 4B9MA 3DFGA 5BOXA 2XMVA 5HVGA 3DU5A 1JT0A 3CPWR 1VMBA 3CCSS 2RUSA 3MTJA 2HXIA 5K8NA 1E6YB 5LSRA 2O61A 4OYWA 4ID5B 2KJCA 3Q89A 2X1FA 4OJ1A 4LF9F 1TP4A 3LALA 3V6DB 1JWWA 3DRPA 2VIHA 3GX4X 5TISC 1ZAVA 1IN7A 2C6YA 4B47A 1KOHA 5KFQA 1TLHB 4OAYA 2QKLB 2NPFA 1KQGB 2HDDA 2UWMA 2Y1LB 4NC8A 1ZOTA 3BREA 2M88A 3CCUS 4MFEA 2DY1A 2QA4G 4N41A 2BZTA 3G4SS 4R5PA 2MJUA 4DNCA 1R0CB 1MBJA 4Y2MA 3HXMA 3JQMA 3BBBA 3S14J 2V4JA 2XGPA 3P5BP 1DGWY 2ZOFA 1G3YA 1U8BA 3X1LB 2N82B 2JEIA 1UFLA 4FT8A 1KGSA 1YJVA 1I50J 4LF9J 5HMZA 2CNOB 1R27B 4DV5J 1SFEA 4K4ZA 2M0GB 2RMLA 5J4VA 1WI9A 1ZREA 4C3MA 1XC5A 3Q0UA 2DA1A 4I6ZA 3C2GA 2RQMA 1Y0NA 4PXDA 2FBKA 2Y9YA 4XONA 1R00A 3T1YJ 4C0OC 4HX4A 3A1YG 4F02A 2KISA 4CLYA 2K5CA 4YEJA 2B7CB 3FBEA 1YGYA 4AD6A 2R2UA 2NVYJ 1RPWA 3WE3A 1OCTC 3H40A 1TFWA 4AYBD 4IRHA 3HKZD 2OQRA 3W66A 4HPQA 3B02A 2XMJA 1NKCA 4I0AA 4PPZA 3BGFA 3BJ6A 4I2QB 5KAIC 2AJQA 1VQSA 1MZBA 1XC9A 4QYZK 3DGPB 5LRSA 2J0XA 1AWCA 2FXAA 4O3PA 3ZZZA 5GP9A 2HQRA 3UO0A 4AM3A 5HDKA 1WJ5A 1BC6A 3ILOA 5DCFA 3JRHA 4ZC3A 5IC6B 3EZUA 2E1RA 1SL0A 4XKCA 1FWKA 1DP3A 1WDDA 4Q8EA 1RT5A 4NYOA 5EX3A 1HFEL 5KFVA 2LD5A 4ENMA 1CPZA 3NARA 4JV2A 3CCRI 2RIJA 3AY0A 2E1MB 3M7GA 2MQQA 4ATNA 4EO6A 2P6SA 1U8RA 5J8CA 1SVLA 2F8HA 4ZN1A 1OCPA 1HBNB 1APLC 5BNGA 2BDPA 2AU0A 4KYZA 1S9GA 2BA9A 1YJWI 5KCMA 4USIA 1IBLJ 1QHHD 2VPXB 1YBAA 4OZJA 3ZQCA 1FLIA 2VG6B 2JUGA 2XSJA 2PE8A 2XDVA 3CEDA 3OL3A 3NRVA 2QMXA 3HJFA 1IKXB 4HKQA 2DO7A 2AYMA 3J7Z5 3RCOA 3SEQA 4IG0B 1HBMB 4U87A 4NA2A 2IYGA 3FZBA 4KR0B 2DIUA 2V1DA 4L5EA 4CLLA 3VODA 3BGRB 4C8NA 2R7RA 3KK1B 3A4TA 3S2WA 2R0QC 2GHWA 5BYRA 2FNAA 3QYFA 4HLBA 2CSOA 4NC7A 4RA2A 4LITA 2KZZA 3KJFB 4FP9A 2HLUA 4ZN3A 4JYAF 4DFKA 1U1LA 2PSZA 2QV6A 2MHNA 3J7AO 4A48A 2ADUA 1JLCA 1U6GA 1U24A 1FEXA 1D9DA 3VALA 5B66C 4X4RA 3NMAA 3KZIC 3IHUA 3DP7A 1Z77A 4CO5A 3L7UA 3O1LA 3N5FA 4WE1B 3OFHA 2OF7A 2XMMA 4ITSA 3JSBA 3CF5Q 3D5LA 3BBFA 2CUZA 1J5OA 3NGTA 4B3SJ 4Y0FA 2UZKA 5J47A 2RH3A 4LUBA 3DI6A 1E6VB 2A05A 5LL6d 3VWSA 3DOLA 2HKEA 2XASA 3KYDB 4LOCA 2XSJB 1SJ1A 5KOWA 4ZVUB 4A3DJ 1SCJB 3DYAB 2ZKZA 3UR3C 3M6VA 1ZQ3P 2AHQA 1P1TA 4P7VA 1JMTA 1T0TV 2K40A 1I39A 2C3YA 1R36A 3KHRA 3N6LA 9ATCB 4EQQA 3H5RA 2YU9J 2W2OP 5KFDA 1LDDA 2DRBA 1Z2LA 3R1HA 1ETVA 1NK2P 3BG6A 1SIWB 5B0CA 4R25A 1QY7A 1YJTA 1ACIA 2H09A 5CAAA 2EIKH 4Y3OA 1O7LA 2CJXB 3FQLA 1IAWA 2R2RA 3Q9VA 5HJYA 5HBMB 4F0MA 2WAEA 4K4VA 2VL1A 3OL8A 4LF5F 3HSZA 3PX6A 2V34A 1HYSB 4RM2A 2DNYA 4OWRB 1D8ZA 3D66A 5FJ8J 5E33A 2BXYA 3DLJA 4CWBA 1JTYA 1ORKA 3PFOA 2AJ4A 5IXUA 1S0MA 3ZMDA 1TC3C 4A8QA 1SANA 3LFUA 1OFCX 3NMRA 1RE1B 1LDKB 2WK4A 3M8JA 2UXNA 3MWMA 1UWBA 1Z21A 3ZZTA 1IBKJ 1HNXF 2XI3A 3MKWB 2OUGA 3EWGA 4DLEA 1K4SA 3MCSA 1RAGB 2ASLA 1S9EB 4I0BA 1LB2A 3HOTA 2HEOA 3BDEA 4JYAJ 2JPBA 4B17A 4U0YA 3P5TL 3KEQA 5M2PA 5TRDA 4I7FB 5HS9A 5HQLA 1K8AT 5H20A 2JJ4D 5HAOA 2P81A 2XKPA 3H9GA 4BJTA 2QT7A 3L4BC 3IC7A 3M8YA 5ERIA 3MWBA 1JKOC 3VTIA 2CQPA 4A3LJ 1GXLA 3LAKA 3O3LA 5L38A 1W26A 4C8OA 1XDSA 4KIFA 2KO1A 4KICA 1VQ6S 8RUCA 3IR5B 2CW8A 1IJEB 5DD4A 1HYSA 2ID3A 3K5OA 4IH6A 2WSCC 4O4GB 5G0RA 4CCOA 2H3EB 4KRWA 1UG2A 3GCWP 3OSNA 1T9XA 2B9EA 3PJ9A 3BZCA 3I5CA 4FYYB 2XF7A 4QIFA 4PSXA 1T9WA 2XS7A 1BY9A 3CJTA 5B09A 5KG1A 2ICWG 2XCPA 4CO1A 2Z57B 3S01A 1K61A 2RV8A 4CCHA 1RGVA 3OS0A 2IS2A 1TL5A 1DRZA 3CJ3A 2QLBB 2O67A 4ZPWR 1TWAJ 4KNYA 2AX1A 3TP0A 2CFXA 4F4WA 4Y52J 2VJVA 1FF2A 1SFKA 2K2PA 2HTJA 4DQIA 4XICA 4KPCA 2VFTA 2YTCA 3Q83A 2Z1DA 1RNLA 4CHUA 1F5BA 2HWTA 4IRKA 2FJEB 2LECA 2LFBA 4QSHA 1Y9OA 4B08A 4LG0B 1Z2ZA 4CDGA 2LKXA 4NZ6A 1UVIA 1RT3B 1UWAA 3OL9A 1Q95G 1VRTB 1A6QA 1RYRA 2KT2A 4K0KJ 2VDHA 1IWAA 4KHPF 1O5JA 3ENVA 2WAQA 3LF0A 1Z6RA 2H1KA 3HUGB 2J7UA 4OI2A 1AW0A 1ZA1B 1TAQA 3T1YF 4ED4A 5CZXA 4O6JA 2Y8YA 4LT6A 1GMUA 3SYZA 3DOKA 2MTLA 1KU7A 2MC3A 3DOLB 2VN2A 1FNXH 1EETA 3AHPA 4QQBA 1X4OA 3M3YJ 1ZLJA 3R2CJ 3CMYA 3CCSI 1R49A 1YS7A 3FBBA 3TA1A 3RSNA 1X4HA 3S1TA 5K14B 3EVWA 1HBMA 3RG6A 2DA4A 1IR0A 4A8YA 2DGQA 2VA2A 1L3TA 2YNFB 4XSZF 1D1UA 3DLBA 1HNWF 5E8IA 4JI7F 4PWUA 2HYJA 1HKTA 2IEKA 3BN4A 1ZK8A 2LMDA 3T5HA 2F5CA 2NUHA 2B3TB 3BQ1A 1Y8RB 3CMEI 1EH8A 1BQNB 2OPPB 4NBQA 2GXAA 4V19X 3BSAA 3OYDA 1Z1ZA 1IRGA 3D6MB 5J8FA 1J27A 4C3JJ 3TQEA 2J7WA 4NC6A 1RT4A 1C0WA 4WFYA 1TKTA 3NXZA 3OUYB 3ML6A 2A10A 4CLUA 2MQ8A 2ZKUA 2QBYA 2Q2EB 4HI2A 2P4WA 3QBCA 1K73T 2L5QA 5FLMJ 2IJRA 5T41A 5DEQA 2HK3A 4HQEA 1ACMB 1S5ZA 1XMQJ 4LSZB 2BM0A 1LFBA 3P96A 1XGSA 1S6LA 5KFNA 1MIJA 3NAUA 3H92A 2OFHX 3F9KA 5J2NB 3G1LA 5EN1A 1I94J 1WOPA 2UXBJ 4EMSA 3M4OJ 4DFMA 4A0XA 3CTAA 1LFWA 1MSFC 1G4DA 4X4QA 2ZHOA 1E3PA 1OMIA 2KXHA 4F3QA 1FE4A 4N4OB 3VAMA 2IJNA 1OYYA 2R92J 5IP9J 2N3OA 4KMFA 5JVGQ 4B9SA 4IHXA 2G7HA 3WGHA 4O4GA 5G0RB 2IPOB 4UVAA 1PYOB 1JLEB 3C18A 1YE9A 3QLHB 1I6HJ 3OYGA 1NK4A 4RUCA 1WC3A 3W62A 5IT0A 2D9PA 3C6UA 3OL7A 4ICLA 1KP6A 1EX8A 3S15J 5JLXA 5KFHA 3G82B 1AOYA 3BOQA 3QP5A 3GP9A 4HBLA 3MHYA 2A69F 2EFQA 1CC7A 4OLPA 2FBHA 4XSXF 1FOWA 4Q7AA 2RC4A 4Y2CA 2L4MA 1IKVB 1IR2A 1G7CB 1QPMA 5F0HA 4HDHA 2DR6A 2WVDA 2VG7B 5KG3A 3PW0A 2JEJA 5DQGA 1FTZA 2MB0B 4DOZA 1AROP 5E3MA 3DRPB 2D3OR 5K7HA 3COAC 4HEA2 2ACJA 4U7DA 3CW2C 3OYNA 4P9SA 4CCJA 3BPSP 2Z2ZA 2V8DA 3KLGB 1AZSA 4PUOA 4ED5A 2CNLB 2YX7A 4A46A 5BXIA 1YX3A 1VK8A 4C2TA 3ZPLA 3M2RB 1VQ4I 2ZO4A 1AUDA 2XEXA 4JI0J 1FY7A 5M5YJ 3BWGA 1CQTA 3FSXA 3BF4A 2VT2A 1S1XA 1UJ8A 3QSIA 3LWMA 5JLWA 2G7UA 4YB5A 2CUFA 3PFEA 1FWLA 4II2A 4U9RA 3VEPA 4J9MA 4OYMA 3OY9A 3CT9A 3KYCB 4UHTA 1QTNB 1V6HA 2HQDA 2ZE2A 2LK2A 3OVBA 2RKIA 4J91A 5IT9U 1RT6A 4ABZA 1R1UA 2M30A 1UJ6A 3UW1A 4ECZA 2KN4A 4KKOB 3VV2B 1BBYA 4IOAQ 3M2VB 2HVRA 2DMPA 2K7KA 1Y1WJ 4JUZA 3JTNA 2GO9A 3CCQS 2D3UA 2F65A 4CYCA 1FOKA 2M5YA 3F72A 5KG2A 3FFIA 3SDBA 3ENWA 3HGYA 1B0VA 4W98A 2IBDA 2WA0A 2BEOA 1HQ2A 3ZTRA 3FEYB 4DR3F 2NXNA 2R7XA 5A0YA 3CCQI 2CV1A 4I4BA 2J9EA 4J9LA 2PMZN 1HIYA 3MR3A 2DCEA 2VOPA 2VBWA 4MEYF 3TAMB 5DM6F 3CCLS 1NK0A 3VGTA 3TARA 2FVSA 3HSGA 2KMUA 4DV7F 3D28A 2V0NA 1OYIA 3NGDA 3PQKA 3CC4S 1FXDA 5F0WA 3HOWJ 2ZXWH 2AEMA 5L3BA 1JLBB 1RI7A 3ASOH 4A6DA 4FKXA 3S2DJ 2ZC4A 5GMDA 2MYFA 3ELKA 2HVZA 2BANA 3PR4A 1K1QA 2V63A 3PO3J 1JLFA 4UQTA 3I82A 4I1TA 3RZAA 4F52A 1ZH5A 4M3DA 1S1WA 1I5ZA 2DFEA 2HS5A 2APOA 3OSFA 4B3OA 2VBZA 3B73A 1USSA 5FLXY 2ZM6J 1VDHA 2JRTA 4RW7B 1V3ZA 2CWEA 4LVOP 2AF6A 4C30A 3M32A 2LYCA 1NKBA 3WTWC 3QFWA 3IRXA 4O3QA 4RW6B 3GPAA 1JX4A 2G2OA 1HI1A 2NOJB 1SJRA 4Z2XA 3R27A 4DWIA 3O8GA 2ZOGA 2LY2A 3HFVA 5AE2A 3V4IB 3MEXA 3K4KA 2XLKA 3OYHA 1N4LA 1WG5A 1KHWA 1R6RA 3EJMA 3NL0A 3CJQA 3VAJA 1GUUA 1IBLF 2PBIA 1RTIB 3CCUI 2J9CA 4WXWA 2CZ4A 1VS3A 5DETA 3CUOA 2QSGX 1X1AA 4KUMA 1JHFA 3GUDA 3HHDA 1XGNA 4P75A 3OTOF 4M73A 2RVJA 3UE2A 5J2PB 2V8PA 4ZMMA 2R7VA 1WSUA 3DMJA 3MAHA 1X4DA 1PBUA 4QOTA 4A3EJ 4F50A 1JLBA 3OR1C 2DCUB 3WTYC 4I2QA 3K2AA 2CRGA 3TWZA 3P49B 5KFZA 2LA6A 3LP2B 3CDHA 2L7MP 2R5YB 3PXGa 1EQMA 3MEGB 3CDBA 1XCVA 5F64A 3QZ8A 3G8TA 4DX5A 2I5UA 2RGVA 1KYWA 2LREA 3M6XA 1DQ8A 1R23A 2C3UA 4J7CA 5HP1A 2DR5A 2FGCA 2BOPA 3W65A 1H2UX 3DGVA 1RT1A 5B1BH 5F0CA 5KVRA 2NXJA 2F5GA 4RGUA 1FVQA 2UXCF 4QPQA 4LG0A 2WVBA 2OQGA 1TWFJ 2O66A 3SEOA 2VIXA 3LA3A 3ZQLA 1QSLA 1DAXA 2E36A 2AWZA 4NA1A 4Y2KA 3E3VA 2P7VB 3CDLA 1SUQA 1NZAA 4RPFA 5KHDA 1XSXA 1SC7A 4BQAA 1VR6A 4Y3CA 1SXLA 4RU9A 4ZIVA 5T7LB 1A36A 3A8EA 4WK3A 6AT1B 3AJDA 3NY0A 4IHYA 3E3XA 2CQHA 3UDEA 2X48A 4HZFA 2UXDJ 1X9WA 2K1RB 4RMNA 1N5SA 2FVRA 2QA4I 4DX8H 1AYEA 1XB4A 4OX6A 2JSCA 4GVLA 3I6PA 2VODA 3KLHA 4U7UK 1VRTA 1SL2A 1LOUA 4DSLA 3LP0B 2I5JA 2XBPA 4NI2B 5J4YA 1TWHJ 2JZYA 2HSEB 1BGXT 4NLVA 4C7QA 1TV6B 5E5NA 2YWWA 1W1WE 5T7LA 3AB4B 1W7PD 2VUGA 4E70A 1B70B 2J7KA 3HF5A 4V19K 4L76A 2W00A 4J9SA 4HG2A 1HA8A 5KK1A 3CNQP 4IUFA 3MXHP 2O7OA 1S76D 1U1OA 5LSOA 2DN0A 3SBMA 3CCMI 2Z58B 2I1RA 3HPOA 1FFSB 3RJMB 2CH0A 5K8MA 3W9IA 3OYEA 2HVEA 4KDPA 4YMEA 3MURP 4JI3F 5FLVA 4ANEA 2W8KA 1D8KA 2Q43A 1UEKA 1BHNA 4XO0A 4RBVA 2MY8A 2O01C 1IKYA 5CCLA 4DL0C 2DNMA 3PL8A 2DW4A 5H1SV 3RQIA 1NH7A 2IBOA 2WOMA 2Y2ZA 1HNWJ 1Q82T 3GFXA 5CQGA 1VQ9I 1GH8A 3A13A 2KFYA 4ED2A 2RU3A 2M8DB 3DPTA 1IZ1A 3QYEA 4I2OA 2DOFA 3E01A 2OPSB 3OHAA 2V1NA 5CYVA 1CJTB 3M6UA 5EGOA 2XNRA 1SB6A 1IWGA 4FYDA 2MLYA 1JLEA 4DSFA 2QO3A 2ZMEB 5D0GA 3ZMSA 5J1EA 1C0TA 5LJ5Y 2Z56B 2VPZB 3A1YA 1Q1HA 2OZUA 3FGVA 2C3PA 2UV1A 3CJSA 1YFHA 2LQ8A 3CIZA 2V69A 3I53A 1PAEX 5HBMA 1U2RA 1Y3KA 3US5A 5FROA 3CCJS 2VQHA 2D1VA 3HC7A 2DNRA 2ABYA 2F9DA 1RTIA 1KQFB 1KQKA 3VVUA 3IWZA 1JJ8C 5E3RA 1LPQA 5B08A 1X58A 1Q16B 4FETA 4C6AA 1K47A 3HZGA 2FLOA 4QWBA 4P71A 2R2SA 5MLCV 5J1RA 2KRFA 3Q8VA 2NS1B 2XC9A 4AUXA 1R43A 2MGQA 3ZMVA 2PEBA 3VF0B 1GAOA 5DDPC 2QG9B 4EZ6A 4BE2A 3FXMA 3RRHA 3OS1A 2OUMA 3GCMA 2A5WA 2U2FA 5KT7A 4N47A 1BWVA 3M9MB 4I2PA 1K1SA 1LJ9A 2A2CA 1HQUB 2ZH5A 2NUUG 2ROPA 3KJVB 5LHGA 4EMDA 1WUUA 4O4RA 4ZDOA 3DU6A 1QAYA 1I3OB 2E9RX 3LSPA 5IZHA 5AXKA 4GGGA 2OELA 1RTJB 4ZVOB 1HCRA 4MT1A 3FWEA 4QWDA 5DZ7A 2GIQA 5DO2A 3CJ0A 2W84A 2ADBA 5GAGJ 4WP9A 4M5KA 3EUAA 4HVZA 1BQMA 3D1OA 4GCVA 5L3CA 3M8QB 3HCXA 2XMKA 1WJ9A 2A6TA 3GG1A 4AYBN 1M1EB 2NLWA 2A6OA 2F5EA 1B59A 3RBDA 3HZJA 1C0TB 1F0XA 4A3BJ 3IUOA 2L7ZA 4BKXA 1U4BA 1LVKA 3NAIA 2ESNA 3A3NB 2M45A 1HMVB 3BGOP 3LA2A 3DHWC 2PQ8A 2K8GA 2YKQA 2P7CB 1TK5A 2O3DA 1FKAF 5DZ6A 3U27A 2AJ0A 4C8MA 2KJBA 3ECHA 5CPRB 2MYSA 4BS9A 5CVVA 3KP5A 4BYYA 4EJWA 3MAAA 1RKWA 5F8HA 4DR4F 1R9TJ 4KKOA 2HQ3A 1H7XA 4PG5A 1RZ4A 2RQKA 3MEKA 4OAZA 1FKPB 4XLHA 2PN6A 2IM2A 2XMAA 4ERDA 1TKZB 2F8MA 3GLLA 2G0EA 2E5ZA 3T5LA 2HHWA 1WC1A 5KG5A 1TVRA 3ZP5A 2OCCH 3H5SA 1NSPA 4P74A 2UVRA 3NAHA 4KJIA 1YJUA 4IG0A 1G3SA 1SH2A 1TFYA 4LF1A 4GO7X 4FX4A 2AIRB 4F93B 4B8XA 3KHHA 5JFRA 1ITPA 1ZPWX 3KJNB 4DR1J 4AQYJ 1Y39A 3MCMA 1F1BB 2ECCA 3POTB 2N4DA 5D0EA 4LF4J 3C1DA 2IDLA 3VSKA 3ILLA 1IQZA 2OPTA 1GTHA 4LB6B 2YX4A 2A18A 1LKZA 4RUHA 2E35A 5DRKA 3VHQA 2DO0A 1TK8A 4CICA 1LXNA 2XAFA 4JYKA 4B3XA 5L1KA 3RR8A 5AXMA 4OINF 4NASA 2DFHA 1TW2A 3BTJA 3OTEA 2ZNYA 3HSEA 4IHTA 2LRDA 2JC0A 1A6IA 5FDLB 4AIHA 4NLWA 3Q8QB 1DP7P 2LSOA 3HHLC 4TYBA 2YWHA 2I2YA 2X3DA 2GAGC 2IVMA 4JB8B 1FOYA 2V6AA 1QZEA 2E5JA 3GYGA 3CCMS 2R7DA 1D5VA 2D69A 2B9YA 3H7HB 4G1QA 2FIUA 4BDPA 4JP8A 1U2CA 2MQPA 4LIRA 3V42A 3BG7A 5GAGI 4ZVSB 4C11B 1FO1A 2IDEA 4ZVQB 2K7LA 2MABA 4EZ9A 3ABKH 2OPSA 2N7CA 3NOGA 3QWUA 1IBMJ 3VQTA 2BQUA 5HODA 4ZCKA 2G1DA 3AD7C 3J81j 1UVLA 3KK3A 4RBOA 4WU2A 4KA4A 4Q0BA 1PYSB 1O7FA 4J9OA 1J75A 2XPVA 3EDQB 1X7VA 2LC2A 2KH9A 2LQBA 3HD1A 3NOCA 4IO9Q 2NAZA 4GKJJ 2VQEF 4K4YA 3QRFF 1LK5A 5D6GA 1SPBP 1F6TA 3BKFA 1HNZF 2EK6A 1HR0F 1R1VA 1XX5A 4NLRA 2Y31A 2RRBA 1N6QA 2M52A 4BBSJ 5FGMA 2W9AA 4DCOB 4NE9C 1S97A 1M1HA 2LEBA 2BJ3A 1MGTA 2M3AA 5FFXA 4YB6A 2B0GA 5AJ3F 5MAOA 1FT8A 3UNGC 2HHHF 3UN3A 4QWCA 4OI0A 5GAGU 4L3KA 2QLWA 3GZ7A 1JT6A 1KU2A 2KHDA 1UZHA 3PG9A 1S7EA 3FHNA 4DUYJ 4DJAA 2QLJB 2GWRA 3C14B 2VKZG 3KPHA 1HKSA 1KONA 2R7WA 4Y33A 3ZQIA 4U0VA 3CD7A 3KEOA 1IG7A 4E6KG 5B3SH 3P3DA 2WVEA 2CXEA 4TYAA 5I4MA 2MZTA 4X62F 4UUTA 3BC8A 2EK5A 1HQEA 3IG1A 3K0LA 1I6JA 2K3IA 4IFYB 2ZH1A 1WEXA 2PD1A 3O8HA 3TOQA 3V81A 4Y6IA 5DUIA 1UAAA 4YFNF 2CQ4A 2MDAA 2EEYA 1QRYA 1SV5A 4K8RA 2WRMA 3VQSA 3TO8A 2QA1A 1K6YA 1M0SA 4IOAF 2LEAA 3TEHB 3BTCA 2QLXA 1J5EF 4CRJA 1FK9B 1KOOA 4Q44A 3ZMZA 1AKHA 3QODA 1HWJA 2HKOA 2MLGA 1WEZA 1V4RA 4X65F 3R6GB 3QPLA 1WKMA 2G0JA 4IFVA 1B3TA 2RDIA 2M4GA 4EATA 1TWCJ 3SYTA 3ITHB 4QW8A 3Q9SA 3CLOA 3TEGA 3PW5A 2CJKA 4LF8F 2DDAA 4RL1A 1X4BA 1RWWB 4NLTA 4CZZA 1MLAA 2NZ4A 2J9DA 5E7OB 4UB8C 2X1EA 2NCKL 3UD3P 4CXFA 3SSSA 2G4BA 2JVRA 2NVUB 3FMBA 4JI6F 3GZ6A 1H73A 5GADJ 1JUSA 3SCJE 2DFIA 2AS5F 3LNQA 1FX4A 1WDTA 3T3FA 5KT6A 4ZH4F 4R0JA 2XAGA 3PNYA 2W4CA 4G7OF 1TZLA 3GIJA 1XR6A 4FHTA 2O8XA 2Z2LA 2H48B 3EPZA 4DQSA 3F6VA 3E1SA 4TY8B 4I99C 4RGRA 1RT3A 1D8JA 2CQ3A 3QJJA 1OCRH 3OW2R 4F25A 1ONVA 2E1CA 1UELB 4EM0B 2GZWA 1P8GA 5D4SA 3CGIA 4OX9F 1X1DA 4CLPA 3D9BA 3FMWA 2VE9A 3R61A 1Z7LA 4QLCU 3U1KA 2IHR1 1T7PA 4KE5A 1KU9A 4BXUA 5KFXA 2BQRA 3M8PA 3CUQA 2AYEA 1LE8A 2GMHA 2K7JA 5JVGF 3MEDB 5C4XJ 2VG5A 3BR5A 5IM0B 1YOVB 4F8RA 1FT9A 1VQ9S 3ET6B 4NWBA 3MM8B 2L9VA 4UV9A 3K7RA 4XKBA 4HYKA 5GVQA 1DPRA 2HZAA 4BH9A 1FIAA 2LKPA 3RW7A 4C8KA 1WJBA 2BRKA 5KFYA 1XTZA 2AQFA 2EFWA 5GMKa 4KT6A 2EZIA 2MFZA 4LR9A 3HRTA 3BM7A 1MROA 3T9ZA 1R8HA 3MMBA 1IQTA 4V2GA 2J9DE 4RX6A 1FX7A 1FP2A 4LF6J 2DO4A 1IN8A 3V8KA 3G4SI 4CO2A 1FTTA 1LEAA 3CXCR 4IKAA 1MWYA 3E0JB 4TU9A 2VI6A 3M30A 3DGPA 3KLFB 1HW1A 1S72I 1RR7A 3L2UA 3D1HA 1T08B 3LSJA 1RUNA 1FRJA 3FXOA 2RDJA 4NMLA 4HLYA 4IJAA 2VU5A 4DPXA 1AU7A 1N56A 2D41A 2E7XA 3V7RA 3OFGA 5D5XB 2JLGA 2BVMA 2HZDA 1ZAXA 2LU1A 1WOOA 1O0PA 5A8KA 4C97A 1A35A 2KT3A 3KLEB 2D1HA 3CCWA 4UOFA 3EMTA 2E2IJ 1P9YA 5L1IA 1B6AA 4TXSA 4YS2A 3VAGA 1PUEE 1WORA 4DHVA 2STTA 3IP4B 4E8UA 3FHZA 3W1YC 2CNKB 2Y8WA 1U6BA 1EKRA 1JLGB 1G1XA 3QZ7A 5BS6A 3TO6A 4IQXA 3GJTB 3PZPA 3DBLB 1HNVB 3G82A 4B1RA 4ANJA 4DQPA 3BQYA 1VQMI 3QO9A 2UUWA 3IS9A 4JI4F 5IYBJ 5L3DA 2BJEA 3ZQFA 4LBIA 4DYRA 3J7YJ 1WI6A 5F1JA 4F0KA 2E9TA 2DYSH 2HHQA 2YNHA 3JRDA 1F5TA 1IM6A 3P9KA 2MD5A 2KLOA 4H4OB 1ZLKA 3D3BJ 3M2UA 1HBOB 4EGZA 5L39A 4ILLA 1CULA 3MN2A 3CCTA 1TKZA 4LFAF 4ECTA 1FMVA 2O0YA 1F2GA 3ZQQA 2AMCB 5ICFA 5IPAA 3A03A 1NHVA 4Q48A 1NTCA 1IN4A 1RHRB 1FJGJ 2H5JB 3VPRA 4ZITA 4ZVRB 1OPIA 3KP6A 4AC0A 4FBTA 3FK6A 4UB6C 2OIHA 4I76A 1J5OB 2CPYA 1VI0A 2DT5A 2BACA 4N5SA 3SXYA 3OUYA 3HGGA 3OL4A 5BQTA 1YDLA 2JSXA 3EX7B 1VBYA 1VK3A 2L54A 2BRLA 1GT8A 2ZBRA 1FJCA 2W7NA 1SKUB 3LQQA 3PNVA 3HRMA 5BMZA 2RE1A 4NZ7A 4BDYA 4LJMA 4MJKA 2DPIA 2JVOA 2IRYA 1S99A 5JVHQ 4N76A 3ISNC 4C0HA 1YRTA 4H0EA 4HSTA 5DG8A 1U5TC 4GC7A 3DEEA 5KFSA 2XGXA 3ISPA 3BQ0A 3L2QA 1QUPA 1R0AB 4ZIWA 5M5XJ 2Z33A 3L7OA 1S1UA 1VISA 4DL3A 5IT9Y 2HQAA 4NLPA 3FZVA 3J7ZT 2A6EF 5ETTA 2ZWPA 3O8WA 4HNVA 3W8GA 3VAIA 1TT0A 5FRNA 5KT4A 1GK8A 1P6TA 1QJHA 3GV5B 4DQ2A 3H0DA 2MSTA 4DPTA 4RB2C 4RW8B 2GIVA 2K9MA 3TZXA 2OMLA 2G2YA 4MQ9F 2CG4A 2M8GX 2GQCA 2VDIA 2BY0A 3TR5A 3DTEA 3W63A 4I6YA 2DHGA 4YOEA 3SDEB 1YX2A 2P5VA 1RWXB 2V1UA 4XKVA 3W9HA 5J6XA 2ELHA 3MAQA 2A61A 5K7ZA 3GF2A 1BA5A 5BYSA 3PYEA 2HNHA 2MQNA 1M5SA 2L7KA 2HYIB 3PO2J 4FQGA 1T0FC 1U0SA 3VGVA 2KKOA 3IRXB 4WFAQ 1BR1A 2J0WA 2EZHA 4O3SA 1VLOA 3IM9A 3JTPA 5JUMA 1U78A 3SIPB 2ZC2A 2XHKA 1O57A 1KZHA 3Q8PB 4CTAB 4ZZDA 2WAQN 2HHUA 5D4PA 1URNA 3MMCB 4QIEA 2YS9A 3HP6A 4LSLA 4E4HA 3C2BA 1KC8T 3H1CA 3B78A 4N9IA 2A07F 2A0FB 1ETYA 1TAUA 1Q7YT 3NQOA 4BL0B 3WDOA 1T38A 3BYRA 1RT7B 4AL5A 5IC4B 3LPYA 2A5YB 4HX8A 3HVTB 5LXRA 4OFZA 3WBZA 4QWQA 2D9OA 1D5YA 1FSEA 4DV1F 1WPKA 3GFMA 4CSWA 3M9NB 3THVA 1WTBA 5ICCA 2RS2A 2QL5B 1R71A 3NCQA 3OYMA 3CJTB 3Q0VA 2PIIA 5D4OA 4WXHA 2VLAA 4X6AJ 3TUIC 4BC7A 4B3TF 5L3GA 4FN5A 4B3OB 1RCOB 5HVQC 1LW2A 3N6MA 3T41A 3JSYA 3PSIA 3GYNA 1FBUA 1VQLI 3T19A 4TLQA 1CG2A 2IRXA 3GTPJ 2MZ1A 4DR2J 3CF2A 4C11A 1G2EA 2CQKA 1X3WB 4HTJA 1VQ6I 3UVJA 1K44A 4Q5VA 1ENHA 1ERDA 1ZR2A 2RAEA 2QE5A 3J7YI 1ZAWA 3BCBA 2R42A 3ZZUA 5AONA 2X85A 1W4MA 2O6GE 4Y65A 5EGOB 3M8FA 2J8SA 4ZPVR 4B09A 2HPMA 3DLKA 4YY3J 1T94A 2PMHA 4MHGA 1OY8A 5AT1B 5L1LA 4A2UA 1WEYA 1HSTA 1H9GA 3IBWA 3HKZA 2YNFA 1X5PA 2KXNB 3FCHA 4M5DB 5IWAF 2WVCA 1WSRA 1HQCA 4TU8A 1FJGF 3CZ6A 2QZ8A 3EUKL 1JJ2R 4XLNF 1KU3A 1Q78A 2X7IA 2QKMB 1T95A 4CYCB 2QSWA 4HACA 4NEYA 4DV3J 1K78A 1QAIA 4CP5A 2CRLA 3HHKA 4YIRX 4FF3A 3W6VA 2IGNA 1U9NA 4U8VA 3RPUD 1KQ0A 4OX8A 1UFMA 3FIWA 4EJUA 3N28A 1N33J 1DY3A 3FK4A 5CYQB 3K5MA 2C2RA 2WADA 3Q8SB 1R1TA 4LG3A 3KDNA 1A31A 1UZDA 2QYGA 1BQXA 2BYVE 3C3WA 3LO3A 2Y1IA 4NXNF 1GX5A 2GIFA 1SKWA 4FF2A 3OBIA 2ZXIA 1X4EA 4ETSA 2IAIA 4AVPA 4ENNA 1U25A 2HG4A 4DG1A 2W2MP 1T05B 3I4HX 2ZDPA 1WH5A 1ODDA 5K5RA 3MM6A 3D6TB 3RRKA 4DV2F 2DXDA 3OR2C 1RLCL 2P9CA 3DDIA 4G7HF 1YHQI 2NS8A 1NSAA 2DGTA 4DZPA 3R5CA 2FMLA 4M8LA 3CQZJ 3E6CC 1JJ4A 3H36A 1Q5YA 3LOCA 2H9ZA 3THTA 1CF7B 2VL8A 2VH7A 3OYKA 1YJ9I 1ON2A 3KUGA 5F8LA 5D4NA 5BR8F 3I56S 1XCBA 5D3GB 3FVYA 4A3FJ 1PJ6A 4NA3A 4ZDNA 4DL5A 1C4CA 1FD2A 1EKSA 3CCJI 3OYLA 3K4LA 4ENKA 3HHEA 2L3DA 3OR2B 3KLHB 2ZFWA 2M34A 2BY1A 1T8IA 4G8XA 1CQMA 4CLSA 4B02A 1QNTA 2QSFX 1NHUA 2LDIA 4M6VA 2GC8A 2CO5A 1S0VA 1J2XA 4NQWB 3E5XA 1ZBTA 3TX8A 4OZ2A 2FJ1A 1Q81T 1K9MT 4L5JA 3W2WA 3QGGA 2K9QA 2EFVA 3VGUA 4BACA 2F9JA 2JVGA 3DBRB 2MXYA 4X4VA 2WV0A 3G1OA 3BO3A 4PWDA 5B0GA 1WI8A 2VKEA 3EYZA 2Y75A 3DLGA 3KJQB 2HW3A 4I7HA 4ALZA 3HPHA 2B9WA 4CH0S 2YNGA 2A6MA 1VRUA 3R7SB 5EWFA 1R4NB 3JQJA 3P8BB 3IV5A 1RT4B 2WBMA 2XAHA 1BLUA 2IW5A 2MLXA 1EARA 1FYLA 2CPFA 3FQKA 3OYFA 1WG1A 2JN6A 2A6HF 4Y28C 2YH0A 4HA8A 3CDAA 5GADU 1REVB 4DPOA 3R2DJ 2FQ3A 1HKAA 3Q86A 4K5SA 2VT3A 3UDVA 2OPRB 3GV8B 3PHTA 4DR6J 3QP6A 4JI8F 2V67A 3Q3SA 3GFJA 3L7WA 3VVTA 5KFAA 3CC7I 4USTA 4F2SA 2BJ8A 3CD5A 2DQLA 4L9NA 1B7YB 5E8GA 5E3AA 5F9NA 3PVXA 4CCKA 4N9HA 4KN4X 3J7AY 1R5ID 2ZJQQ 1D1BA 1Z67A 2V4RA 2RAQA 2VXZA 3H4DA 3C16A 4KH1B 3W3SA 3DTIA 3TVYA 2FC8A 4WFXA 1S1WB 2IXSA 1X3UA 1A5JA 4I67A 4Y34A 4DX7A 3CVKA 4EGLA 4A8XA 4M5GA 4RW8A 3LSIA 4KAIA 3FMQA 2LEPA 4TY8A 1U48A 4A8OA 2DT9A 3SSQA 2MKJA 2Y0SD 2NNYA 2Q1LA 5A76A 1RBAA 1TTYA 3QT8A 4KMUX 2XYHB 2FOKA 2CJYB 2X1BA 1BM9A 2FTRA 1I1SA 2DA3A 2XLIA 2CFOA 2DPDA 2QYOA 3CWJA 4QYZJ 3FBIB 2VBXA 2XGQA 2ZFHA 1F5CA 1RAHB 2KJVA 1VQ8S 2QBYB 3H3ZA 2Y69H 3BPDA 2JA5J 1C1CA 1PCAA 1QUVA 3QT6A 2MQLA 4HRIA 3GWCA 2E9ZA 4CLTA 2K27A 4CTAA 4BHBA 1KR4A 4K4XA 4LFCF 4Q4ZF 3GZNB 4M1KA 3F44A 3MR7A 4OJHA 5AXNA 2W7OA 1DTQB 1F9NA 1U5TB 2DA2A 4LD5A 5J3LA 1ZHFA 5LGUA 4I56A 3WGGA 4E7IA 2QA4S 2ZZTA 2VJUA 1ON1A 2CV0A 3BR0A 1FESA 2V4JC 3F0NA 2DDBA 4WK1A 2KDZA 2BABA 2QL7B 4PG8A 1D0EA 3PO4A 2K1RA 4X4UA 3TUZC 1U6ZA 2E2JJ 2HNYA 3BY6A 3S16J 1N5YA 4DZJA 2H6BA 2XB0X 1FRIA 1ZETA 2GNKA 4XL9A 3ZTPA 5D5UB 3HK2A 2ZH3A 2JA2A 1G6BA 4PR6A 1VQKI 1G2HA 3M05A 3RKWA 4OV6A 3BTIA 2I10A 1EP4A 3ROUA 4O23A 4GKJF 1LNWA 1OPZA 4MKAA 1SD5A 3KZYA 1WQ2A 2P5LC 1NB7A 5LM7E 1RKIA 2N3LA 1XPXA 4P52A 4ES3A 3OS2A 2W9BB 2FD5A 2IA6A 2QN6B 2UUAJ 4F4AA 1SH3A 3NGUA 1R8AA 1N32J 3UN5A 3KETA 4DEZA 4F4KA 4AFFA 2XTJP 2AQ4A 4TNOA 5LMUF 1MW7A 4PEOA 1M1KT 1PYTA 2E1OA 4H4OA 5A8KB 4D5CA 1I5OB 3EE3A 2Q8KA 1YW7A 1P27B 2XSJC 2W82A 1FNMA 2FZKB 3AD9C 1RTHB 3P4UB 4GO5X 4KITB 1FMWA 2ZMEA 4OIRF 5DQHA 1KHVA 3U7JA 1YW9A 3EGZA 1X2NA 1U8WA 4F26A 1JXLA 5HQMA 2L0KA 1UVKA 2BEFA 1TKXB 3TJ8A 1NHAA 1XS9A 3GSDA 4UOCA 1FEEA 4OHXA 1IKYB 3IH3A 4LF4F 3QRPA 1HXDA 3G71I 4DR1F 3U9GA 4AQYF 4NEZA 3Q8RB 6FDRA 3BN7A 2M7AA 3CDEA 1NU4A 2KDOA 4LR8A 1MJ9A 4DBRA 3ZTSA 1DLOA 3IAS9 2ALYB 4V1Ak 1U3EM 4ZVTB 3QT7A 3U1DA 3UCGA 1F3VA 2W9CB 1V9OA 2KL8A 2E60A 2OD5A 1WG4A 2L41A 4ECQA 4OHYA 4DFJA 4S05A 3DI6B 5LGTA 5J1NA 4WPAA 4F7VA 1J5YA 1NSKL 2CQIA 2BY3A 1RTHA 4EYHB 1TL7A 2CMPA 5HS8A 3MPUB 4MTDA 3MM9A 3CC7S 3F8BA 1YLFA 4C9DA 4QR0A 1X4PA 1Q79A 2JSPA 4XRMA 2DOAA 2WB4A 4HV5A 4P7TA 3ULHA 2RF2B 3DRRA 2MQOA 1N36F 2QX0A 4B43A 5HOOA 1Q7LB 2HVDA 5KG6A 1TL3B 1KWMA 3AFGA 1T56A 1I6XA 2EK1A 3U21A 3I54A 3GFLA 1MBEA 3DRSA 1F36A 2LBFA 3HT3A 2AJFE 2JC1A 3I3LA 1NNDA 2STWA 4IHSA 4DSIA 2K9LA 3SHFA 2JWNA 4ZPBA 5ETNA 2CNNB 4CCMA 4DQRA 1TQIA 2NS0A 3MMCA 3W2VB 5I42B 4WIIA 5JMNA 2ZH9A 3BROA 2VQGA 5CD4H 3DPUA 1S4FA 2WB1N 4IR1A 3C2HA 5D15A 3OR1A 3HI9A 2VJ4A 1GLNA 1FOXA 4N77A 2IFXA 5IV3A 2R5YA 1B4AA 1U8SA 4KFBB 2B8PA 2F4OB 4JX6A 2B5JB 2DFFA 1HL6A 5AIPA 4DW6A 4KY3A 4Y17A 2XRNA 5HMWA 4U67Q 4PGHA 5HVHA 3DCFA 1NRKA 3AKZA 3A0HC 2XQCA 3AG2H 2F6CA 4DL2A 2QQBA 5J2PA 4HOBA 3HDDA 1EKEA 4RNFA 2V50A 1UETA 1T9TA 4EGYA 3ILJA 1IKXA 2GHVC 4DCPB 1LWCA 5KFGA 2EI5A 2RDPA 2V2VA 5B0BA 2O3FA 3H59A 3CP8A 1X2MA 3Q8YA 3K57A 1JLAB 2M4MA 2DMTA 1F60B 1YKWA 1C1CB 4G6QA 4XM3A 1UJ5A 3QPSA 1DDNA 2QYCA 3ICLA 4F0HA 1OYDA 4YEAA 1S1UB 2P9GA