2DBBA

Crystal structure of ph0061
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
146
Chain Sequence
KLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLGYMYAIVLIKSKVPSDADKVISEISDIEYVKSVEKGVGRYNIIVRLLLPKDIKDAENLISEFLQRIKNAENVEVILISEVRKFEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcriptional regulator
molecule keywords Putative HTH-type transcriptional regulator PH0061
publication title Crystal structure of PH0061
rcsb
source organism Pyrococcus horikoshii
total genus 36
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dbbA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dbbA02
2ZMEB 1TW3A 1YS7A 3G73A 5LRRA 3GYHX 1S6LA 2KJBA 5H6QA 4BYYA 1KQ0A 2Y75A 3FMRA 2P4WA 2EK5A 3FM5A 2DT5A 3ROUA 5K5QA 3LA7A 2EWNA 4EJTA 2P6SA 5JFRA 4JBAA 1R23A 3P9CA 1FYMA 3SFZA 3BWGA 4I01A 5EEHA 4ENKA 1S3JA 1TNTA 1P4WA 1OMIA 4L9TA 1IN4A 3J7AO 2ADUA 3HRMA 3OOPA 4YG2F 1G4DA 1HSJA 1PP8F 2E1NA 4OMZA 1R5HA 1XD7A 5FB2A 5HDKA 3GFIA 4L9VA 4I2OA 3PQJA 4UVBA 3NRVA 2ZNZA 4ESFA 5ED4A 2DJWA 2WTEA 1FT9A 1LDKB 3HRUA 3MFKA 5FD5A 3WTUC 1U5TC 1KQ8A 4N0BA 1U8RA 3F8CA 1PUEE 3MAJA 1A04A 1SD6A 2D2WA 3I59A 1K7AA 1J7KA 3TOAA 3KE2A 3KLOA 2CGPA 1YO5C 2P5KA 5CVIA 1LNWA 2FNPA 2PG4A 4A2UA 1T98A 5E1XA 3DF8A 4ENNA 2VBXA 2K27A 3SQNA 4RGXA 1U2WA 4XRFA 1JXSA 1KYWA 2ISZA 2MLKA 1YFHA 2RGVA 1WSUA 2RN7A 1ZN2A 1IW7F 1R1UA 4HW0A 1ODDA 2DFIA 4LMYA 4ETSA 1Z91A 2RDPA 3ABTA 1BIAA 2M87A 4KA4A 3QAHA 2X0LA 5ICGA 3KFWX 1K78A 2CW0F 2O0YA 1W7PA 2PEXA 3T1BA 4P9FA 1W4MA 3CUQA 1OR7A 2VT3A 3PQKA 4WCGA 1U3EM 4KIFA 3FWEA 5DUIA 1ZG1A 2MLGA 4KUMA 1IF1A 2MH2A 5DCMA 1O57A 4Q5SF 1B59A 4EM2A 4LJZF 3TO6A 2YX4A 1CF7A 1H9TA 4XLPF 1J59A 1F1ZA 2XGXA 3CJNA 3GVAA 2XV4S 5LGTA 5LHIA 4K2EA 1B6AA 5A2QZ 4M73A 1ZLJA 2ZXJA 1EH8A 2EV6A 2JTVA 2W25A 3K2ZA 2GZWA 4HF0A 2OAZA 4O6JA 4YIIA 4S04A 1G3WA 2DQRA 1YS6A 4EM1A 1O3TA 1KU9A 4KN4X 3TGNA 5DYMA 5D6EA 1TNSA 5BQTA 3FX3A 4RB0A 1TQIA 1SMYF 2A68F 1OPCA 1DP7P 3I71A 3RYPA 3JTHA 3QU6A 5FFXA 3TOBA 2GA1A 1UB9A 2O61A 4F7ZA 1XGOA 3HSFA 2ZKZA 3QPTA 4PZJA 2D45A 3FMQA 1ZH5A 1R36A 3EETA 3J80Z 1MKMA 1BI3A 4LGWA 3GXOA 3CUQB 1QO0D 4I0BA 1USTA 1YG2A 2G9WA 3C7JA 4R8HA 3KP4A 3ULQB 2YR2A 3E97A 3BOQA 3DQVC 4I7HA 4EGZA 2HQRA 3TQNA 1SAXA 4XBFA 1W7PD 1XDSA 1J9IA 2M8EA 1BJAA 3P9IA 4LD5A 1MDMA 4RB3C 4CO8A 2XAQA 5DEQA 2LKPA 4R1HA 5FO5A 2L01A 3NQOA 1T6SA 3M9AA 1W5SA 3FXQA 2PBIA 4GXOA 5E20A 4G9YA 4RGRA 3HRTA 2Z9OA 3V7CA 2V1UA 2ZJ2A 3DPLC 3ZMTA 4HAMA 5DV5A 3DXJF 2F5EA 3QU3A 1S29A 3VB2A 1I27A 3H92A 2STTA 2KIUA 2LNBA 1YLFA 2UZKA 1LJ9A 2HYGD 5DD4A 2DK8A 5JI6A 1XGMA 3G3ZA 1KU2A 3DFGA 3MQ0A 4OINF 5D4RA 2IRFG 3K0LA 4HV5A 5HS8A 4I98B 4HLYA 1BC8C 3L09A 5J8CA 3ZQ7A 1ON2A 1J2XA 4HDUA 4A12A 4KNYA 2XAHA 3OV8A 3MZYA 4WK8F 3VOEA 2XAGA 2MBFA 3K1NA 3ZN1A 2E7WA 2L54A 5L3GA 2R7DA 2PMHA 1ON1A 5D5VB 3KP3A 4KMUX 2A07F 4HZFA 3GUDA 1HW2A 4ESBA 1OYIA 1BBYA 2OA4A 4EQQA 4KFCA 2OD5A 5CYVA 2ESNA 4AD9A 2MA3A 1YQAA 2XVCA 5CVRA 3REOA 2QWWA 1HBXG 3HUGA 5LHGA 2P5LC 4QLCU 2XAFA 4MQVA 3C1DA 2CO5A 4UUVA 4MEXF 2EV5A 4NQWA 1REPC 4WWCA 2GA2A 1FBSA 3WTTC 2HEOA 4A0ZA 3GEZA 1SFUA 3R4KA 2L4MA 4FX0A 5D5XB 1J5YA 5D6FA 4HYEA 2DAOA 2VC1A 3COAC 3MEXA 1TBXA 5CVVA 3SHFA 2EB7A 3V8KA 1B1BA 1MJ9A 5A2QK 3K1PA 1RI7A 3LAJA 3QP6A 1IN5A 1FWZA 1SFXA 4U0YA 4KYWA 4Y15A 5BPIA 2NS0A 1GXQA 3CO7C 1Z1DA 2FF4A 1G3SA 1XDUA 2FMYA 4EGYA 2ZCWA 4UVCA 2OU2A 1IN8A 1FP2A 1WI9A 2UWMA 5FLXZ 3HRSA 3GLXA 1R22A 1HSTA 4IRIA 2IPQX 3H3UA 3TO7A 2PI0A 3FXRA 5DDGA 3TO9A 2FBHA 5E1WA 1RNLA 3RDIA 4WX9A 3MZHA 3J80K 2YX7A 4MGRA 3WODF 2L02A 5AIPA 4RGUA 5ICCA 5HVQC 1SD4A 4G7ZF 4YFNF 4BNCA 3C18A 2O3FA 3I4PA 2HR3A 1FC3A 3E6MA 5D8LB 3GO5A 3J81Z 5HLGA 1PP7U 1FBUA 1BI0A 1FSEA 1OYYA 1T0FA 2JZYA 3FZVA 3ZMZA 4NHJA 2XKOA 2HGCA 3WG9A 5DCFA 1KYZA 3V4GA 2BV6A 3Q5FA 3N97A 4IF4A 3LSTA 4GCVA 2R7FA 2DLLA 2ELHA 3BJAA 4HX4A 1HKQA 1QBJA 4LLGF 5EEGA 3IRQA 4ZYGA 1S7OA 1TTYA 1QZZA 4G94A 4RAZA 1ZARA 1L0OC 4CZZA 2GQQA 1TQMA 1IN7A 2FU4A 2WWYA 2HFHA 1O3RA 2CSOA 1KA8A 4AWXB 3VODA 4B09A 4O5VA 5DUKA 1G3TA 3F23A 1TLHB 1P2FA 1B9MA 1TW2A 4L18B 1IXCA 5IT9K 4L9JA 2E1CA 1VTNC 2LF8A 3ERED 3F8BA 1QZYA 1E17A 1IZ1A 4M9ZA 4M74A 2Z99A 2B0LA 4EVIA 4JK1X 3S2WA 2Z5UA 1EV7A 2QBYA 2PJPA 4XSXF 3U1DA 3JAMZ 5ILSA 4LG0A 4OIPF 2O8XA 2QQBA 5HOOA 2RQPA 2DO7A 2LDUA 2J5OA 2IA1A 2WC2A 4IRHA 2ZBKA 5D5WB 3E5QA 4M71A 2P5VA 3DP7A 3GF2A 2R3SA 3L2CA 1ULYA 3RKWA 3WTSC 4BAYA 3KZZA 3LA2A 3L9FA 2K02A 3JSOA 4OOIA 4IHSA 1IXSB 3P9KA 3K9TA 1QPMA 2A6HF 4U88A 4YFXF 2KIMA 5K5OA 3HOSA 5F64A 3ZMSA 4ENMA 4FX4A 1OKRA 4ENJA 4CXFA 2LF7A 2K7LA 3ML6A 5HLIA 2CFXA 4KMFA 4PGGA 1YTYA 4CDGA 1Y0UA 2OZ6A 2EFOA 5E18F 1KU7A 2QLZA 5JR3A 1IRFA 3GFJA 4P9UA 2H6BA 4G8XA 5L3DA 5LEJA 2ETHA 3I59B 3IC7A 4G7OF 1AWCA 3T0YA 3LQRA 2L3DA 3D0SA 3F8MA 5HS9A 5FLXK 3F3XA 2RNJA 4LG0B 3WTYC 4N9HA 1NHAA 4IVNA 4OU0A 2PMUA 3CTAA 3T5XA 2PLYA 3W6KB 2F5CA 1GHCA 2GAUA 2VC0A 3GZ6A 1IUYA 3HIFA 3CO6C 2Z3YA 3CLOA 4KIBA 4RB2C 1I1GA 1Z05A 2HKOA 3Q9SA 1IXRC 3IHUA 1SD5A 2FSWA 4HDVA 2JSXA 2PFBA 3L7WA 1Z6RA 3MWMA 2WV0A 2Y48A 4BHPA 4OIRF 5CLSA 1LEBA 5HS7A 1ZGJA 1K78B 1R00A 1W7PB 1TQPA 3BP8A 1DUXC 1XB4A 3J81K 4Y17A 3KEOA 3KEQA 3V7SA 2QUFA 1SMTA 1WWXA 4MEYF 5BPDA 2UXNA 3KP6A 3WGHA 4XSZF 2HYFA 4QWQA 3DPTA 3PFIA 4L0ZB 3FF5A 1GXPA 3LAPA 2BGCA 4UV9A 1RUOA 3WTZA 4L0YB 5DCMB 4KICA 2XHKA 3RJPA 5BS6A 2VOPA 2AS5F 1T38A 2YSRA 1CF7B 2XASA 4BH9A 4EMSA 4HF1A 3LQQA 2CYYA 2HDCA 2Q2EA 4GO1A 5D8KB 2FBIA 4HF2A 1D8KA 2A6EF 1R58A 1DDNA 2VBYA 4EJOA 2EFWA 2DW4A 2QM3A 3WU1B 1Z9CA 3K69A 2KKOA 1FPQA 3AAFA 3BZ6A 4KDPA 3DEUA 2VE9A 2HQNA 5D5UB 3E6CC 2Z4PA 3CUQC 1HW1A 3SZPA 3EQLF 1O7LA 1QQIA 3JAMK 4IJAA 2RKHA 1T39A 4UNOA 3HSEA 5IT9Z 3KETA 1S8NA 3FHZA 3M8EA 1O7FA 3QPHA 1HXDA 5BMZA 3ZN0A 4AIHA 2JT1A 1P4AA 2QYOA 3C3WA 1ONVA 1HKTA 2G7HA 5L3BA 2HKXA 2P6TA 3LWFA 4P5OA 3Q9VA 2HTSA 1ZAOA 5BOXA 2HZTA 3RPUA 2M30A 3F22A 3BY6A 4O3MA 4LK0F 4ASNA 2ZBCA 1MDMB 2P7VB 5E8GA 1H0MA 2E1AA 1LEAA 2FQ3A 5DD8A 5E1ZB 3F72A 3WU0A 2GXGA 3E5XA 3GW2A 1UHMA 2IP2A 2FOKA 2G7UA 4G7HF 3E6DA 3VFZA 3HTUA 2VOOA 3IWZA 2EFQA 4IPAA 1I6XA 2A5YB 2ZMEA 1FBQA 3ELKA 1U5TA 2V1XA 3TDZC 1HQCA 3F21A 1ZG3A 2A61A 4LB5A 1K6OA 1YYVA 2IA2A 4A6EA 4RGSA 4IRGA 1LB2A 4N9IA 3KLNA 5D4SA 3LFKA 2OZUA 4FT8A 1FLIA 1P6RA 1BOAA 4DQ2A 3RYRA 2K86A 1IN6A 3WTWC 2CWEA 4IXAA 3I53A 2A3SA 2A69F 2MC3A 1I1SA 2FMLA 3M8FA 1XGNA 3R6SA 3T8TA 3R61A 2D1HA 1X3UA 3E3VA 1P92A 1V3FA 2QVOA 4CHUA 5HLHA 2YU3A 4I02A 2IA0A 3WE2A 1QGPA 4EJVA 2VT2A 1LDDA 1JHHA 3I54A 4WXCA 2YPRA 3HTSB 4LB6B 3L00A 4MTEA 1KQ9A 3ECOA 1OYWA 3EYYA 1L3LA 1FY7A 4GYGA 5FGMA 3VEPA 2F2EA 1E2XA 5L3FA 1XCBA 3I64A 1HKSA 1ZYRF 5AIQA 4M6XA 2XUBA 5L3CA 4UV8A 3KZYA 1B4AA 2RC4A 1U6GA 3RTRA 3F8NA 2BEOA 2W84A 3R0AA 5TRDA 1H9GA 5E17F 5H6RA 4MHGA 1KU3A 2XAJA 2EV0A 1FOKA 3WE3A 1BI2A 2O6GE 1U5TB 4OIOF 4A0YA 5JVTA 1R7JA 2STWA 4Q48A 5IT3A 1ZHFA 4BQAA 2Z33A 2DQLA 1YW7A 1SFEA 2MD5A 1ZREA 4WXDA 1DPRA 1D8JA 2E7XA 3GFMA 1O3SA 3BJOA 4G6DA 2EJRA 4Y13A 3ZMVA 4HV6A 2MH9A 2VODA 3BJ6A 5ICFA 1UHWA 1YW8A 3KCCA 1FYKA 2RV8A 1RIOH 3FM3A 3K1MA 5J8FA 3HYIA 4L9NA 1BC7C 2P8TA 2W57A 3ABUA 2XKPA 3E5UA 5J6XA 2O03A 3BDDA 2DU9A 1DPUA 5L3EA 4KT5C 2EA4A 3RIRA 3EYIA 3ZPLA 3I0TA 1MD0A 2L4AA 2HWVA 5K5RA 3O2PE 2EA2A 4P55A 5HDGA 4WXHA 3P7NA 1FP1D 1EH6A 2CVIA 4AIKA 2GWRA 5LGUA 3V7RA 1HW5A 5E8IA 1G3YA 2NAZA 2DBBA 3V8LA 2DI3A 1S7AA 2JRTA 1RZ4A 5CJ9A 5JHUA 3FXUA 3QOPA 2JSCA 2HTJA 2H09A 1USSA 2XRNA 3F6OA 3SZTA 4MNUA 4LLNA 2AXLA 2J5PA 3HOTA 1O3QA 3CUOA 2NNYA 4D0PA 5FD6A 2PN6A 4M9SA 1GVJA 1PDNC 4HA8A 3KP5A 5K1YA 4OMYA 2V1DA 5ILVA 1I5ZA 5LRSA 1XGSA 2QQ9A 1STZA 2RVCA 1BI1A 3B73A 2FBKA 1WRJA 3M7GA 3GWZA 3TKYA 5F1RA 1G6NA 4ZYEA 4S05A 4TV7A 4I09A 1UCRA 2Y0MA 2K4JA 5LBQA 2VXZA 3W6JB 2QBYB 1FX7A 2ACJA 2C6YA 3I58A 3HHHA 3NEUA 2IVMA 2DK5A 1R1VA 1YIOA 2IJLA 1BIBA 1YW9A 4U0WA 4L5JA 2LSOA 2XROA 5H20A 2H6CA 2P7CB 3CDHA 5CVJA 4ZZDA 1IRGA 4HBLA 1ZG5A 2OBPA 4UVAA 2M1BA 4CYDA 2NYXA 2VBWA 3R60A 4Q47A 1D5VA 2FRHA 4B8XA 1V4RA 3JW4A 2Q8KA 4M72A 3ISPA 4M9XA 3T8RA 2XIGA 2TDXA 3RKYA 3U2RA 5LEKA 1WQ2A 6PAXA 3GFLA 2PQ8A 4BHCA 4XLNF 2BE5F 2ZNYA 3DV8A 4HX7A 1R1TA 1QNTA 2V79A 4RB1A 1T2KA 1FYLA 4IHTA 5ERIA 3GX4X 1JE8A 4HLXA 4H0EA 4JQFA 3QRFF 2COMA 4U7DA 3IKVA 2HOEA 3QP5A 5FFZA 3O3KA 1LVAA 3GZ5A 3IRRA 2DPUA 4U7BA 2VONA 3RPQA 3R0JA 1F4KA 2NRAC 2IW5A 4A5MA 2CQKA 2EFNA 1XN7A 1XSXA 4U0VA 4P96A 5LLQA 1WKMA 3MCZA 1FNNA 4HOBA 2W24A 1EH7A 4A5NA 5ICEA 3EUHA 3EDPA 4UHTA 2HS5A 4WF2A 2VBZA 2V9VA 4GYIA 1BN5A 1ZLKA 1ZRCA 4RS8A 2OQRA 1J75A 5TJJA 1ZRDA 3F8FA 5KK1A 4ZZLA 3BPXA 2V6CA 1MJAA 2JPBA 2KIFA 4I0AA 2X4HA 1P4XA 4LK1F 4EV0A 1B9NA 3WGIA 4LFUA 3BROA 4PGHA 5HDNA 1XSDA 1MJBA 2H27A 3KP2A 1MGTA 2QENA 3SXYA 4EJUA 3JSPA 2K4BA 2DPDA 2F5FA 3JTGA 1LDJA 3E6BA 2VN2A 1SD7A 3D5LA 2DTRA 1W5TA 4UXNA 2FE3A 1FSHA 1AOYA 4KIGA 4L5IA 3H3ZA 3LA3A 3V8JA 1K79A 4M6YA 5KVRA 4R79A 5LGNA 2FA5A 4MQ9F 4LLLA 1Z6TA 4RAYA 2KJCA 2H94A 1D3YA 3RI4A 3RKXA 2QZ8A 4MTDA 4KN7X 1XMKA 4A0XA 4YIFA 3WTVC 2ESHA 3IWFA 3IL2A 2ISYA 4OIQF 4NB5A 2NNNA 1BM9A 2ZO4A 2F5DA 2JPCA 3HHGA 5CVUA 2IT0A 1FZPB 1F9NA 2M45A 4ESJA 4FHTA 1R5GA 1J0RA 1U78A 4ZYDA 2Q0OA 4ON0A 4GGGA 4CGZA 1IAWA 1ZRFA 3WTXC 1XMAA 2BBYA 4G6QA 3TDUC 3HSRA 4Z2YA 1JHFA 1Z7UA 2FEZA 3ZP5A 4DNCA 1C0WA 1UFMA 2GXBA 2D1VA 4HX8A 1Q1HA 2ZFWA 3ECHA 3M1EA 3U9GA 1XSVA 3KP7A 2UXXA 2GIVA 4ZYHA 4HQEA 4YFKF 4PDKA 3B02A 3N4MA 4AIJA 1LQ1A 2FNAA 1XCVA 2OQGA 5F6FA 4CICA 5ILUA 4E70A 1JGSA 2W85A 5AONA 2FXAA 4Q4ZF 4ZH4F 4A6DA 3I5UA 4PCQA 2EFPA 3DKWA 1KGSA 2M5WA 4HQMA 1ZGAA 3ZMDA 3WGGA 1RUNA 5LHHA 1F5TA 2CG4A 2VE8A 4BHBA 3BPVA 3IKTA 2BYVE 2QQAA 4AVPA 4BXUA 1CGPA 4EJWA 3FMSA 1MZBA 4EM0B 3F6VA 2KRFA 3O6BB 3ZMUA
chains in the Genus database with same CATH superfamily
5DG8A 3SXLA 1VC6A 2W4PA 1TW3A 2ALYB 2MZJA 2E7VA 5LRRA 4I1TA 4LR8A 3JRGA 1NG7A 2NUUG 3OL4A 1RXOB 5F08A 2ZBIA 1KS2A 1KNZA 2Y75A 3FMRA 2P4WA 3GTYX 2FY1A 4N76A 3MD2A 2EK5A 4C9YA 2B4VA 3FM5A 3ASOH 3OTCA 3N28A 2L08A 2G2ZA 3CCSS 2JEJA 4EJTA 2AF6A 4CRJA 4JBAA 1R23A 2CMPA 2EPFA 3U21A 3FVYA 3P9CA 1FYMA 1U8WA 4C4WA 3CCQS 1DFDA 2AYGA 4IO9Q 5FKKA 1FHTA 3R8YA 1YHQI 1M5PC 4OYMA 1PAUB 4JX5A 2E5LF 1ACIA 4QR2A 3AQPA 3J7AO 1HYSB 2ADUA 2CPHA 5A8WB 1LV5A 1U24A 1YK9A 1D8YA 3OOPA 1G4DA 1PP8F 2RKIB 2ADBA 1B72A 2GAHC 4OMZA 2R0QC 4DV2F 3NAIA 5DDRC 1HI1A 4OZLA 4BEHB 2JC1A 4UVBA 4ETXA 1BW6A 3MZ8A 5AE3A 2ASJA 3HRUA 1EHWA 3WTUC 2DA3A 3JQKA 3WBZA 5LSOA 1UEVA 2IC3A 2MQQA 1S10A 1PUEE 2Z2YB 2I5JA 3DKYA 1Q8BA 3MR5A 5L46A 2CS3A 1QVTA 4DV0J 3BZCA 1SD6A 3UVJA 4C30A 3OS2A 1K7AA 4FN5A 2UXBJ 2MG4A 3DLHA 2XMWA 2CGPA 4F93B 2K85A 4O3RA 2P5KA 3PO2J 2DO0A 4DQPA 2DNOA 2JFDA 2MYFA 4IFYB 2VKRA 3JRCA 3ZZRA 1G8XA 1IKVB 2DHGA 2J0SD 2VG7B 3FZBA 2V69A 2MMYA 2IAJA 2HYIB 4RGXA 2BANB 4V1Ak 1U2WA 2M9HA 2PJRB 1QE1A 3OS1A 2MEWA 1KYWA 3K10A 2ISZA 3HPGA 2AHQA 4DR1J 4UQGA 2EZIA 3OL7A 3MM9A 1Z2ZA 2FLLA 1IW7F 4HW0A 5EDNA 1ODDA 2LEAA 2ZXIA 4ETSA 2RDPA 1BIAA 3EM1A 2M4KA 5HNHA 4KA4A 3QAHA 3O8HA 1ZM4A 3GTJJ 1OWXA 3H59A 2OELA 4D5CA 2FHOB 2CQ4A 7FDRA 4J9LA 1W7PA 1TKXB 1D1AA 3OHBA 2DNRA 2EK1A 4C8LA 3CUQA 4ZP8A 2RT3A 1OR7A 3PQKA 2YNHB 5D78A 1BY9A 4YELA 3U27A 1U3EM 3LANA 5C5JA 1E3OC 3NNAA 2YH1A 1ZG1A 3OJSA 3M6WA 1IF1A 4BDPA 1KWMA 2EH3A 2IC3B 4DL5A 3ISNC 1LFPA 3BR9A 1RKIA 1T0FC 2XGCA 1ETWA 3O8GA 1UVMA 5KFIA 3UVJB 4PK4A 5CPRB 1J59A 4O44A 5KG7A 1Y3KA 1UFKA 1UTAA 4K2EA 5A2QZ 3FSXA 5ETRA 2EKYA 4M73A 1UP1A 1FMWA 2W25A 2UUZA 1WD6A 2YKNB 1SUQA 2M7SA 3IR6B 2DQRA 4RW4A 3AT1B 1QTMA 2L7MP 4JBCA 1O3TA 4IQ4A 1AUDA 2NLWA 1QE1B 3K7RA 4BBSJ 2H3EB 3QQCD 1D1BA 1GMVA 3SBMA 3M1CA 1Q86T 4Z7CA 3JTHA 3QU6A 3TOBA 3PIOF 2BVLA 2RHSB 3G6ES 1YBTA 2Z2SB 5M5XJ 2J0XA 3G6YA 1UB9A 2OTJI 2O61A 3T9ZA 2F48A 4F7ZA 4Y4RA 1X4GA 1LWFB 4E7KA 2QA2A 4KITB 2ZHAA 1VQLI 2R3VA 4IH7A 2LTPA 1G2HA 4OX9F 5JVGQ 3SIPB 4KV8B 4M5GA 1BI3A 1LNQA 3CUQB 1QO0D 3VAFA 1LFWA 1USTA 4WU2A 4A3LJ 4LG3A 3R27A 3ULQB 2YR2A 2UV8G 3DLEA 1UW9A 2R5YA 4DV7F 3P9IA 1UKUA 2XAQA 4WZMA 4M3BA 1PKUA 4R1HA 5FO5A 2UUWA 5IFMA 1O4XA 2L01A 2A18A 1YWXA 1IN0A 5DG9A 2DISA 3MM5A 4TVAB 3M07A 3L7UA 4KRWA 1UG2A 5K8OA 2V2QA 1W5SA 4HRIA 5E20A 4BU2A 4BY1J 2CQQA 1ETOA 3HRTA 2A2DA 3CCTA 5KOWA 1WTBA 3D5SC 2HSEB 4RNHA 2B4UA 4Y2MA 3A8KA 4ZHRB 3DPLC 2XF6A 3ZZ0A 4XRSG 1AA7A 4GVLA 2H5JB 1D09B 2XHWA 2DJNA 1HNZF 3DCFA 2STTA 3CO9A 2W9BB 2OPPB 1KTQA 5T7LB 2IBDA 5D4OA 2OHDA 4MKVA 2DK8A 4DPTA 1OCOH 3OSGA 4Q2LA 1GV2A 1RWNB 4NOHA 2BY2A 5C24B 2R8KA 2OI2A 4OINF 2LMDA 2Z58B 5CHCB 2RDIA 4ZCLA 3UR0A 3D5MA 3ZZTA 2JA5J 2VZ9A 3OL6A 3OTBA 5E3QA 3L09A 4C7QA 2OO4A 3R1LA 4ZPAA 1L3UA 1NM2A 2EC2A 2WV1A 4OI3A 1FT8A 2E9ZA 2E5NA 3DRRA 1KEKA 2WAQN 1YHQS 2DGOA 3DDNA 2F5VA 4QCLA 2QFJA 2VG5B 2D41A 3R5AA 5KFHA 5DRKA 2ME6A 2XAGA 1FESA 2CQ0A 3IR7B 3DHWC 1Z2LA 2L54A 3D1NI 1HR0J 1A6LA 5IM0B 2R7DA 2MQMA 2VQLA 2PMHA 1BD6A 1QAXA 3LA0A 1MBKA 1Q95G 2HQIA 3DLEB 2A07F 2R5YB 4BC7A 3QLHB 2DIVA 3PYDA 2L0KA 1JGGA 4ESBA 2XMAA 2I0XA 4JI1J 3R7NB 5KFOA 4EWTA 3IG1A 4BY7J 4IO9F 2HZCA 1BBYA 2PIIA 1KRPA 3Q86A 1FJCA 4EQQA 4KFCA 2XGQA 3MOJB 2OD5A 4OHYA 3MM5B 1G2EA 5LJ3Y 2V8PA 2XVCA 1XERA 3RAXA 1Q81T 2MDAA 3PUBA 4OHZA 2VFTA 5GAHU 4DX5A 5LHGA 4EUVA 2ACYA 2XAFA 1GQEA 4XN3A 4TXSA 4UUVA 2CO5A 3NMAA 1PBAA 2JUGA 1JLGA 2EV5A 5LD2C 1YJ9I 1REPC 3DRSB 3QOEA 4WWCA 2GA2A 1FBSA 4ZJQA 3H5NA 1ZAVA 4A0ZA 1KZHA 2HNZB 2X85A 3FK7A 2ZE2A 1B7FA 1SFUA 4DL2A 4ES1A 5KFUA 3ZQCA 4DCPB 3GFZA 2XMJA 4NLYA 2PT0A 1TAQA 2VC1A 2F4VJ 1WH5A 4K59A 1D0XA 5CVVA 2DA7A 3V8KA 3D4JA 4YB7A 3KMSA 1RWWB 5A2QK 3K1PA 1UPPA 3LAJA 5GVQA 3SDEA 4HNUA 1N0UA 1XPXA 5A2QY 3V4MA 1YZ6A 1N6QA 1FNOA 5E2QA 2WB4A 4U0YA 4MH8A 4XRSA 4KYWA 3IFEA 4TY9A 4L75A 1YITI 2QX0A 4FDFA 4USHA 2YH0A 3MUVP 1XQIA 1Z1DA 2FF4A 4ZPWR 1S4EA 1AKHA 2Z2LA 4R5PA 4O3PA 1UVKA 4NLOA 1FP2A 1WHWA 3Q2TC 2LVWA 4OYAA 2Y0SD 1IWAA 4DV5J 5C3EJ 4NLXA 1OCCH 2XF7A 5BYRA 1VQ9I 4IRIA 2IPQX 5D3GA 2HQ5A 2OTLI 4O3SA 2PI0A 1SJ1A 2DNMA 4BDYA 5F3TA 5F9NA 3RDIA 3TVZA 4WX9A 4LRBA 3ETMA 5AXKA 5AJ3F 3A1YG 2DFEA 2ELKA 2AQ4A 1L3KA 2D9OA 5ICCA 5HVQC 2JWTA 5KFFA 2RHQB 5LL6d 5J3LA 4YFNF 1VR6A 2LA4A 3M8QA 2JNJA 3C18A 4JI5F 2DJIA 2NSCA 2FJWA 3FGVA 4PXBA 3SCIE 4LF7F 2W82A 5J4VA 2Q6BA 1JLGB 1B0VA 3TA2A 4ER8A 4KBIA 2ECCA 4Y0FA 1SC4B 4K2XA 5L9NA 3JTNA 5KFLA 5D8HB 1SAUA 2OP5A 3CC7S 1FBUA 4DJAA 1NXIA 1BI0A 1FSEA 1X2MA 1H8AC 5LXYA 4GKJJ 3K4LA 2Z30B 2WAQA 1H38A 3LQVA 2EC0A 4PYAA 4ILRA 3ZMZA 2EXUA 2HFOA 5B1AH 2V4QA 5IT0A 4UOCA 1PSDA 4EO8A 1M1KT 2QL7B 3D2WA 2JVRA 1T11A 1GK8A 1NHUA 2W1OA 3N97A 3LSTA 2R7FA 3Q3SA 1HKQA 4P1WA 2J6TA 2IVYA 3MCNA 1TMJA 4G94A 3HOYJ 5KFJA 1IUJA 1L0OC 2OTJS 3C66A 2MKJA 2E34A 2VG6A 2GQQA 3QGHA 1V3SA 4A4JA 1AKHB 1IRXA 2ZMEC 3I32A 1KA8A 3A8IA 5KAFC 5H1SV 1S59A 1GNKA 4RM3A 1VQLS 3OYKA 2JJ7A 3GJSB 4B09A 1SIZA 1DU0A 3G6VA 1G3TA 3F23A 5KFNA 4A8WA 3QWPA 4ZVGA 4L9JA 3I5BA 5IQQA 1TMMA 1ETXA 1MSFC 3GIIA 2AJ2A 2EBEA 1ZM3A 1W2BR 1QZYA 1OYEA 1E17A 1IZ1A 2X3GA 3HOWJ 2HWHA 4K4SA 2Z99A 2B0LA 3ABLH 2Z16A 4EVIA 4JK1X 2VJIA 3DLLF 1EV7A 1GX6A 2GOXB 4LVNP 1JKOC 3JAMZ 3ESWB 1U9OA 1D1CA 2GMLA 5JVGF 5EGOA 1KC8T 2X9DA 4PJLA 1VOMA 2QSFX 4WBFA 3KG4A 4CO5A 5D5WB 3E5QA 2N82B 2X3DA 4F2SA 2P5VA 3FXMA 3GF2A 5E41A 2EZKA 3GLLA 1ULYA 3WTSC 1R7IA 2G1DA 3EE3A 3AA9A 3ZQQA 3KZZA 3LO3A 3LA2A 3SFIA 3JSRA 3OHAA 3A1YA 2AKWB 2RH3A 4L76A 2QA4G 2WOMB 1KHWA 1A7GE 1IXSB 1QPMA 4IG0A 4YFXF 4PUOA 2OLWA 2I9SA 2XZTB 5K5OA 3HOSA 1KOOA 1VQ7I 5F64A 2PA3A 2KG1A 3HSDA 4FX4A 1MBJA 4BS9A 1HBNA 4ENJA 1HF0A 3MM7A 4ZCMA 4NE9C 2VG6B 5IWAF 1T0TV 5HLIA 1RKJA 1KHVA 1NRKA 4PGGA 2J7WA 3ZNJ1 4H4KC 4NLWA 1KU7A 2BE9B 2QLZA 3A03A 5JR3A 2F63A 3OYEA 3GFJA 4P9UA 2H6BA 3DGPB 1IBKF 4Q43A 3SDBA 4CCJA 2XPWA 3T6BA 4G7OF 1AWCA 3T0YA 2DPJA 5CCMA 3TW7A 5DDQC 4B3RJ 3UO0A 1VQMI 3IN5A 4FVMA 5RUBA 3L2UA 3J7AN 3LALA 5HS9A 5GAGU 3OXFA 1QAIA 2H54B 2O8KA 2RNJA 3W2VA 3WTYC 3EUAA 4NYZA 2Z8QA 4E8UA 3E2EA 5EGOB 4ZOSA 2MABA 2OMLA 3T5XA 3ZQGA 1WJDA 1MN7A 5FD1A 5HMXA 2J76E 4RM2A 1IG7A 3GZ6A 1T9WA 3HXLA 1JKRC 3HIFA 1YJ7A 2RUSA 1UFWA 4DV6F 1YZ7A 4KIBA 2R7UA 1S97A 3HC7A 2LG4A 1YJ9S 3KEYA 4QQBA 1JLQA 1YX3A 2HKOA 2VV5A 1IXRC 2LFBA 1SL1A 1SD5A 4ZDLA 1K4SA 1BJZA 3I4NJ 3AG4H 2BR0A 5F0WA 3VTIA 4L6V3 1Z6RA 2LCWA 2EIJH 1HQEB 2Y48A 5DETA 4RW7A 4IG0B 4DR4F 1VQOI 5HS7A 2GVDA 4XK4A 3KLHB 1R00A 1TQPA 3BP8A 1DUXC 1XB4A 4K0KJ 5K8MA 3FUYA 1Y5LB 3M30B 3QJPA 2B7CB 2R2SA 3V7SA 2CZ9A 3S32A 3D68A 4NASA 6FD1A 4JX6A 3AG1H 1RGVA 3MM7B 1RAJA 3Q0VA 4P2MA 2ID6A 3KP6A 3BR3A 1YITS 4JI7F 2HYFA 1LOUA 3PFIA 4XMYA 4Y6IA 4UV9A 5F0CA 4KICA 3GCXP 2XHKA 1TK8A 3TZXA 3P4UB 2VOPA 2R2RA 1T95A 3EJMA 1XNRF 5F27A 2RB7A 4LF5J 4HT5A 4U8YA 3B78A 1VQ9S 4Y33A 2NXNA 1UHSA 3LQQA 2OTLS 2HDCA 2IGKA 2X1GA 3HP6A 2FBIA 2ZM6F 4HF2A 2GHWA 2DYSH 1JK9B 2XSJA 2PI5A 1N77A 1IKWA 4EJOA 3TJAA 4X64J 1KQSR 4K4WA 2QM3A 3WU1B 1FXDA 3DEUA 5AE2A 4DBQA 1C4AA 2F8HA 3E6CC 4A8KA 3GZ7A 3VGTA 2Z4PA 3MKYB 2W8KA 4PQUB 3PM1A 4CM2A 1JJ6C 5KCMA 5HSPA 2K8GA 1X5SA 3JAMK 2RKHA 1JLQB 4RW8B 1E6YB 1T39A 4UNOA 3D6TB 3JSYA 5E3PA 4XNFA 1RK8A 3JAMY 4DYRA 2DT7B 1BGXT 5J2QA 1S8NA 4MKAA 2D74B 4RUHA 5BMZA 2FZKB 3S8SA 2VKZG 2I6WA 5GMDA 4HYKA 4F50A 1P4AA 3MVPA 2QYOA 4QIVA 2AU0A 5B0FA 4B3TJ 1ONVA 2W1BA 2HKXA 2E1RA 3EUKL 3ENQA 4LF6F 2AJ1A 1VYAA 4Z6YA 1NB7A 3P5JA 3Q9VA 3MCMA 2HTSA 5M2RA 1HWUA 5ADZA 4NXMF 1CULA 2M30A 4JI4F 3BY6A 3OYCA 1MH4A 5B0BA 4LK0F 4ASNA 4A8XA 2P7VB 3M2VB 2E1AA 3E01B 3MAAA 1LEAA 4CCMA 1XG1A 3OY9A 2WZ1A 1VLYA 1YJTA 2AWZA 3WU0A 3E5XA 3GW2A 4F4WA 4ZN3A 1UHMA 2IP2A 3NGSA 2JA7J 1ZQ3P 3D6FB 4B4CA 4LIVA 3E6DA 3IM9A 3HTUA 2HXOA 1K44A 3NNHA 1EX8A 3IWZA 4NI2B 1AXQA 2BHZA 2UVWA 3T6JA 2COLA 5KFYA 4AC0A 3ELKA 1O6XA 4CLZA 4A3BJ 1A6IA 3TDZC 3CD5A 2VKVA 1IKXB 2BV3A 2EG1A 1K6OA 1YYVA 1FO1A 3NEKA 4A6EA 4WWSA 1VDHA 1LB2A 2HFZA 4DV3J 5M3MJ 2FTRA 1BOAA 1W36D 5M5YJ 2LBFA 4KC5A 1ZTWA 2K86A 3K5LA 2X7IA 3WTWC 1ZTTA 2IYIA 1XS9A 1A36A 2MJNA 3FNNA 3M8FA 1YIJI 5J2QB 2CQXA 2LLKA 4ZJZA 3DRPB 3PVXA 2QVOA 2A2CA 2MSYA 4ZN1A 2IA0A 3WE2A 1LWCB 2VT2A 3PW5A 2I10A 3VV2B 3KLIB 3OR1C 2YQ0A 3C8YA 4C9DA 1FDAA 4LB6B 4GRIA 1SC3B 4OZ0A 1KQ9A 1RQ0A 2DA6A 4B9LA 1VQ7S 1OYWA 3ZRGA 3IAS2 2M34A 4F02A 3V6HA 4KO0B 1WDDA 1CULB 3VEPA 4FPIA 5L3FA 5H9FK 2OAUA 3FXKA 5AIQA 1UA0A 4M6XA 5A76A 2NVYJ 1SJRA 1UVJA 4UV8A 1ZR2A 4RUCA 3KG1A 3RRKA 4ECZA 1RHQB 1R0CB 3RTRA 3F8NA 3BG9A 1FJGJ 1TQLA 1WWHA 2LQ9A 4Q2MA 3OIOA 1WF2A 1OLTA 5TRDA 5E17F 4JI0J 1N5YB 4KSEB 3FQKA 2B9SA 5H6RA 5SUHA 1KU3A 4UY8T 2ASDA 5DS9A 1VQMS 4V19X 2DRBA 2V4JB 1Y1WJ 1FCAA 1BI2A 4FETA 3ERMA 2XY7A 3FXOA 3N0VA 4PFPA 1XMOF 3JRHA 4LQ9A 5M3FJ 4MIMA 1TL3A 3M05A 1Y39A 1F36A 2N7YA 2STWA 4OV6A 4WYLA 4Q48A 2HVSA 1RWXB 2GIRA 2YPZA 4X62F 3RR7A 1DTQA 4NLRA 1EQ0A 2YNGB 4G1QB 2B9EA 4TYBA 4IZZA 4K4ZA 3S2DJ 2MD5A 3CMEI 2WBMA 2KTQA 1D8JA 1GTHA 4G6DA 2FIUA 1U45A 2E36A 1QLNA 5KG4A 1QPIA 3VYSB 1FVSA 4EYHB 2EVZA 1FWPA 1TK0A 2GCFA 3BG5A 1DBDA 4MK9A 3KCCA 3TEDA 3V2UC 3MEDA 1RT3B 4U9RA 2ZJRF 4KGZB 2WCXA 2HHHF 4DSFA 3DLBA 2FD2A 1VQOS 2W57A 2H4YB 3GV7B 3ZZZA 2XKPA 5ETSA 3S2HJ 3BDDA 2O03A 3KK1A 4RBTA 1HQUA 1VRUA 5A6WA 4B9TA 1T05A 2R4GA 2LREA 3HOZJ 1UG0A 2Y9ZA 1QHGA 1RHMB 3TWZA 4Q0BB 4Q8FA 2ZZMA 3TBIA 1MD0A 3MMAB 2HWVA 1RT5A 2J6UA 3H9QA 5H2FC 2EG2A 2RQQA 3JRDA 4XICA 2GWRA 4KH0B 3K58A 3BQ0A 1HW5A 3BR0A 3LP1A 4QPOA 1S6UA 3CDUA 4USJC 4MMOA 3RAMA 1KONA 3V8LA 2C28A 1N4LA 3I87A 5DDPC 1VQ5I 3BG6A 5CJ9A 5JHUA 4RAFA 1CJUA 1TWAJ 1VQNI 3QOPA 2HTJA 3QJLA 3BTLA 1RSCA 1F6TA 4F4AA 3OOUA 2XRNA 1TL3B 4M1KA 1TZ0A 2AXLA 3PEHA 5BNGA 5HQ8A 5D4LA 1AU7A 2VB6A 3LP2A 1PO6A 1KVIA 3H42A 3CUOA 3HK2A 5K7FA 1RCOB 2C2KB 1SI9A 2FUG9 1GVJA 3UI3A 3KP5A 2X6WA 3HHLC 4H54A 5K1YA 3WZ0A 3I9V2 2DR5A 4ZJLA 3GPAA 2DOFA 5AXLA 3V6DB 1F9FA 1S77D 2QQ9A 4X1EA 1Z21A 3MEGA 4J9MA 4DR3J 4NXNJ 1BI1A 4LR9A 3MXHP 2HGNA 4CCNA 5IYDJ 2LP4A 3IM8A 3OVAA 4X4TA 1FDBA 4DX7A 3MAHA 3MEDB 3H5UA 5FROA 3RBXA 3CXCR 4ECTA 3M7GA 4DSEA 1S76D 1X0PA 3TKYA 2YNFA 2QCOA 4C2MA 4CIOA 1ZS6A 5F1RA 3M32B 2RILA 3OFHA 3PNYA 4KFBB 4B3MJ 1HQUB 3M2UB 2G2YA 1B70B 4W98A 2ROGA 1UCRA 3UWTA 5I4MA 4E2FB 2JLFA 3RU0A 4NA3A 3M4XA 3N6MA 2HS4A 2QBYB 4WJBA 3M8PA 3G96A 2ACJA 2D1CA 2CRGA 3C2PA 3JYTA 3MKZA 3UNYA 4USTA 4C8NA 1S99A 4WP8A 1JT6A 5EZGA 4P2SA 3RB6A 4OI1A 2P0WA 1YIOA 4Y34A 3NWTA 3I0RB 2KQRA 1BIBA 4LSLA 1YW9A 3SSRA 5GAHI 3TUZC 5D15A 2LSOA 1FNXH 5HJYA 2XROA 2XYGB 2LXIA 1MBFA 1TL4A 1ZG5A 2IFXA 1CBKA 3C15B 1S1UB 2IIHA 2W4CA 2FDNA 2OBPA 1TELA 5E3LA 1M1GA 1WC5A 2M1BA 1VGYA 3WX8A 4V19J 1FXRA 5H9EJ 4B8XA 2DNGA 2Q8KA 2CQHA 3QGPA 5KFMA 4IRKA 2HNYA 5A8KA 2RVJA 4ZVPB 3BPDA 3RRHA 3T8RA 2XIGA 2TDXA 3WHIA 3RKYA 3H5SA 4LRDA 1JNRB 1FKPB 3MMCB 4BHCA 1UA1A 5LJ5Y 2ZNYA 5EEAA 1QNTA 2X1CA 3NL0A 4H4OA 4EU0A 2SXLA 3TUPA 2QGFB 3IWLA 4IHTA 2E19A 3GX4X 1WHYA 1HNWF 1WI3A 1JE8A 3M6VA 4B02A 3U1LA 2COMA 4BHQA 5EN1A 3JQMA 3IKVA 5B0GA 2OIHA 5FFZA 5FKMA 3AL0C 3HOVJ 4X66F 1JLEA 4HR2A 2GW8A 3D1HA 3AOBA 2VONA 1HNXJ 2G4BA 3PRDA 3RPQA 1U1PA 1ULRA 2B4OA 5HATA 2UP1A 1YRTA 4OAYA 4R8UA 1VBZA 4MO7A 2R7XA 5ETLA 3K5NA 4JV2A 3TAMB 1CC8A 1TR0A 1XSXA 4M3EA 1R49A 2MZSA 4P96A 1JIHA 3DI6A 5DDOC 4HOBA 1R4NB 1P7JA 2QN6B 4UHTA 2WAFA 1WJ9A 1NKCA 5IC4B 3PNTA 3MM8B 5CQGA 2DMNA 2VBZA 2KT5A 1JUPA 2MKSA 1ZLKA 5KT4A 1S1XB 4AL6A 1RPWA 2OQRA 4NDLA 1J75A 2ZKTA 1ZRDA 3I55I 3LPEA 2DMPA 3F8FA 3MD3A 3SSQA 4RA2A 2MLXA 2XCPA 4ZZLA 1BR4A 4IDKB 5LM7E 4RBUA 1MJAA 3GJQB 1ZM2A 4NC7A 1RWUA 3OTOJ 1P4XA 4WXOA 2CPJA 2R2TA 4PGHA 4XOPA 3AOAA 2HNYB 3VWBA 5A8KB 1QD1A 2G2OA 1MGTA 2QENA 3DYAA 3CMES 4AFFA 1QRYA 2BEFA 2K4BA 5FLVA 1XEZA 1K9MT 1ZPWX 4OJ3A 4HNTA 4ZVTB 2VN2A 3MZIA 4H4OB 3MPDA 1ELOA 1WOOA 4ZVSB 3M8RA 2DXEA 4LIRA 1LW2B 3KUEA 2L7ZA 2LEPA 3NKYA 3EVOA 3HVAA 3R97A 5I42A 1W0TA 3DTEA 1F9HA 4LFBJ 2VF3A 2Q2EB 2ATLA 1E6VB 4LLLA 1H2UX 1TP7A 2KJCA 3OMYA 2JN6A 4M3FA 2ATCB 2M9KA 2H94A 1KQGB 3ITHA 4HSRA 3DPUA 2L7KA 3W63A 2A6TA 1YLXA 5D0HA 2VPWB 5L1JA 3AD9C 2LKXA 2ISYA 1HBUA 3DI6B 3J7A1 4RL1A 3BTCA 1BM9A 3PHTA 3LAKA 2FVSA 2KT0A 2ZO4A 2GM4A 4ATNA 4OZNA 2UUCJ 4TNOA 1FZPB 5C4XJ 2BBEA 2CPIA 1YE9A 4N77A 5E3NA 1X4FA 2HZVA 1XMXA 1EKEA 1VQNS 3QT6A 1U26A 3GQCA 2XBPA 2CUZA 3C14B 4ON0A 2QIFA 4PG4A 4GGGA 1IM6A 1IAWA 2J7UA 1XMQJ 4XL9A 2JLEA 4PG7A 1QVFR 1JHFA 2CFOA 2DT9A 1Z7UA 1NDCA 3NS6A 2VQEJ 2JEFA 1C0WA 5CYQA 4II3A 3CJQA 3FBBA 1IBMF 4DR5F 2GXBA 3G9CA 4JUZA 4HX8A 1FWLA 5C42B 3U9GA 1XSVA 2E66A 2KHMA 3DTKA 3DYAB 4HQEA 2QLBB 4NLSA 4PDKA 2F6CA 3MUTP 3N6NA 1U2CA 3OYFA 1LQ1A 2Z56B 2FNAA 2Q66A 3ZQHA 1S57A 1JGSA 4KHRA 2FXAA 2OPTA 2KI2A 3GONA 2BA9A 1TUGB 1ZZFA 2C3PA 1BQNA 2WVCA 3D66A 1VIOA 1F1BB 2QKLB 4RAGA 2O3DA 2P8IA 3DHXA 3PIPQ 2Y8WA 1TL5A 3IKTA 2VU5A 1IKYB 2QQAA 3MMBB 2NCKL 2O9LA 4ES2A 1SKRA 4I0WA 3IXQA 4PPDA 1S0MA 4ABZA 3H2LA 1MZBA 4QPQA 4EM0B 1F5CA 2DK2A 5KFEA 1K73T 2JFKA 3B54A 1Z0XA 1X4DA 3CP8A 3US5A 3ITHB 2ZH8A 1WC1A 2H65B 4YEJA 3ASNH 3Q89A 4KYZA 3K5MA 5LMUF 2PD1A 3CT9A 1K83J 3OXLA 3G73A 1HBUB 3C2GA 2KJBA 4X65J 2W48A 4OZ2A 5GAGI 3C2HA 2NPFA 2A10A 4U7CA 4A3KJ 3I31A 2QEXI 4J9RA 1U1QA 5KFDA 5K5QA 3JREA 1CS4B 2P6SA 3M9MB 3F44A 2OPQA 2BABA 4JV5J 2UUBF 4XQFA 5IYBJ 1B0PA 1OMSA 3C2BA 3ZO7A 1VJWA 4WXWA 1TNTA 4BQQA 2FHKA 1KVKA 3G6XA 1WTFA 3HRMA 2M4GA 2POKA 5K5MA 5CYQB 4YG2F 4X6AJ 3GIRA 4YRVA 4ECSA 2CH0A 1RT1A 2DDAA 4QPTA 4A8YA 1NB2A 1R5HA 5FB2A 3C46A 3GFIA 2H9ZA 4PFOA 2DIUA 3IRWP 3NRVA 1LK7A 3JRFA 2V26A 2ZWPA 3SFGA 2R92J 1RA6A 3FK6A 2KRCA 2DGTA 2PDAA 2M7AA 1FT9A 1EP4A 1PJ5A 3JB9k 4RKUC 1FVQA 5DGAA 1U5TC 5CYJA 1KQ8A 4N0BA 1FOYA 1BQNB 2DRAA 4J7CA 2PO4A 3CGIA 1J5EF 1YJUA 4PYDA 1LW0A 3I59A 1Q7YT 1J7KA 3KLFA 1EAYC 4OLOA 3K0JA 4OJGA 5ITHA 3KE2A 3KLOA 3KIOA 4AD6A 5KFXA 5CVIA 4ZIWA 1JTXA 1G1XA 4A2UA 1T98A 3UN3A 5DM7F 3GTLJ 3ET6B 4IUFA 3IRXA 3LUYA 1JLAA 2ME0A 3DF8A 1CJVB 4OIXA 4RNMA 3X1LB 4YOEA 4CSWA 4I67A 1S1WB 3Q0AA 3SQNA 2C1EB 4MK7A 2C2DA 1WDTA 2V50A 2CQ2A 2GXAA 2K5CA 3ENWA 4ZPVR 3UCGA 3P6YC 2RGVA 3BBFA 1R27B 3I4MJ 1ZN2A 1KTVA 2QE5A 2R7WA 2DFIA 2DR9A 2ZSIB 1NG6A 2O5DA 2OPQB 2EPIA 1Z91A 3ABTA 4ELTA 2L2OA 2AX1A 3KLEA 2GO9A 3BTIA 4B3SJ 3HPOA 4FYWB 5C25A 2XGPA 5ICGA 2V8GA 3TVYA 4ANCA 3F41A 4HKQA 3KFWX 1RT2A 2DH7A 2CW0F 2O0YA 2VJ5A 5DZ7A 4ZVQB 2G0JA 1W4MA 2UVRA 1RKWA 1HD1A 3D0HE 2VT3A 5ETKA 2CA9A 1EB0A 2BRKA 1TVRB 1PYTA 2RJZA 2KH9A 2HVDA 4KT0C 4KIFA 3MR2A 3CE8A 5KFKA 2MLGA 5K7HA 1ZR4A 2TRTA 5DQIA 1JJ8C 4F55A 2HMIB 5IOYA 5EX0A 3BYRA 4J9OA 3HFVA 1OJLA 4EM2A 3TO6A 5SZTA 1CF7A 5BYQA 2RRAA 4B48A 4QIFA 1F1ZA 2XGXA 4A48A 2NS7A 5A0YA 5HVHA 2UUTA 2XV4S 1B6AA 4PPZA 5DM6F 3D3CJ 3IRXB 3PO4A 2EV6A 1C0TB 1JLAB 1WPKA 2OAZA 4O6JA 3FBNB 4YIIA 1C1BB 1D0ZA 1B8IA 4EM1A 1KU9A 4KN4X 2RIJA 3VAJA 3PW2A 1R6RA 1TNSA 3HZJA 5BQTA 3PYGA 4RB0A 3GMEA 1TQIA 2OF7A 2WB1D 4QYRA 3T1HJ 3HKWA 1OPCA 1RTIB 4DFPA 4LBPA 4FF2A 1EKRA 1MU2A 2GA1A 4WFYA 1N48A 4DL0C 4MYUA 1IV6A 5HQLA 3IR5B 4CT9A 2GO8A 3FEXB 2JK3A 1SFKA 5C25B 2CW8A 1U0JA 4OZ5A 2ZKZA 1X1PA 1RTDA 5JLXA 1LFUP 3ULHA 1PJRA 1B0TA 2BACA 1ZH5A 6AT1B 2LYVA 5K14A 5J1EA 3J80Z 1MKMA 1WNEA 3GXOA 4K2JA 2NUHA 4I0BA 1VLOA 3C19A 2G9WA 3E97A 3DQVC 4EGZA 2AJ0A 2HQRA 2HW3A 1KVJA 3DN9A 1HC8A 2KFYA 1BJAA 1FEXA 2HQCA 4OX9J 1T03A 2G0CA 4CO8A 2H8RA 2LKPA 4G6VB 3B6BA 1RT6B 3Q8QB 3OT9A 4UZBA 4GKKF 2IM0A 3CF2A 1N88A 3FBCA 2CJJA 2CQ3A 3FXQA 4QOTA 2PBIA 2HIYA 1ETVA 2BVMA 3H5RA 4DF4A 5EHHA 1CSJA 4DZJA 2Z9OA 2ZVIA 3QSYB 3V4IB 5A0YB 3SYTA 1N34F 4NCBA 5B08A 2NXJA 1N8RT 2F5EA 2ZH2A 3QU3A 1NO8A 1OFCX 2CQBA 4FTHA 3H92A 1TWCJ 2LNBA 4DWIA 1SJ3P 1B8IB 1E3PA 4KT6A 5IP9J 5DD4A 2DOAA 2AQFA 1VCTA 4XTTA 2MSSA 2EW9A 2CDQA 1NSPA 1XGMA 3G3ZA 1KU2A 2YKPA 3DFGA 1PAEX 3HSZA 4ED6A 1HNZJ 5K8PA 3TVKA 4N4OB 3SQOP 3MQ0A 4CH1A 2PEBA 2QEXS 5HS8A 4BE2A 3ONQA 4HEA2 3CJTA 1S6OA 2PA8D 1BC8C 4C2TA 5J8CA 3EZ5A 1DZ5A 1UJ6A 2GNKA 2GVZB 1VFCA 4HDUA 1RTDB 4FP9A 4C3MA 4KNYA 5CQEA 1HLVA 3L7PA 4DUZF 3ZNUA 2F5GA 2RMLA 1SVLA 5KFBA 3A13A 2KO1A 5E3AA 1FE0A 5K14B 2QSGX 2DT6A 3H5AA 5EG0A 1H2TZ 5IQ6A 3K1NA 3M8JA 1YG0A 3QFWA 2KM8C 1TK5A 4NLVA 1IQTA 5L3GA 1BR1A 1GT8A 2E1MB 3QSIA 3PZPA 4J9UE 3KP3A 4KMUX 3LP0B 3MD1A 1H3DA 2ASYA 1HW2A 1J5OA 1T03B 1UPMB 3PX4A 3VQSA 1S1VB 5E7OB 4QBUA 1CC7A 3NCRA 2L9DA 3I5CA 3BR6A 3IBCB 1VMBA 3HKZA 3BKTA 5CVRA 2W8LA 1MG7A 3REOA 2H1KA 1FKOA 3SFUA 1HBXG 2R8JA 2P5LC 2BOPA 2KLOA 3PACA 4F91B 1X9SA 2V68A 1KLNA 2GJ2A 1WC6A 3HM9A 4MEXF 1VRTB 2HEOA 1HWJA 1MBHA 4IKFA 4IOCF 3TQ1A 2JSPA 2OPSA 3QNWB 1XJWB 2OEKA 4FX0A 4A3JJ 1XN9A 1IM4A 2VASA 5D6FA 4HYEA 2I5UA 1N56A 1Y10A 2L9VA 3L1PA 3V6KA 2ZHBA 2DCEA 1REVB 3CF5F 1Y11A 2AIRB 1ZOTA 1OJ4A 1HDDC 1VQYA 1RI7A 2EEYA 2RQMA 4CLFA 3MHYA 1U25A 2RRNA 2HG4A 2DGSA 3OR2A 4L74A 1FWZA 1NNDA 3CJTB 2NVUB 1D3WA 1SQGA 3D0IE 4CH0S 3PRVA 1M5SA 3QPIA 1X1AA 1XX5A 5BPIA 2BE2A 3M3YJ 2NS0A 5B7WA 1GXQA 3GJRB 4XKVA 5K7ZA 4B9SA 4DU7A 2WTFA 4F8RA 4ED4A 1VZ0A 1X5TA 2XSJC 4I69A 4CCKA 1IN8A 5EG0B 2YXLA 2UWMA 3A2KA 1C0UB 5AT1B 5FLXZ 1KDNA 3TNVA 3HRSA 3GLXA 4AE5A 4QR1A 1R22A 1HSTA 3RGIA 3G8SA 4J9KA 2JQ7A 4I6WA 3DNCA 2KXFA 2QMXA 2W9AA 5J2PA 5DDGA 4NCAA 2HVQA 4JB8B 1IC8A 3FSIA 4KGKA 2K2PA 1X58A 1Q53A 4KGXB 2B5JA 2E71A 5B0AA 3ZTQA 1MLAA 4ETZA 3RB3A 4X4OA 3J80K 3TX8A 4MGRA 1WKLA 3WODF 3HPHA 2L02A 1VK3A 1Y4ZB 3CCYA 5AIPA 3J80Y 1NTCA 1PBUA 1SD4A 4OV1A 4CQ1A 1D0YA 1CPZA 4CO4A 4MLOA 4XORA 3VSLA 5JLWA 4HT7A 4IH5A 2LU1A 3ZTPA 2CJYB 1JLCA 1WUUA 1S1TA 3E6MA 4BXXJ 1UWBA 1FTZA 1U2FA 2K9LA 5CH7B 3MDFA 4W90B 1I5OB 2MPUA 3FKIJ 2BJ1A 2QLFB 4QWAA 1S6QA 3J81Z 3JQJA 5HLGA 2HNDA 4BACA 2JRSA 5IOZA 2BUNA 2COBA 4E7LA 5E33A 3R7BB 5J40A 4JI3F 4B47A 3MPYA 4YB6A 5DCFA 4DS5A 4ZYAA 2JH3A 4FISA 2E5IA 2BV6A 3K4JA 3H2UB 4P7VA 4IHVA 4GO5X 2E9RX 1WI6A 5G0RB 2DLLA 5IT9U 3A02A 1QBJA 4G1PA 3VYTB 4IYQA 2HHUA 1MMGA 3RJMB 2ASLA 2BE2B 3UN2A 1Q78A 3FDYA 3HFKA 3X2QH 4LFCJ 4ZC3A 2W2NP 2OCEA 4LF4J 2JVGA 3BN4A 2UXBF 2WWYA 4B17A 4WF9Q 1F3FA 1O3RA 2DODA 2VXDA 4ZP7A 1AA1B 1HW9A 1RWOB 1MSEC 4ECUA 2XI2A 1SL2A 3HJVA 1V5FA 2LF8A 2F8EX 4LSNB 3RBEA 4EEFG 4PJNA 1T9TA 4M9ZA 1TKTA 3ILLA 1B3TA 3CDLA 2EWHA 4M74A 4K4XA 2BXYA 2E2IJ 3S2WA 2B5JB 1F2GA 4C8KA 1GFWB 2Z5UA 3BYPA 4EI2A 4XSXF 3U1DA 4M94A 5ILSA 3CCEI 4OIPF 5HOOA 4PG6A 4TU8A 1JLCB 2WC2A 1M5HA 2D3UA 4E98A 3LSIA 3DP7A 3HSGA 4NCGB 1TC3C 2R3SA 4WFZA 1LEOA 2K7JA 1K0VA 4OYIA 3WHCA 5J2MA 3U02A 3BGRB 4B1RA 1F60B 2IJRA 2ZSHB 5M2PA 5J1YA 4MIAA 4DYCA 4GDFA 2N8GA 5EUHA 5D0RA 4C3IJ 2YWHA 5M5WJ 3SCJE 2QMUB 3M6UA 4AXIA 3T5HA 3P9KA 1U8BA 2K7KA 5F8MA 3RUBL 2A6HF 1Y0HA 2AZ1A 3FEYB 4WE1A 1XWLA 3CCWA 2LA6A 4Y2IA 3PFEA 5J2NB 3S15J 3AA8A 4IRDA 2V9WA 2V8VA 3Q8RB 4HACA 1H74A 5GTIC 1X0FA 1OKRA 3AQOA 2DMTA 2LF7A 2NZ4A 4X4UA 5HP1A 3ML6A 1NU4A 4PJJA 1K1SA 3HT0A 2B7BB 1WEZA 2HFUA 2IS6A 2AYBA 1U1MA 2OZ6A 2EFOA 1R6YA 1SANA 4DZPA 3HD2A 5E18F 1OSCA 1R8BA 4LIUA 1IRFA 4F52A 3CC2I 3IH4A 4ZVEA 3MI7X 1QY7A 5LEJA 2DGQA 4IFVA 3K70D 1X19A 4RNFA 4M63A 3LQRA 4M5KA 3IS9B 5A8RA 1S0VA 2UXCJ 5KFSA 3HGYA 4DGWB 2ZJPF 1RWPB 2BXJA 3B6CA 2E5GA 4KB7A 2AEMA 5FLXK 3FDSA 4ECQA 5F8LA 3VAMA 4BJ6C 3F3XA 1U0HA 4L72B 3IAM9 1ZBTA 1X9MA 5FLXY 4IR1A 2DA4A 3CTAA 3DLGA 5D6GA 2PLYA 2F5CA 4ID5A 5D4NA 1GHCA 3P45B 2EILH 4XLHA 3AKZA 3KMQA 4IO1A 3CLOA 1FIAA 2PC6A 1K1QA 4DUTA 3OIPA 4RB2C 2W7AA 2ZH1A 1GXLA 4OYZA 1KN6A 3Q9SA 1FTRA 2BW3B 4CH7A 1B99A 3L7WA 3MWMA 4PXCA 3KK2A 2WV0A 3J7YI 2EZHA 4NLGA 4BHPA 5CLSA 2M0GB 2BZTA 5D0EA 4TU9A 2RU9A 3G82B 1K78B 1NPKA 3C6TB 4EMDA 3VAGA 2IEKA 3KOAA 3J81K 2A5WA 4Y17A 3KEOA 3QBCA 2NS1B 1NAQA 3TX0A 3J81Y 4RLQA 4HACB 4MEYF 2QMWA 4DQSA 2GJFA 3QAEA 4EK2A 3G71S 3RRGA 3GR1A 4Z37A 2HHXA 3WGHA 4XSZF 4QWQA 4U8VA 3PO3J 1GXPA 1WACA 4FXDA 3GTOJ 3WTZA 3HDDA 4B43A 2EIMH 2LQ5A 4LITA 3HT3A 5DCMB 1ZAXA 3ZTRA 4IG3A 4I64A 5HMWA 2Z0GA 5BS6A 4OI0A 1P7IA 2AS5F 1TFWA 1T38A 2XASA 3FISA 4BH9A 1YX2A 4EMSA 2E1PA 4HF1A 1DLOA 4O0IA 4HVZA 3POTB 5A8RB 3CW2C 5G4DA 2HWTA 4N7TA 2XLKA 3Q23A 3UCUP 2LH9A 2AP6A 2HBZB 1UJ5A 2OUMA 2A6EF 2E9TA 4DX6A 3JTOA 3TMOA 2QO3A 3MUMP 2VBYA 1JWWA 2F65A 3H7HB 4C0OC 3LSHA 3ZFVA 2HPMA 1U6ZA 4FF1A 1HNIA 1NZAA 3EDRB 4ANJA 3K69A 1VNDA 3LSRA 3BZ6A 4KDPA 3DOKA 4DXLA 2HQNA 1N52B 2FVCA 2QSWA 4ECVA 1UZDA 3G1MA 2DXFA 3J81j 1O7LA 3W5XA 1QQIA 3GIJA 1SKSA 3LSKA 3KDNA 3EX7B 1CEZA 3F56A 4IJAA 3VGSA 1R3NA 1OISA 1YQHA 3TZYA 5IT9Z 4P52A 4JI6J 3THPA 1H88C 3FHZA 2JHEA 1O7FA 3QPHA 4K50A 2E2JJ 4OLPA 3ZN0A 4AIHA 1TL1B 3R9LA 4K4YA 2BE7D 2AT1B 3C3WA 5TISC 1RHRB 1HKTA 3OL8A 4JI1F 4CWBA 3OYLA 3K2YA 4UTGA 3VALA 2AO9A 4ZPCA 5KNLA 4J9QA 4ICLA 2BYCA 3A01A 2W2OP 2DR7A 2HZTA 3RPUA 3ADAC 3R5BA 4NWBA 1FRIA 2XMMA 1MDMB 1CJTA 3TANA 4NL5A 2AD9A 3L2QA 1AROP 1L3VA 5DD8A 3VCDA 3MR3A 4DHVA 5E1ZB 2KL4A 4IG3B 4LF6J 2OEMA 2ACMA 4DN9A 4MK8A 1FDDA 4NXMJ 4OYOA 4DQRA 3MR7A 4CNZA 5GAGJ 3VFZA 3BPSP 4DL7A 2VOOA 3DDIA 2F4VF 4IPAA 1I6XA 1HBOA 2A5YB 1WOSA 1U0SA 3OYJA 1NK2P 1RESA 3CDWA 1PUFB 2DNKA 3CNQP 3F21A 2KXNB 4LB5A 4J9SA 1V3RA 2RDDA 3DWLE 4DV1J 1HHSA 4ZA1A 3DOKB 5D4SA 4MIWA 2OZUA 4FT8A 1P6RA 3I0SB 4R0EA 3RYRA 3KLVA 1WF1A 1UFLA 4NEYA 1IN6A 1DP3A 1WJAA 2CJXB 3I53A 1SVDA 3IH3A 3J7ZT 4URGA 2A3SA 2A69F 2MC3A 1V3ZA 2PEHA 4CTAA 4DF8A 2FMLA 5L1LA 5F0UA 3R6SA 3MR6A 4NA1A 4DV5F 2XPUA 2OEJA 4ES3A 1P92A 4MFBB 3MEEB 1V3FA 3CZ6A 5HLHA 2YU3A 4I02A 1HYSA 1BWEA 1M1EB 1QGPA 4EJVA 3CTRA 4NRTA 3TL4X 1SJQA 1JXVA 1LDDA 1XK8A 4WXCA 2MQLA 2FZGB 3KYCB 3A3PB 3CDBA 2GAGC 2Y69H 2OV7A 5HLFA 1L3LA 1URNA 2HVZA 3ZC4A 1FY7A 3A01B 4ZLPA 3NRBA 4CNYA 3NS5A 4A8SA 3DM2B 3I5AA 1HKSA 4FNIA 2HFNA 1HCRA 1GUUA 2ZFUA 1QJHA 1S9EB 3KZYA 1B4AA 1SH0A 4P9SA 5CAAA 2J0QD 5KFWA 1PGZA 3MMJA 4KE5A 5ETVA 3SEQA 1U02A 3QRRA 3G1LA 2DCUB 3AD8C 3CC2S 3JTPA 1T3OA 1ETQA 2CPZA 2V67A 1H9GA 3HUGB 4E6KG 3TA0A 3R5DA 4GKJF 1KSPA 4QZVB 1SB6A 5KTQA 4C2MJ 1XR6A 4K4TA 4IFYA 1FOKA 1WZ2A 2Y30A 3BLYA 4ILLA 4EZ6A 3IBFB 1IKVA 4AL7A 3EYZA 3WU2C 2VG7A 1R7JA 1KFDA 2HQAA 2BANA 3MM6B 1ZHFA 2PJRA 2D3OR 4ZKAA 1RWVB 1NK3P 3DOMB 3KK3B 4ZDNA 1GMWA 3VR1A 4Q7AA 2Z33A 1FEHA 5LXRA 1SPBP 1YW7A 2OGUA 1XMOJ 2C42A 4KHMA 3S7RA 4LQ3A 1NDLA 4CTAB 1DPRA 3BQ2A 3GFMA 1O3SA 4U95A 3BJOA 1VQKI 2M8DB 1YRNB 2DNLA 2HNHA 4FQGA 4Y13A 3ZMVA 3M8YA 4WZQA 2Y1LB 3BJ6A 3M1VA 5F8IA 1UHWA 3R2DJ 1XC5A 2WADA 1RIOH 3Q8PB 4E7SA 3K1MA 5J8FA 3HYIA 1TKXA 3N4WA 3MECB 3BKFA 4A3EJ 2XWYA 4USIA 4OAZA 3ABUA 1C2PA 1S7HA 2BW7A 1SEUA 3IGVA 1KQKA 4TU7A 2YNHA 4RU2A 5HLFB 3M8ZA 3RG6A 1FK9B 5E5NA 2C2RA 4B08A 5L3EA 1MN9A 4AT1B 5BYSA 3M9NB 3RIRA 2FLPA 2B8QA 4JI8J 2YU9J 3W2WA 3ZPLA 3I0TA 2NS8A 2K06A 2CQNA 5DQHA 4XN0A 5DS7A 2EA2A 1FP1D 4QYZK 4CM0A 3N9UC 5LGUA 4U67Q 2DGWA 3HULA 4DUYF 5GMEA 1G3YA 1I51B 2EQRA 2DBBA 3CDIA 1RTHB 2DI3A 1YJNI 2MSTA 2IMOA 2KB2A 3PHEA 1RZ4A 3UDEA 4HTIA 2G0EA 3BR8A 5KFQA 1NDPA 2MLZA 2YKNA 5FJ8J 3FXUA 4UUWA 2N3LA 3IO1A 3HMJG 1FTTA 2ZFHA 3F6OA 3CIZA 3KYLA 3CDAA 3SZTA 2X6XA 4MNUA 1NJYA 3LMMA 2MQ8A 4USKA 2J5PA 3AODA 4YR2A 3HOTA 2DH9A 1O3QA 3ILOA 4MAKA 5ETMA 2WVDA 1UETA 5FD6A 2XMUA 4M9SA 1YKWA 4UOHA 4DJBA 4IL6C 2E5JA 4MTPA 2HLTA 2UUAJ 2XPVA 2NREA 4OMYA 2V1DA 2YKMB 4UT4A 2HZDA 4RUAA 1I5ZA 5IV3A 3D5RC 4R25A 2FJVA 4PWUA 1LWFA 3M9OB 1NCLA 4F0MA 1GX5A 3M1VB 2XDVA 3AB2B 2GQ2A 1DQAA 2FBKA 2YS9A 2H1LA 2VLAA 4R0JA 4NPOA 2B43A 5GADJ 4KV8A 2DHAA 3E51A 4B3RF 4RNOA 2NXEA 4C98A 4DU8A 1JLBB 3ZTSA 2RRBA 4CT8A 3L2RA 4ANEA 4O23A 4M5NA 3OYBA 2XULA 3QT7A 4KJIA 1RTJA 4ITVA 3C6UA 4ITSA 3W2WB 3UR3C 1OCRH 3BV8A 3FKJA 4URQU 5LBQA 5F8HA 4D5FA 5IS2A 3S1RJ 3IH2A 2K1RA 4PG5A 3A8JA 3GBGA 4BQNA 2BW2A 1DRZA 1V54H 3K4NA 3K57A 3I58A 3UPFA 4KAIA 1WJCA 4NZ0A 4USWA 2PMZD 4ZHRA 2OD4A 2DK5A 4OYXA 3R5GA 3OLAA 5GAEJ 2IJLA 4Y28C 1X1DA 4RR5A 1OO0B 4LF9J 4L5JA 2W9BA 2HHQA 4XLCA 2HRTA 2MZRA 2OPPA 2FX0A 5H20A 1T02A 5T7LA 4I76A 3ILIA 3QAUA 4OX6A 2RNGA 4HBLA 2R93J 2CKWA 3DXSX 1FJEB 3JR9A 1U7LA 1OQ3A 2UXDJ 2XM3A 2C2NA 2MQOA 1FEEA 3G8TA 5C24A 3QPLA 2NYXA 3BM7A 4HDHA 5DO2A 3R60A 4U7UD 2B6AB 5B0CA 4F3OA 1D5VA 1BQMA 3T5KA 2UU9J 1RAAB 3ISPA 3EPIA 3DLLQ 4OQJA 4DOZA 1P1LA 3OYNA 1AB8A 1UJ4A 3U2RA 3ZZPA 1WQ2A 2PQ8A 4XLNF 4LF5F 2Y9YA 4UW2A 3KNGA 3K17A 1Y5NB 4QTRA 2VG5A 2V79A 2K9SA 3BT9A 2JX2A 2PX9A 3RZAA 1T2KA 1FYLA 2AV5A 3IC1A 5IM0A 4HLXA 4H0EA 4F7VA 3QRFF 2MKCA 3LTOA 2X1DA 1OY6A 1QU3A 2ZITA 4U7DA 1SVOA 2K40A 3QP5A 2ZDPA 3RB0A 4A3CJ 3QLHA 3PO5A 3GZ5A 4LFAJ 5B09A 1RTJB 4LRAA 4X64F 4KHPJ 3C6UB 1R71A 4U7BA 2P9GA 5FKLA 4XDCA 2K1RB 3VGUA 2VJVA 1OCZH 2CQKA 4U0VA 1WKMA 2WVBA 2F1FA 2W24A 4CA0A 4X0GA 5ICEA 1N78A 1T33A 3DRSA 4V2GA 2RQKA 2CNNB 2QG9B 2CRLA 3CP2A 1NPPA 4WF2A 2C2EA 1VC5A 2HNZA 2RDJA 2KT2A 3VSKA 4GYIA 3DKXA 2RNEA 4B3TF 1B7YB 1ZK8A 2K9QA 1F3VA 5KG1A 2QKMB 2LY1A 4KISA 3GG0A 4BQOA 3D6HB 3CVKA 2YVSA 5KK1A 2WK4A 1ENHA 4FYDA 1S7EA 2V6CA 3UD5A 2KIFA 3X3UA 1W26A 2WAEA 2X4HA 3D1QA 1J09A 4WCEQ 1BQMB 2KKHA 3LL7A 3SI8A 1C1CB 3VAHA 3DXBA 4DR2J 3Q0UA 1N25A 4EJUA 2YWEA 3T5JA 3W8GA 1HL6A 1O5JA 2RAQA 2DPDA 4AL5A 2ZD1B 2CPXA 2DNQA 2VPRA 3E6BA 1O51A 3UKGA 2MY8A 1SD7A 3AH6A 3D5LA 2IDEA 3CEDA 1QM9A 2DTRA 4F92B 4I6YA 2DCLA 1JNZB 1FSHA 2CJ9A 2H4WB 3H5XA 5KT6A 1ZAWA 2MZTA 1HD0A 3LA3A 3M8WA 2H48B 5KVRA 1Z67A 1S72I 2IRXA 3I9ZA 1IO2A 1KLMB 2ABYA 1Z6TA 1T56A 2VQFJ 4DV3F 5KHDA 1RDRA 3PW0A 3RI4A 2W4DA 4KN7X 4A0XA 3WTVC 3IL2A 1IQZA 1S9HA 4IHXA 3TYTA 2OFGX 3G8QA 3I82A 5BR8J 1SL0A 5L9XA 3PFYA 1NLKL 1Z77A 2UV8A 3QO9A 2FPHX 4C8ZA 3HHGA 3KJFB 2XB5A 3B82A 2IT0A 2HQGA 1MROB 1JI8A 2M45A 3G1OA 4OI2A 4M6VA 4NLPA 1Q8IA 4FHTA 1X1BA 4RX6A 3SJMA 5LMNJ 2WB1N 3QRPA 2ZDOA 4LBHA 4NUBA 1TWHJ 4XKWA 5HN0A 4ED0A 2YX1A 2O5RA 1ZRFA 1KBRA 1NJWA 2UVVA 3ZP5A 4PEOA 4CLUA 2VPLA 1N5TA 4TLQA 2Y8YA 4RO0A 2D1VA 1Q1HA 4XAKA 4LF8F 1DQ9A 2GIVA 1Y00A 1M1HA 3DKDA 3N4MA 1IDZA 4GO7X 3GWCA 1WHUA 2LXUA 4ED2A 3K59A 4FASD 2O7OA 5AONA 2F4FA 1JXEA 1O0PA 1XBWA 2X1BA 4ZH4F 5T14A 4A6DA 3I5UA 4JI0F 2EFPA 1HDPA 3BBCA 1IWGA 2AYMA 3ZMDA 3WGGA 2M70A 2HQ3A 2G13A 5LHHA 1F5TA 2AYEA 4RMNA 3BPVA 1S7IA 1URRA 1IV8A 4ZLNA 1ZKGA 4WYWA 3SV4A 3ZGKA 3LOCA 2WSEC 2KRRA 1TL7B 2XMVA 5ETQA 4ELUA 3O6BB 2QSFA 2KZMA 3TZZA 2ZMEB 5B3SH 1F5BA 3GZNB 3HL2A 1YS7A 3TJ8A 2VJ4A 1QUVA 5IOLA 2XB2D 3RR8A 1S6LA 1X4PA 3NS7B 2XMTA 5H6QA 4BYYA 4EO6A 1WG1A 1KQ0A 3HKZD 3NCPA 1EA3A 3QO9B 5EDWA 1Z7LA 3ROUA 1RU1A 2DN0A 3LA7A 5EWFA 2PFFB 2QGUA 3THTA 2YQ1A 3TEHB 1DTTA 2DMUA 3DMJA 3SFZA 2R7ZJ 1SQEA 2YWWA 4URSA 1RR8C 2ID3A 4I01A 5EEHA 4ENKA 1S3JA 3EGWB 2FJAB 2WOMA 4B3OA 1HWKA 3VZHA 3RQIA 1OMIA 3MTJA 4L9TA 4J9PA 1IN4A 4DZ6A 1RETA 3OUYB 5J4YA 2YKAA 2CJKA 1AFIA 2CUFA 3AB4B 1XD7A 3L2WA 4C8OA 4OYBA 2AJ4A 5HDKA 3CIMA 1JB0C 3D28A 4I2OA 3GSIA 2Y31A 5KAKA 5GMKa 4II2A 1LDKB 3MFKA 5FD5A 4OI4A 1MNMC 4WU3A 2KRHA 4B9VA 2HZAA 3P8BB 2BQRA 1TT0A 2CG8A 1U8RA 3F8CA 2QV6A 1A04A 3DGPA 3GU0A 3Q83A 2XMKA 2QLXA 2D2WA 5LOQA 3A3OB 5ETOA 4LR7A 4DSJA 1KFSA 3OR2C 2PG4A 5K9FA 3BBBA 5E1XA 1TZLA 4E7JA 4Y2CA 4K5SA 4N47A 2WB1A 1VQSA 3OSFA 3I56I 1YVFA 1FNMA 3G87A 5FRMA 2VBXA 2K27A 4OZJA 1HMVA 2P81A 4DIQA 2OFHX 5FRNA 3GJTB 3J7YJ 5LSLA 4XRFA 3W66A 2Q43A 4JV1A 1JXSA 3EXCX 4P2XA 4F67A 4DR3F 1FRJA 4NXNF 1WSUA 2RN7A 1R1UA 2QL5B 1DTTB 2KZGA 1SC6A 3DMJB 5ETNA 5F04A 1PC4A 1RAHB 2CWKA 1HQEA 2X0LA 2IM2A 4B3OB 3WQPA 2XG8A 3HVWA 1TKZB 2C3MA 3N5FA 1RBAA 4QIGA 4XLFA 2GJIA 3KLHA 3NGKA 3B4MA 1K8AT 2R7SA 3S6EA 3W9JA 3KLGB 3S16J 2PEXA 5GPAA 3M30A 4P9FA 5KT2A 4V2FA 5U47A 4PG8A 2HHVA 1WJBA 1EZZB 3H0PA 3GV5B 4N4NB 3HHNB 1HARA 4WCGA 4A46A 5C2GA 3FWEA 1FXLA 4M5DA 2HBQB 1M5OC 3F0NA 2HHWA 2MH2A 3QRQA 2VFUA 3M2RA 1O57A 4M5IA 3LNQA 3H25A 3CJ0A 4RDUA 4LJZF 3B4DA 1LK5A 4DX8H 2YX4A 1ZPVA 4WKRA 1H9TA 4XLPF 4DR7J 2UVUA 2KISA 3BC8A 2IBKA 4CO1A 4YR0A 1QUPA 5LHIA 1SVMA 1SIWB 3TAQA 5F8JA 1S72S 2JTVA 4F3MA 2GZWA 2JL9A 3CCQI 4BWJA 1SQFA 1HMVB 3OFFA 1YS6A 4RW6B 2J9EA 4XO0A 4ELVA 2B51A 2ZJRQ 4PRFA 2KPMA 4RNNA 3FX3A 3OJUA 3HVRA 5HVGA 4KGVB 2A68F 2Q3PA 1X4AA 4PQUA 2KL8A 1DP7P 3HOUJ 3I71A 3H98A 5KFZA 3BG7A 3RYPA 4DFJA 5B0DA 4DSKA 1NJZA 4RW8A 1E6YA 4PJMA 4C2UA 3HGGA 3PSFA 2J6SA 4A47A 1RAGB 3T1AA 1TFYA 1KR4A 2FLOA 1K0TA 3HSFA 2B8PA 2NPIA 1JJCB 1VRQC 1I6JA 1TAUA 2PMWA 4WTOB 2L9SA 3QPTA 4PZJA 2K3FA 2CZ4A 3FMQA 5IC6B 4TKTA 2FVPA 3EETA 2ZZTA 1G7CB 1YSJA 3QPSA 4QIWN 1Z4UA 4LGWA 1HNXF 1X60A 3LPYA 1O8BA 3SQGB 4TN2A 4DG1A 3C7JA 4U87A 3PRBA 3KP4A 3BOQA 2DGXA 3BEGB 3S8PA 1WF0A 3TQNA 1SAXA 4XBFA 1J9IA 4CO0A 4M5DB 2M8EA 2G1HA 4C8YA 2JLGA 3CC4I 2BJ3A 4JOMA 8RUCA 3M2VA 4RB3C 3E01A 3MPWA 3ZZUA 2M8GX 3M2RB 1N75A 4IOBA 5HQMA 4UZCA 2R5ZB 1HI0P 2DXIA 4DPWA 3JSMB 2YQ3A 3GTQJ 3MGJA 2EFVA 1JXLA 2YNIB 2VFVA 1XR7A 2RQCA 4GXOA 2RF2B 4G9YA 4RGRA 4ZCIA 4ZIVA 2Z2ZA 3V7CA 2V1UA 4CYCB 4NI2A 4U7UK 1BUXA 1N0VC 3KJQB 1WFXA 3ZMTA 3H0GJ 1T9XA 5DV5A 4GKKJ 3H9JA 3H40A 1Y8QB 1LE8A 1EF4A 3NGUA 3BGFA 1I27A 4F36A 2KRBA 3ABKH 2WONA 3W64A 2KIUA 3BDEA 1NK5A 3ZQLA 2MQNA 3OTOF 1YLFA 4K4UA 2UZKA 1LJ9A 1IKXA 3OSPA 2JA8J 2HYGD 5JI6A 5IXUA 4JOUA 4F26A 5EX3A 3FJ2A 2B4PA 1U49A 4YHHJ 4C0HA 1BOBA 4ZTJA 4OX7A 2IRFG 4CLWA 3OYIA 3NWGA 4HLYA 2LXFA 3O1LA 2VH7A 3JS9A 4YUDA 1FX2A 4WK1A 4HHUA 2J9DA 2VQCA 1ON2A 3JCUC 3DRPA 4Y2AA 3BR5A 2KDZA 1LWCA 1NH8A 2W2QP 4LF1A 3AFHA 3MZYA 4FBTA 2FUG2 1VISA 3VOEA 3KLIA 3T1YJ 2IBOA 2EFGA 2MBFA 1D8ZA 4QWBA 3Q24A 1YRUA 1U1NA 2E7WA 5DJBA 1I3QJ 4I56A 3P49B 4Q8EA 1V5GA 4I2QB 4DG1B 1ON1A 5D5VB 3OV7A 1EKSA 4KO0A 2I38A 1FRHA 2FJBB 4HZFA 1IVZA 3GYNA 3RBZA 3I4HX 2RS8A 2IA6A 3GSDA 4UUSB 2HFVA 2VJUA 1S48A 2VD3A 4ED8A 3D3BJ 3MCOA 4I6ZA 5CYVA 4KKOB 2HOTA 4AD9A 1UAAA 2UUCF 1NH7A 2QA1A 2QWWA 2ZVSA 3OR1B 4C8MA 2MQPA 2MLYA 5A2QU 4QLCU 2ZKUA 2LD5A 4MQVA 1P9YA 1N5YA 1S49A 3C1DA 2L9RA 3S3OA 2WW4A 4L3KA 2RD5C 2AGPA 1LE8B 5I3QA 3QYFA 2FJXA 2V4JA 2WONB 3GEZA 1RHJB 2VQEF 1FD2A 3R4KA 2L4MA 5D5XB 1J5YA 3I56S 2XY6A 2DAOA 5FDLA 3COAC 4DL4A 4JYAJ 2C2MB 4W97A 2EB7A 2YNGA 4G1QA 1MJ9A 4JI2J 3FCVA 1P9QC 3KHHA 4ZP9A 4EBEA 4NNJA 4OJHA 1U1OA 1MBEA 1EQMA 4Y15A 2DPIA 2KU7A 3MN2A 5ETTA 3CO7C 3PSIA 4OZ3A 1S9GB 1XDUA 4EGYA 4IEJA 4UVCA 1W36C 1RT3A 2OU2A 3PCOB 1WI9A 3S3NA 1UVIA 5B5EC 2RU3A 5I3UA 2IS4A 5KFAA 4RW9B 2O66A 2VJJA 2GFFA 5GADU 3EUHC 1CG2A 1TWGJ 2QRRA 3TO7A 5HROA 2LQJA 2W00A 3HB9A 5DG7A 2NXCA 1OPZA 3TO9A 4Q0BA 3QYYA 4RWWA 3TO8A 2KJWA 5ETPA 3MMAA 4X65F 3MZHA 1WC4A 1CQTA 1AT1B 1X5PA 4DSLA 3IA0A 3RPUD 3OWTA 4RGUA 1N5QA 1ORKA 4BNCA 1OY9A 4ZJOA 5HBMB 3GB0A 3UDLA 5KFPA 3I4PA 3RQ4A 1E0EA 3NNCA 4JV5F 2XI3A 4ZTFA 2VDHA 5EWGA 1FWKA 5D8LB 1S6PB 3R6LB 3MEKA 3BO4A 2V94A 1PP7U 3WHBA 4O3OA 3KJVA 2FGOA 1OYYA 3AFGA 3LAMA 1V5VA 5GAEU 3FZVA 1FJLA 4NHJA 2XKOA 5FDLB 3WG9A 2HVHA 1KYZA 2DGUA 1SJ4P 3V4GA 1DJ0A 4YIRX 1RLDA 4F4XA 4CUGA 5EJCA 4C3HJ 3H36A 4GCVA 1GTEA 4DV4J 1R6VA 1A9NB 4HX4A 3PY8A 5KG3A 5MLCV 3IRQA 5KT7A 1X9WA 4ZITA 1S7OA 1U09A 4JI3J 1TTYA 1G6BA 4A8QA 3J7AY 3VDXA 3V6DA 1QZZA 2YWGA 4UY85 5KFCA 1RABB 1G4CA 2R2UA 1TQMA 3S3MA 1U9NA 3W5ZA 3PJ9A 1H89C 2FU4A 3ENVA 3C16A 2IHR1 1DURA 3SCLE 3SV3A 3NAHA 3VODA 4A8OA 3VVUA 2CV1A 5I3UB 3VPRA 2MHEA 4ZVHA 1TLHB 2HHTA 1P2FA 1B9MA 2DYRH 2H5IB 1TW2A 4K4VA 4L18B 3O3LA 3M32A 2X1FA 1IXCA 1FTCA 4DFKA 1S0NA 2LU2A 4KFBA 3HHLB 5HROB 3SYZA 3M2UA 3F8BA 1W1WE 1GVDA 1FA0A 2R7TA 1KD1T 4UB8C 3H2VE 2XYPB 3MKLA 3CC4S 2QBYA 3S1TA 4XKBA 4WK3A 2W2MP 4M5JA 3OVBA 4HH1A 4LG0A 1Q8KA 3CWJA 3FMWA 2RQPA 2DO7A 2LDUA 4CLSA 2J5OA 3R2CJ 4B3SF 2AEFA 3I0RA 4M71A 2CNLB 2OKQA 4C11A 2V4RA 3L2CA 3RKWA 2XB0X 4KPYA 4BAYA 3KJVB 2OC6A 1VQ4I 2C2ZB 2KG0A 4BUPA 1YI2I 4M95A 3C15A 3JSOA 1S1UA 2FY8A 4IHSA 1RBLA 1UZHA 1N36J 3FKBA 2CU7A 4YY3J 2KIMA 3ISND 5DTDA 2ILYA 2W4SA 1Q4RA 1B72B 4AM3A 3ZMSA 1MNEA 1HHQA 2F3JA 2P2CB 1GMWD 4G65A 1N32J 1QSYA 1BR2A 4E7ZA 4CXFA 1FKPA 3MMCA 1ETYA 3B6AA 3C16B 1YTYA 5LSRA 1IDYA 1Y0UA 5DLGA 5HK4A 3HO1A 2CUJA 1T94A 2VHGA 5KT5A 4PABA 4G12A 5IY5H 4XIUA 2VPZB 2DYAA 2ZXWH<