2DBBA

Crystal structure of ph0061
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
146
Chain Sequence
KLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLGYMYAIVLIKSKVPSDADKVISEISDIEYVKSVEKGVGRYNIIVRLLLPKDIKDAENLISEFLQRIKNAENVEVILISEVRKFEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH0061
rcsb
source organism Pyrococcus horikoshii
molecule tags Transcriptional regulator
molecule keywords Putative HTH-type transcriptional regulator PH0061
total genus 36
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dbbA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dbbA02
4FHTA 3CO7C 1STZA 3M1EA 3K69A 2R7FA 5LGNA 3HSFA 4R1HA 2VT2A 3OOPA 4LMYA 3KEQA 3DPTA 3FX3A 5BPIA 3K0LA 5E1ZB 5BQTA 4OIPF 2ADUA 2QUFA 4G94A 2A6EF 2KRFA 5CVRA 5HDNA 3QAHA 2XIGA 4RAZA 1MJAA 1ZN2A 4HOBA 1YW8A 5D6FA 4IPAA 6PAXA 3T8RA 2RV8A 2PMHA 3DP7A 2ZBKA 5HDKA 1SAXA 3E5XA 2EV5A 3CDHA 4HX8A 1MDMB 2RN7A 2ISZA 2EK5A 4LG0B 4HF2A 4LK0F 3I71A 2XGXA 2HS5A 4M6YA 1W7PD 5E18F 3M8EA 3H92A 5L3DA 1ON1A 3P9IA 3E6DA 4S05A 3GF2A 2IJLA 5AONA 2ZNZA 1HW2A 1HQCA 2BBYA 4BNCA 3VFZA 2JPBA 3AAFA 4HAMA 3HRMA 3QPTA 1ONVA 3JAMZ 1R7JA 4OU0A 4YIFA 1SD4A 2CW0F 4PZJA 4FX0A 1BJAA 4F7ZA 4IRIA 3M8FA 4YFNF 3QP5A 2M45A 4HF0A 4MQVA 5LHIA 3LA7A 2ESHA 5ICFA 4UNOA 4XLPF 4R79A 1SFEA 2KIUA 5CVIA 3V8JA 4ZYEA 1HKSA 2QBYB 1ZRCA 3JSOA 3CO6C 1WRJA 1XCVA 3F6OA 1LDJA 3U1DA 3SQNA 4KNYA 3Q5FA 2STWA 2HQRA 4KIBA 2VBYA 4L9VA 4JBAA 4I0BA 2V9VA 1ZRDA 1EV7A 2E7WA 5DCMA 3I53A 2OZUA 4D0PA 2QQAA 1EH7A 4IRGA 5LEJA 1TQMA 1ZYRF 1UFMA 1FY7A 4OMYA 5ILUA 2K4JA 1BBYA 1GHCA 4QWQA 3W6KB 1Z05A 2WV0A 3EDPA 3ML6A 1BN5A 1KQ8A 4AIJA 2PI0A 4RB2C 3GFIA 3F23A 1GVJA 4HYEA 2L02A 4KT5C 4L9NA 2QQBA 2P7VB 3ZQ7A 3HRUA 3ZN1A 5IT3A 1DPRA 1OR7A 3T8TA 2IP2A 4LJZF 4ENKA 5LRRA 3EYYA 1BIAA 2EB7A 3ECOA 2DT5A 2VE9A 1W5SA 3FMQA 4M9SA 3ABTA 2E7XA 1FZPB 4RGSA 4L0ZB 2A3SA 4U0YA 2LKPA 2XAGA 5L3BA 1O3QA 4GCVA 2FMLA 2FBIA 2VONA 1F9NA 1HSJA 1T0FA 1LDDA 4EJOA 3Q9VA 1CGPA 3GZ6A 2W24A 2Z99A 4ESFA 2QM3A 4RGUA 3V8LA 2EJRA 5HLGA 3IRRA 2DPDA 4BHBA 1GXPA 2BV6A 2OU2A 3QU3A 3L2CA 1IN7A 4AWXB 2QLZA 3CUOA 4DQ2A 1YS7A 5ICGA 2ZXJA 1ZHFA 2HKOA 4OINF 3K1MA 1U8RA 2HGCA 4L18B 2Z9OA 2F5EA 1FP2A 3ZP5A 3K2ZA 1ON2A 1KU2A 1FC3A 1FWZA 5ILVA 3RTRA 2NNNA 2VODA 2K27A 4LK1F 5TRDA 4BHPA 4ZYDA 1FBSA 4K2EA 2D1VA 1REPC 1K78A 1O3RA 1S6LA 3FF5A 2MD5A 3HTSB 2OZ6A 4MTEA 2E1NA 4I01A 2AS5F 2XROA 3GX4X 5HVQC 3ISPA 2QWWA 3MAJA 4ASNA 2DK8A 2XRNA 1UCRA 4WWCA 1IN4A 3ZMZA 3GW2A 4RS8A 4GGGA 5HDGA 4IVNA 4NHJA 4UUVA 1XCBA 4BHCA 3MQ0A 2VBXA 5E8IA 1OPCA 2X4HA 4MGRA 2NRAC 1R1VA 2XV4S 2XKPA 3S2WA 3I59A 5A2QK 2XAFA 3KE2A 4HBLA 3GYHX 1PUEE 2R3SA 3WTYC 2W84A 2X0LA 3I0TA 4MHGA 4S04A 1WWXA 4M71A 3HHGA 1FSEA 1ZGJA 1O7FA 3LFKA 1BIBA 2Y0MA 5AIQA 3G73A 1D8JA 2WC2A 4ESJA 4IHTA 1FSHA 2ZFWA 3JAMK 2XKOA 4I09A 4KMFA 4R8HA 3L9FA 3ZMTA 3M9AA 5TJJA 3O2PE 3COAC 4WXHA 1JGSA 3HRTA 3V7SA 3NQOA 4HLXA 3DFGA 5F64A 1I1SA 3RIRA 2Z4PA 3DEUA 4YIIA 2UWMA 1TQPA 3QP6A 1G4DA 4G7OF 1IXCA 4KN4X 4EQQA 4MEXF 1H9GA 4CICA 3I58A 1Z7UA 4HQEA 2VXZA 1ZARA 3FXQA 1HW5A 3C18A 1I1GA 3DKWA 1P4AA 1J75A 2HDCA 1KQ9A 4H0EA 5FO5A 2PJPA 1TW3A 4UV9A 2HWVA 1BOAA 4YFXF 3GXOA 4OIOF 3RPQA 1H9TA 5DDGA 1XSXA 2ZO4A 3WG9A 4MTDA 4ZH4F 1IRFA 4G9YA 1PP8F 5FLXZ 2RC4A 2HYFA 3NRVA 1PDNC 2P6SA 3BY6A 3WTSC 2ZJ2A 1F1ZA 3ZMUA 5IT9K 1G3WA 2XAJA 4U0WA 1QPMA 2W57A 1UHWA 1S29A 2GA1A 3RPUA 4ENJA 2BE5F 2M30A 2FNPA 1IN5A 2QQ9A 1FYKA 4JQFA 5KVRA 1ZH5A 2EV0A 3OV8A 3KP4A 1ZG1A 2HZTA 4CHUA 3ECHA 2P5LC 4M72A 1SMYF 1YFHA 1R5GA 1ZAOA 1IN6A 2QZ8A 3I54A 3T0YA 3KP5A 4CDGA 1Z91A 2DK5A 2FQ3A 3RI4A 4O5VA 3L09A 4Y17A 2GAUA 2DFIA 3ZMVA 2UZKA 4A6DA 2ESNA 3R6SA 3JTHA 4BH9A 3M7GA 5K5RA 3F72A 3E6MA 1H0MA 1W4MA 2VBWA 1VTNC 1QQIA 5EEGA 3TO6A 1Z9CA 2EFPA 1D5VA 1DDNA 3MFKA 4CXFA 3TDUC 5CVUA 3WODF 3HSRA 5H6QA 3KCCA 3B73A 3J81K 3IRQA 4AVPA 1B1BA 4U7BA 1U5TC 3LAJA 4A0XA 2JRTA 5CVJA 3T1BA 2GA2A 2VT3A 2FOKA 2O8XA 5JR3A 2PN6A 2EFOA 3BROA 4I02A 2QENA 1HKTA 2LNBA 3KFWX 1R22A 3LA3A 1W5TA 3WTZA 4A0YA 3CUQB 4GXOA 2DAOA 1I6XA 4KN7X 2XASA 5LEKA 4HV5A 4EM0B 2ZBCA 3PQJA 4P5OA 1B9NA 2Q8KA 4PGGA 1O57A 2EFNA 2TDXA 3FWEA 3T5XA 1DPUA 1Z1DA 2NAZA 2IA0A 5DEQA 2JTVA 3CUQC 1BI0A 4OIQF 3WTXC 3KZYA 2P8TA 3EQLF 4EJWA 2CQKA 4IJAA 1P2FA 3I64A 3BP8A 1SMTA 5J8CA 4UV8A 2GXGA 1D8KA 1QZZA 1YQAA 1J59A 3J80Z 1OYIA 2Y75A 5D5XB 1CF7A 4A0ZA 2F2EA 4P96A 2DW4A 5LHHA 3L00A 3JW4A 3O6BB 2W85A 1K7AA 4ENNA 3IWZA 3QRFF 3LAPA 2A68F 1U3EM 1T2KA 2RDPA 2OD5A 4BQAA 2NYXA 5F6FA 5LGUA 3K9TA 5ICCA 2P5VA 3F22A 4KA4A 5ERIA 2DQLA 2F5DA 1IRGA 2XAQA 4HQMA 3MZYA 3H3UA 4IXAA 3WTWC 3ABUA 4WXCA 1IW7F 5CVVA 1T39A 4RB1A 2B0LA 2KIFA 1QBJA 3V4GA 1C0WA 4XLNF 2FXAA 2H94A 3E5QA 3G3ZA 1W7PA 3F3XA 3F8BA 2A6HF 3MCZA 1J0RA 3ULQB 2P6TA 2WTEA 5K1YA 3HTUA 5DD8A 3BDDA 1TLHB 1V4RA 3WGGA 4GYIA 5L3FA 2ETHA 3Q9SA 1Y0UA 2J5OA 2VOOA 2LSOA 2P7CB 3WU1B 5BOXA 4WX9A 4O3MA 3HRSA 3RKXA 3WTVC 4I7HA 2V1UA 1ZG3A 1QNTA 1OMIA 1IXRC 3MWMA 1LQ1A 1KGSA 2H6BA 1RUNA 5FFXA 4KMUX 4ON0A 2VN2A 5LHGA 4RAYA 1XD7A 4WF2A 4Q4ZF 1SFUA 1HBXG 4CGZA 5FLXK 3KP2A 1BC8C 2QYOA 2CYYA 1ULYA 4G7HF 2HKXA 2OBPA 2Z5UA 4IRHA 3H3ZA 4L0YB 2BEOA 2EA4A 3I59B 1T6SA 4JK1X 1J7KA 4XSXF 3C3WA 4B8XA 4EJTA 2RVCA 4I98B 4BYYA 1RNLA 1XMKA 1A04A 3IC7A 3KEOA 3R61A 1QZYA 1LB2A 5HLHA 2O03A 2O0YA 3KP3A 4PGHA 4EGZA 4EVIA 4HX4A 4A6EA 2HYGD 2STTA 2CVIA 4N0BA 4RB0A 4Y13A 2RNJA 3IHUA 4KFCA 5A2QZ 4LB5A 2ZNYA 3HOSA 1Q1HA 1EH6A 1KU7A 1YS6A 3FZVA 1U5TA 4CYDA 3TO9A 1ZGAA 4CZZA 4LD5A 1I5ZA 4IF4A 3E6BA 2RGVA 4Y15A 1X3UA 3V8KA 3WU0A 3R0AA 2DO7A 2MLKA 1JXSA 4MEYF 3BWGA 3WGHA 3KETA 3R60A 1HSTA 1V3FA 3SHFA 2PEXA 2GXBA 1IZ1A 2FF4A 3FMRA 5EEHA 1YTYA 4A12A 5FB2A 1ZLKA 1RI7A 2PG4A 2DPUA 2DBBA 3LQQA 1HKQA 1LNWA 2IVMA 3FM5A 1P6RA 1P92A 5D8KB 2A69F 4KYWA 4M9XA 3RYRA 5L3EA 2OQRA 1GXQA 3JTGA 3BPXA 4HLYA 2JPCA 3JSPA 3TOBA 5DUKA 1D3YA 1IN8A 3IL2A 2CG4A 3E5UA 3I4PA 4AD9A 4N9HA 2AXLA 5J8FA 1XGSA 2FA5A 2NS0A 2W25A 2L4AA 3F8MA 4OMZA 2IA1A 1IAWA 3FM3A 4MNUA 1R23A 3GLXA 1AWCA 5E17F 5IT9Z 1HXDA 1KA8A 3K1NA 4P55A 3VOEA 4OIRF 3EETA 5L3CA 1XN7A 1UHMA 3DPLC 3E6CC 3C1DA 4G8XA 4ETSA 4P9FA 5K5QA 3LA2A 2P5KA 1B9MA 5HLIA 4HZFA 1XSDA 3QOPA 1RZ4A 4LB6B 2H09A 2Q2EA 3WTTC 4Z2YA 3F21A 1XDSA 1XMAA 2H6CA 1KQ0A 4WCGA 4GO1A 1BI3A 4OOIA 4ZYGA 2R7DA 2H27A 1UB9A 3W6JB 2ACJA 4ESBA 5D4RA 2D2WA 2MBFA 2J5PA 1OYYA 3IWFA 1R1UA 4UVAA 3TGNA 3KP6A 2CGPA 4EJVA 2FMYA 5DCMB 3V7CA 3GFLA 2UXNA 3TKYA 2BGCA 2Z3YA 1U5TB 2HEOA 2YSRA 3QU6A 3RYPA 1S8NA 3LWFA 1MJ9A 2GIVA 3GFJA 4EV0A 2PLYA 2KJBA 4WXDA 5L3GA 2G7UA 3K1PA 4U0VA 5LGTA 5HS8A 3U2RA 3R0JA 3C7JA 2WWYA 2DJWA 1EH8A 1MGTA 2ZCWA 5FFZA 3P9KA 3VB2A 4IHSA 2OQGA 1O3SA 1BI1A 5LBQA 1ZREA 4EGYA 4U7DA 1LEAA 1YG2A 3L7WA 2K86A 1WSUA 1Z6RA 2XHKA 3B02A 5DYMA 1G3YA 1ODDA 2V1DA 3NEUA 5D4SA 5H20A 5HOOA 2PBIA 1SD7A 4LFUA 3J7AO 2MLGA 4LLGF 3CLOA 5LRSA 2FE3A 5ICEA 2PMUA 2GZWA 3REOA 3TDZC 3BPVA 5FD5A 2FBKA 5CLSA 3GFMA 3O3KA 3CUQA 4AIHA 4UHTA 2Y48A 3TO7A 4L5IA 5BPDA 2DLLA 4E70A 3P7NA 2FNAA 2HTJA 2PQ8A 1MD0A 4B09A 4EMSA 1IF1A 4FT8A 1FPQA 3KZZA 3RKYA 1PP7U 3HUGA 5D5VB 2F5CA 3SFZA 1K6OA 3SZPA 2JSCA 2L3DA 3DXJF 3F6VA 5ED4A 4Q47A 3D0SA 3F8CA 1FBQA 4PDKA 1S7OA 2HOEA 4CO8A 1R00A 1RIOH 1XSVA 1R58A 1IXSB 1NHAA 2QBYA 4UVCA 1L0OC 3D5LA 3WTUC 1ZRFA 3VEPA 1YLFA 3ZMDA 2MH2A 4ZZDA 3DV8A 4LLLA 2KJCA 1RUOA 4UXNA 2V79A 3BJ6A 1YW9A 4M9ZA 2YR2A 1TNTA 4ZZLA 5FD6A 4KICA 1P4XA 4HX7A 2K02A 3J81Z 3FMSA 2EWNA 2EA2A 4L9TA 2EV6A 1DP7P 2IRFG 2IA2A 1S7AA 2E1AA 3HIFA 3RKWA 3GUDA 5E8GA 3FXRA 5DD4A 1J9IA 3DQVC 2OAZA 2EFWA 4O6JA 1WI9A 1Z6TA 3FHZA 1MJBA 2ZMEB 1FP1D 1ZLJA 2CO5A 5E1XA 1QGPA 2JZYA 2KIMA 2M8EA 1F4KA 1OKRA 2C6YA 3QPHA 4MQ9F 1CF7B 3IKTA 2E1CA 2G9WA 1FYMA 4M73A 2JSXA 1MZBA 4HDVA 3GZ5A 2A5YB 3KP7A 2GWRA 2VC1A 4KDPA 2KKOA 3RJPA 5HS9A 5DV5A 1MDMA 4RGRA 3PFIA 4RGXA 5BMZA 3CJNA 2HR3A 2L01A 2F5FA 1YO5C 2LF8A 2BYVE 2P4WA 1JHFA 1J5YA 2LDUA 4ENMA 4PCQA 3ERED 1BI2A 1I27A 2YU3A 3MZHA 4LLNA 4I2OA 2YX7A 2D1HA 1B59A 4U88A 3LSTA 1SD6A 2A61A 1XDUA 2ZKZA 2FSWA 1JE8A 1TBXA 3HOTA 1G6NA 2V1XA 4RB3C 4KIGA 3HHHA 1OYWA 1XGMA 3MEXA 1TTYA 3P9CA 1USSA 1E2XA 1FX7A 3GO5A 3F8NA 3ZN0A 2VE8A 1LVAA 2FU4A 1FYLA 5FGMA 1R5HA 4FX4A 1F5TA 2G7HA 3RDIA 1J2XA 2ELHA 1JHHA 5CYVA 3U9GA 4G6QA 2CSOA 4Q48A 4P9UA 5AIPA 1B4AA 1FNNA 1U6GA 3I5UA 3ELKA 3TQNA 4XRFA 1FOKA 2M1BA 4LG0A 4NQWA 4HV6A 3PQKA 4BXUA 1SFXA 2O6GE 4HDUA 3EYIA 2IT0A 5E20A 1W7PB 3TOAA 1IUYA 1T98A 1YIOA 5KK1A 4KIFA 1B6AA 2RKHA 5JHUA 2MC3A 3HSEA 2Q0OA 2DQRA 1YYVA 1KYZA 2CWEA 4DNCA 3GEZA 2FBHA 3WE2A 3BZ6A 4YG2F 1AOYA 4M6XA 2D45A 4LGWA 2K7LA 5LLQA 2XVCA 4I0AA 1TNSA 4M74A 4QLCU 1T38A 4WK8F 1XGOA 3N97A 3N4MA 1K78B 1O3TA 4XBFA 4UVBA 2COMA 4HW0A 4EM1A 4AIKA 1WQ2A 5DUIA 3ZMSA 2VC0A 2QVOA 4L5JA 4A2UA 1P4WA 4KUMA 3GWZA 4HA8A 2NNYA 5J6XA 1KU9A 1KU3A 1MKMA 2MH9A 5ILSA 2PFBA 5D6EA 1U78A 1LJ9A 3ZPLA 1LEBA 4NB5A 5K5OA 1XB4A 2A07F 4L9JA 4G7ZF 2VOPA 2V6CA 1KYWA 3EUHA 3KLOA 1G3TA 2K4BA 4XSZF 2HQNA 1USTA 5HS7A 1R1TA 1O7LA 5JI6A 4N9IA 3R4KA 5JVTA 2HTSA 4ZYHA 2FEZA 1L3LA 3F8FA 3E3VA 3BOQA 3J80K 3BJAA 1FBUA 4A5MA 2CFXA 3GVAA 1DUXC 1ZG5A 4BAYA 1XGNA 3CTAA 1E17A 2FRHA 4YFKF 2IPQX 3BJOA 1R36A 3ROUA 2DTRA 2JT1A 1QO0D 2RQPA 5E1WA 2L54A 3WGIA 2DI3A 5H6RA 3SXYA 3V7RA 5D5UB 3KLNA 4GYGA 1LDKB 1FT9A 4Q5SF 1TW2A 1K79A 4A5NA 2GQQA 3VODA 2YX4A 2M5WA 2O3FA 2DU9A 3FXUA 5DCFA 3HYIA 1U2WA 2M87A 5CJ9A 3SZTA 1SD5A 3E97A 1WKMA 4G6DA 2UXXA 2L4MA 2EFQA 2XUBA 2HFHA 1G3SA 5D8LB 2YPRA 3DF8A 2Z33A 2O61A 3IKVA 3LQRA 2IW5A 1BM9A 4EJUA 2LF7A 2ZMEA 5JFRA 2VBZA 4EM2A 2ISYA 2XAHA 1HW1A 5D5WB 5BS6A 1BC7C 1YW7A 2MA3A 4TV7A 1TQIA 1S3JA 4HF1A 1FLIA 2OA4A 5F1RA 3WE3A
chains in the Genus database with same CATH superfamily
2M0GB 4XOTA 3GCMA 3FGVA 3CO7C 3WX4A 3K69A 2DHGA 3PACA 1U1PA 1W36C 3B4MA 1V6HA 3N79A 3EE3A 4IOBA 4YMEA 2MLZA 4R1HA 5HI7A 3PRBA 3KEQA 2GVZB 3ZZOA 3I55I 2OD4A 5BPIA 4LF6J 9RUBA 1KLMA 1VQPI 3SSSA 3BTJA 3TEGA 4OIPF 2DTZA 5AE1A 3A4CA 3SIPB 4MK8A 1TK8A 5AXMA 2PFFB 2HGMA 4C11B 4KR0B 2J0SD 4IOCQ 2AX0A 1YX2A 4I1TA 2GAGC 4RAZA 4HOBA 4IPAA 5CYMB 1JLEA 1LW2B 2RV8A 2JUCA 2DO0A 2QA4G 2IM0A 5HDKA 4AL7A 1HARA 1QJHA 3QGPA 5GAHU 4ED3A 1DURA 3CCLS 3CIMA 2V8VA 4XN0A 2IDEA 3PW0A 3H2VE 2DOEA 1LPQA 1BMQB 3A4TA 1MDMB 4V19K 1V5FA 1S1WB 4YY3F 2IBDA 4AYBA 2LH9A 3Q8UA 2J9DA 1SI9A 3I4MJ 1MIJA 2HS3A 2I0XA 1E6YA 4NNJA 2ZHAA 4XMYA 3ENVA 3NRBA 1GQEA 2YS9A 4FF2A 4QYRA 2IPOB 3QLHB 5E18F 3SCJE 4K7QA 3DCFA 3TP3A 4V19X 1ON1A 2AGOA 2MYSA 4S05A 2J8AA 3DOKB 1DU0A 3FRZA 3RB6A 1VBYA 4UY8T 1QVGR 3B6AA 5AONA 2ZNZA 3KDNA 5ETKA 2BY1A 2IS2A 3CCVS 1PAUB 3IG1A 2F48A 4HAMA 3R97A 3M30B 2FZKB 2HIYA 4TKTA 2R5ZA 4YB6A 1RT3A 5K8PA 5ETVA 3ENQA 4DSEA 5LSLA 2KJVA 1UVIA 4F7ZA 2XNRA 4IRIA 2VH7A 2QA1A 5TISC 4D9JA 2PFDA 3OT9A 3KMSA 3FDYA 2M45A 1HBNB 1KONA 4JI6F 4F2SA 2PGCA 1IXKA 1YJ9I 5ICFA 2FC8A 4LITA 1WD6A 3NLCA 3OQ2A 3TYTA 1MNEA 1UFLA 2E36A 2FJAB 4RMNA 5C3EJ 1HKSA 4FYXB 3OSGA 3HB9A 1POGA 2V8PA 2GO9A 2QBYB 1Z1ZA 3K70C 1ZRCA 1VK3A 3THPA 2VQEF 1T0TV 4KV8A 1TL8A 3PO5A 2ZHBA 1LDJA 3U1DA 4OZ3A 2DMPA 3MKYB 1TAUA 2LG4A 3DU5A 3G2BA 3TQEA 3DKYA 4KIBA 3PR5B 1YBAA 4WE1B 3GBGA 4X65J 1JUPA 1EV7A 2IAIA 4C3IJ 2E7WA 1D5YA 3GIJA 1T9YA 2FPHX 2OZUA 4D0PA 2PMZD 2QQAA 2XNQA 4ZVOB 4QIGA 1EH7A 2KIQA 2Y0SN 1PYVA 4IRGA 1S6QA 3A0HC 4A46A 2RQQA 1ZYRF 1FY7A 4ITVA 5ILUA 1NK5A 2K4JA 1NK0A 4OAYA 3ML6A 4C2MA 2O5DA 3X2QH 1RAFB 1C0TA 4A3MJ 5EHHA 2L02A 1U25A 4ZCMA 3F9KA 4KT5C 1IGNA 2QL9B 4L9NA 2WADA 3KJFB 1ZPWX 3K5NA 2UUAF 2HHXA 2O5RA 1N5YB 3ZQ7A 3HRUA 4K4WA 2Y2ZA 3N0VA 3AFHA 2B0GA 5J47A 4QIEA 4QIVA 3V4IA 1VIOA 4LBHA 4FF3A 3LP1A 3I0SA 4O3RA 1QAYA 4NWBA 4O3QA 1UVMA 2IP2A 5E7OB 4DQIA 3MPYA 4IKAA 3EICA 3DHXA 3CO9A 2DT5A 4CO5A 1HR0J 3Q8PB 4NLXA 1YZ6A 4Y2IA 1TZLA 5C25B 3M2UB 4K59A 3ABTA 2J76E 2KYZA 1NO8A 2ZH6A 2HOAA 4L72B 4L0ZB 4M8LA 1WTFA 2ZUGA 1U2CA 1SC4B 2VL8A 2ATLA 1Z7LA 4FCYA 1RTIA 2K9QA 3BTCA 3L2RA 2XB2D 5E3QA 2BVMA 4J9VA 1T0FA 1TK0A 1BWVA 2JC1A 4EJOA 3DLJA 3NCPA 4CT9A 3Q9VA 1CGPA 2ZDOA 3BYPA 2Z99A 1FO1A 1EJ9A 1WELA 2ZE2A 2EJRA 3IRRA 2DPDA 1GXPA 2OU2A 1JNRB 5C42B 3PX4A 3L2CA 1IN7A 3CUOA 4OYMA 5ICGA 1LWEA 2IEKA 5E5NA 1ZHFA 1NXIA 2CUYA 2NVUB 4RW6B 5A8RB 4DV6F 1WC6A 3TA1A 2UV8A 4S0MA 5CXTA 3T41A 2HGCA 2FOWA 4YQWA 2XHWA 2A05A 3MI7X 2VZ9A 3ZP5A 1VQMS 1FC3A 3N5FA 1SVDA 1YWXA 5KFVA 1BQMB 2MQLA 1TFYA 3SJMA 4BKXA 3O5TB 2H51B 2BMBA 2HBZB 1FBSA 4ZVRB 2EBGA 4OHZA 2ZJQQ 1N32J 1J09A 3G1OA 1UA1A 1S6LA 2CUZA 1WEXA 1RBAA 3KLEA 2MD5A 4NE9C 2DGOA 1AZSA 4MTEA 1U0HB 2L7ZA 2XROA 2QC3A 3GX4X 2OP5A 1B64A 2G13A 3ISPA 1MSEC 2QWWA 3DDNA 4J90A 1UTAA 4ASNA 4OV6A 5CD4H 3ZQGA 3OYLA 1C0UB 2VQGA 2CVEA 2MY8A 5D0GA 1IN4A 1SV5B 4X4SA 2V2KA 5J2MB 4YR0A 1A6LA 3OYGA 3D3BJ 1U7LA 4NHJA 4U95A 3CCQI 1RQ0A 1XCBA 2YWKA 4BHCA 2P2CB 2HFZA 5DQHA 2ZC2A 4CO0A 4N56A 1XMQJ 3HOWJ 1UJ4A 1AXQA 5E8IA 1Y39A 2RB7A 3MMJA 4QZVB 3I5CA 1MROA 2JMWA 3UPFA 5HLFB 3MMBB 3W3CA 3KE2A 4W90B 2EEYA 1PUEE 2R3SA 5FLXU 3J81U 4M5MA 2D3O1 1FFGB 4C97A 5CZXA 2X0LA 4MHGA 3M2UA 3J7ZI 3D7SB 4JB8B 1APLC 2QGUA 1K6YA 1BIBA 1UVNA 1SXLA 2AEFA 2FYXA 4UUTA 2ALYB 3JAMK 2RJZA 2KHMA 4R8HA 1UWBB 3CCTA 2KRBA 3W64A 3JRCA 4NX9A 3ZO7A 4A48A 1S9GA 4USHA 3V7SA 4U87A 2JVRA 1IWAA 4M5KA 1Y00A 4ZDOA 2X6WA 3DFGA 3G2XA 5KFBA 1OO0B 3M8QB 3RIRA 4FASD 3AA8A 3CC2S 4RW6A 2UWMA 3I4HX 1D0XA 2BOPA 2GLOA 1IXCA 4KN4X 3KLHA 1SFKA 2V68A 3VSKA 4MEXF 1VIXA 1OPZA 3JRBA 2HVRA 3DLEB 2VLAA 5H9FK 2H8RA 2LBFB 3R7SB 1N5TA 4CLLA 1YRNA 2QQ8A 4CP5A 1YHQS 2Q6BA 1NKCA 1YJVA 1T3NA 1U1NA 3CDWA 1HI0P 1WG4A 1JKPC 4C8LA 3THVA 1J75A 2VPLA 4J9UE 1U02A 4CH7A 2HWVA 4YFXF 2FZGB 1QUPA 4OIOF 4ZVUB 1TUVA 4KT6A 1IKVB 2WBRA 2NXNA 3WG9A 3L2VA 5FRMA 1OQ6A 2V6AA 4TYBA 4AFFA 5FLXZ 1S1VA 4C8KA 2IS6A 1P7JA 5ETQA 2P6SA 1F1ZA 3CCQS 2I5JB 2B63J 1EF4A 5LJ5Y 2XAJA 3DWLE 1YJUA 4ZPAA 2VV5A 1MBJA 5E3AA 5D3GB 2H9ZA 2AV5A 4XTTA 2NCKL 3I56I 2ZZTA 1FEHA 2ROPA 2CZ4A 4BS2A 4Y00A 3QPLA 4OJHA 3OYMA 2W48A 2J8SA 2HNDA 4JQFA 2W4SA 1TWGJ 1I51B 2FHOB 1C0TB 4DX6A 5JVHQ 3OV8A 1ZG1A 2B6AA 4EYIB 1VQ4S 2N3LA 2ZKTA 2W1BA 5K7HA 3A03A 2P5LC 1KP6A 4B08A 5GAGU 2R7TA 1O6XA 3IH4A 2AMCB 2KJWA 1ZAOA 2DCLA 5I42A 1HNXF 3KP5A 3FUYA 4CDGA 1OCZH 2VG5A 4O5VA 3ZMVA 2GHVC 3JTHA 1NEEA 2HU9A 1UEVA 4M95A 3M7GA 5K5RA 1X9MA 4IHXA 1HOMA 3AAWB 1I3OB 1L3VA 2DJNA 2VBWA 9ATCB 1QQIA 5EEGA 3TO6A 1Z9CA 3DLGB 4IRDA 2KRRA 1PO6A 2CQNA 1FDAA 5GTIC 4CXFA 3TDUC 2C3UA 1ZAXA 2DHHA 3WODF 1RTHA 1J5OB 3KCCA 1U0JA 4E7KA 4I68A 1RE1B 2ZH5A 3WBZA 3LAJA 3ILIA 1H88C 4NLSA 1CVJA 4A0XA 2JRTA 3H5XA 3J80U 5CVJA 2OPPA 2FGOA 2FOKA 4PG8A 4ZMMA 2DISA 4AXIA 1FT8A 2MQPA 4E7HA 1XS9A 5C24B 3POTA 2VPZB 5AXLA 3SCIE 4XPCA 1IKXA 4QW9A 2DNRA 2CKWA 2OGUA 3CUQB 5KFUA 3LW5C 4QPXA 2ZOFA 4GXOA 4CLFA 5K20B 2DHXA 4MKAA 2C2RA 2CS3A 3QO9B 4ELVA 4A3DJ 4EM0B 4H4MB 5I3QA 2MGZB 2QN6B 1DY3A 3K0JA 4OI0A 2U2FA 3LP0B 5B0FA 4P5OA 4BS9A 4Y2CA 5DGBA 4ZLPA 2IVYA 2VKEA 2TDXA 4LVNP 5IM0A 4A3IJ 2DXDA 1S1VB 3PHTA 2CPZA 5E0OA 4JI8J 2NAZA 3A01B 1VI7A 5B0DA 4JI2J 1TL7B 4TQRA 2JA7J 4OIQF 3D5SC 5J40A 3M6WA 2HPUA 2DRBA 1P2FA 2C3OA 2FJBB 1V3SA 2R5YB 2OPQA 5DG9A 1KKHA 2GXGA 2MZJA 1J59A 3J80Z 3WIVA 3HZEA 3SQOP 2W9AA 1CF7A 3BJYA 5D0EA 2HBQB 2XO6A 2HLTA 1ZM3A 2YNFB 1D0YA 5SUHA 4ED5A 2N3OA 4DDFA 4NCAA 2I38A 4ENNA 4LF8F 1XX5A 1R27B 4DL0C 4RW4B 1T2KA 1WHYA 2BANB 2RDPA 4OI3A 4IRKA 3BDPA 1X4BA 2UUWA 1RHMB 2NYXA 2JHEA 2XGEA 3BR1A 3K9TA 2ELJA 2K1RB 3OL6A 1L3KA 3H7HB 3OMYA 4LRAA 2WAEA 1IRGA 4LUBA 3EPGA 1E6VA 3OXLA 2D3UA 1PGZA 9ANTA 1JLAA 1HBUB 2JA5J 1W1WE 1HCRA 3DOLA 4DV3F 3T1YJ 1FF2A 3MR2A 3W2WA 1ETYA 3NG8A 1RT6A 5FKKA 1FWKA 4AQYJ 3LP2A 3CCUS 1F5CA 3OFFA 4YIRX 5CVVA 3CEDA 4RB1A 3C16A 2GNKA 1QBJA 4F3MA 1U4BA 1CULB 1RRJA 2ZKUA 2DNOA 2HURA 4XLNF 4EFAC 1ZOTA 2RREA 3H25A 2CJAA 1W7PA 1RA6A 3F3XA 1VQ6S 3SDGA 4MIAA 1ETXA 3ZGKA 5KCMA 2WTEA 1W5CC 2MSSA 3FC9A 4A8FA 2V26A 2HBYB 1HL6A 4GYIA 3TVYA 2YQ0A 2ETHA 3MM6A 3Q9SA 3TR5A 3PFOA 3BC8A 4KRWA 2A2CA 3WU1B 3M8JA 5F8HA 5A0YB 4JI3F 2ME0A 1E3OC 2AU0A 1WG1A 1HBNA 3RRGA 4BGDA 3KUHA 3BSAA 3KK1A 2V1UA 1MWQA 3RRKA 4LIVA 1QNTA 4M3DA 3HBLA 1IQZA 3HP6A 1IXRC 3HOYJ 1WVRA 2GVZA 1KGSA 3AB4B 1TKZB 4TLQA 1XIQA 1CJTA 2B3TB 4ON0A 2HFOA 5D78A 3CCLI 2VN2A 3QBCA 3MUMP 1JGGA 1N33J 2UVVA 3FNNA 4MKVA 2OEMA 4WF2A 3LH2S 2Z2MA 2YNFA 5M5YJ 5KG1A 1BC8C 4K4UA 2ROEA 3KK2A 5DQIA 1U2FA 2DD8S 3CCRS 2XAUA 2ZFHA 4IRHA 4XDDA 1SJRA 3ZZTA 2KZMA 3MCOA 2WRMA 4XRSA 4KISA 2XZDB 3ZTSA 5AJ3J 1HNWJ 5ETRA 3I59B 2GS8A 1J7KA 2XPUA 2ZITA 4B8XA 2OTJS 2NZ4A 4D7MA 4I98B 1REVA 1NJWA 3MECB 1A04A 3CCEI 4LF9F 5HROA 3IC7A 3KEOA 3DYAA 1X60A 1QZYA 1T95A 1VQ9I 2BA9A 5EZGA 4K50A 4EVIA 2CVIA 4RB0A 2R3VA 4CLKA 3ZZPA 4KFCA 4CTAB 3TQ1A 1F3FA 4LJMA 4A8WA 1VRUA 2Y1RI 4A3CJ 1K44A 1S1WA 1OQ3A 4JYAJ 3PO2J 4YDDB 4CZZA 4HG2A 1U48A 1I5ZA 3JSYA 3SFIA 1Y6IA 3RAXA 1KQGB 3G6ES 2MLYA 1NK6A 2EC0A 1YSJA 1X3UA 3W66A 3TJ9A 1B0PA 2DIUA 4M3BA 1DTTA 4RNOA 4RAFA 1JXSA 2QEXS 3W61A 1K1SA 3R60A 1V3FA 3CDAA 3OTEA 3R5BA 4LOCA 1TWHJ 1R8HA 2FF4A 4V2FA 1OS5A 1HBUA 1JLAB 1S7HA 1BQMA 1UWAA 1YTYA 4U8VA 4A12A 3RUBL 5FB2A 1HKQA 1B8IB 5A0YA 3FM5A 4NYOA 2NS8A 2E5GA 1P6RA 1RAEB 2PC6A 2R7UA 5E41A 4M9XA 3RYRA 2BRKA 2EKNA 1N34F 3R27A 3JTGA 1QE1A 3BPXA 4N4NB 2UXBF 2WHOA 4JI4J 4HLYA 2FHKA 2G9OA 3JSPA 4U9RA 2OLWA 5F3TA 3G82A 5B08A 3IGVA 5IY5H 4HL9A 4N9HA 3CCJI 2Q3PA 4QYZJ 1XGSA 2W25A 2EWHA 4ZITA 3ZC4A 2V4JB 1IAWA 4MNUA 2HVSA 4NLOA 5E17F 3G1MA 4ELUA 2EBEA 5IT9Z 1QM9A 1NDLA 3BQ2A 2GV1A 3F0CA 3IRXB 5L38A 4OX7A 4XNFA 3K1NA 1A5JA 3VOEA 3I31A 4OIRF 2V5HG 2CH0A 1XN7A 3IS9B 2L0KA 4ID5A 4KY3A 2HAIA 2KP6A 2DNQA 3AXKA 1U9OA 1WF1A 3MR6A 3DLLQ 3C1DA 4LFAJ 3CCRI 2ZD1A 3RQ4A 5K5QA 4TY8A 4J91A 4B3MJ 3Q2TC 1B9MA 3IN5A 1WEYA 4UUSB 1XSDA 4HZFA 2Y1LB 3QOPA 3CT9A 3RB0A 2H09A 4PQUA 3WTTC 1PC4A 4RW9A 2F4MB 3FXJA 2LD5A 1IV8A 1KQ0A 1UVKA 1GV5A 4E7IA 1SVOA 2R2RA 2R7DA 1QU3A 2QGFB 4IO1A 3IR7B 2X7IA 4HPQA 2LDYA 1JKQC 4XONA 1RT7A 3DLAA 3R5JB 1OYYA 2K40A 1W2IA 5L1KA 3IWFA 5I3UB 3A13A 2V2VA 4B3SJ 1WUUA 4UVAA 3TGNA 3GG1A 1JTXA 3FXLA 3KMQA 2HVZA 3V7CA 1DAXA 1FESA 2QG9B 2Z3YA 2X1GA 4PJLA 4DF8A 2MQOA 1X3ZB 2YSRA 3RYPA 1SBRA 1S8NA 5DGAA 2BXYA 1R0BG 4EV0A 3PDNA 2W4PA 1KVJA 3U2RA 3R0JA 3RRHA 2X1BA 2E29A 1R8AA 4JI7J 2DJWA 2DA1A 2ZCWA 1SPBP 2QYGA 2VUMJ 2YPYA 3TANA 4CO3A 2VQHA 5FFZA 2RSQA 4PWDB 1TP4A 4IHSA 1XMOJ 2B7BB 3K5MA 2JA6J 1F60B 3HXMA 2M4MA 3W2WB 4FS2A 4LFBF 3LUYA 4IG3A 3IP0A 2DDAA 1BI1A 3TVZA 4EGYA 2ZXHA 3BG5A 4DR2F 1WSUA 3D6TB 2J6SA 4BE1A 1G3YA 4P74A 2G4BA 3NEUA 5J1NA 4NUBA 2FVRA 3UVJB 3KX2A 1AKHB 3QT6A 1SD7A 4LFUA 5J3LA 3J7AY 1ZZFA 2MLGA 1PJ7A 1HNZJ 2CV2A 3ZQIA 5J1EB 2A6OA 2GZWA 3REOA 3FBCA 3HPOA 5FD5A 1S0NA 1F36A 4DZ6A 4NZ6A 3O3KA 3J7YJ 4UHTA 3ERMA 3TO7A 1RAIB 4L5IA 1FJGJ 3HK2A 2AQFA 1IBLJ 1I6HJ 4BXFA 1DP3A 3ICLA 4DGWB 3RW7A 4B9NA 2CZ9A 2DA7A 2DNPA 3SMZA 4LF4J 4V1Ak 3P49B 4JOMA 1GV2A 5D5VB 3SFZA 4KHMA 1X4DA 1LWXA 1HA8A 3A0BC 2FLOA 1NUEA 2BY2A 4DV2J 2V4RA 4JI1F 2M0CA 2IA6A 4NCGA 5J2QA 2ZJRQ 4F4ZA 1HQ2A 3CCZA 4FXWA 1FBQA 4URSA 3QWUA 2MQQA 1S7OA 3UNGC 2F8EX 2KN4A 4QPQA 4C0HA 3GONA 1U9NA 2M0MA 1VMBA 1XSVA 4HRIA 3HJVA 1U1OA 3MTJA 1PUFB 2BE2B 2U1AA 1RPWA 4GDFA 3W9JA 1X8DA 5CCMA 1YLFA 3ZMDA 1CJVA 2MH2A 4ZDNA 4ZZDA 2KJCA 2D1CA 4FE4A 4I2QB 4ZKAA 1YW9A 3VDXA 3I5AA 1RWUA 5IP6A 5J1EA 5KFKA 2C3YA 4KICA 2J7WA 3FMSA 4IFVB 2HBRB 2R7RA 2ERRA 4A3LJ 2EA2A 5HLFA 1PSDA 2KISA 2IA2A 1KNZA 1R6VA 5F0CA 1HMVB 2E1AA 4NXMF 3HIFA 3GUDA 5E8GA 3FXRA 1OMSA 2XMVA 3GSIA 2MKJA 3DQVC 1LUJB 2OAZA 1HLVA 4DPOA 2EFWA 3Q22A 3BBBA 1JMTA 5IV4A 4DS4A 2HMIB 2ASYA 2CPFA 2YKMA 1ZS6A 2DA4A 4A3GJ 3UN2A 1A31A 2GW8A 1J5EF 3E1SA 1N5VA 2JRMA 1YBUA 2HKEA 2JZYA 1F4KA 1XBWA 4FYDA 3T1AA 5HN0A 4M63A 3IKTA 3MCMA 4DFPA 4M73A 2C22A 1MZBA 1RHKB 4HDVA 1ENHA 5KFMA 2VC1A 4KDPA 1S99A 2V63A 4BC7A 2RAQA 5J2QB 1MDMA 3H9QA 1SAUA 4ZP6A 4LF7J 2ASLA 5GMKa 1U09A 2FZCB 4ED0A 3GSDA 2PEBA 2LF8A 4E7LA 1NSPA 4RDUA 2JWNA 2B5JA 2QO3A 2OPRA 2GVDA 3S16J 3JR9A 2MJUA 4OHWA 3ZQHA 4K4TA 4ETXA 4PCQA 3ERED 3DRXA 3HX9A 1N6QB 4GMKA 1FX4A 2L9WA 3EGVA 4A8YA 3RBDA 5C2CA 2CPDA 2DJIA 3EGNA 1NU4A 3HVRA 1SD6A 3MWBA 3W7BA 2RE1A 2QSHX 1XDUA 3BREA 4OI2A 2IRUA 1YIJS 4Q5VA 1QSSA 3GPAA 4BQOA 1NKBA 3HOTA 1OPIA 1KWMA 2B9WA 2VDHA 3I0SB 3M2VA 1QUVA 3TO8A 5E3PA 3MMCB 1HWIA 5EN1A 3MEXA 3QYEA 3P9CA 5T7LA 1USSA 1R89A 3G8SA 4LFCJ 2W01A 1ITPA 2R7OA 5IYCJ 3M8YA 3LSRA 5GAEJ 3BQYA 2HPMA 2DA5A 2EIKH 1RHRB 5FGMA 3LGNA 2OH2A 1F5TA 1FVSA 1RETA 3RDIA 2ELHA 5CYVA 1V3ZA 4P9UA 1DLOA 5AIPA 2RILA 3HVAA 2Z2LA 2ADBA 4PSXA 2X6XA 1FRHA 1E6YB 3IAS9 1URRA 3TQNA 2AYEA 2OPPB 4DV4F 5J1UA 3JSMB 2G2OA 1UJ6A 4HV6A 2VFRA 2HQIA 4HDUA 3N5BA 2IT0A 4A8QA 4AT1B 3JREA 2RQKA 2CNLB 4NLWA 4KIFA 2K3KA 1B6AA 2RKHA 2MC3A 3C8YA 3O8WA 2RNEA 4NYZA 3OYDA 2KT2A 1WSVA 1VFCA 4JUZA 4DNCA 3WE2A 3AJ1A 3BZ6A 3SEZA 3MDFA 4DR4F 3KHRA 2HVIA 1F5BA 2JNJA 2AX1A 2PDAA 4FPRA 3P4UB 2LXIA 3HHEA 4WFNQ 4ECYA 2DFFA 3N05A 1H98A 3UE2A 1EB0A 4HSRA 5K14A 3Q24A 1UMJA 2AP6A 2F4FA 2UUBF 2HNYA 3M8WA 3H8YA 4NMXA 5KFXA 4UVBA 1WFXA 4HEA2 2K1RA 4AIKA 2OTLI 2JJ7A 1WQ2A 1O8BA 3ZMSA 2VC0A 2QVOA 4LREA 1NJZA 1P4WA 2Q1LA 3HSJA 1M1HA 3HL2A 3VALA 1MBHA 4ZJQA 3GWZA 4HA8A 1D1CA 5GAEU 4J7CA 2C3PA 3WHIA 3V6DB 4XIDA 1S7IA 5EUHA 5ILSA 4ECSA 1YOVB 2PFBA 3T6JA 3RTVA 4B9VA 2NZCA 1LJ9A 4PZVA 3H0PA 3KG0A 1N0UA 1LEBA 4TU9A 2E2JJ 1A9NB 2MZSA 4LIUA 3M8SA 2CG8A 2V7FA 1ZM2A 1JXVA 3GV5B 2DGQA 2DRAA 2A1BA 2ILZA 2V6CA 1KYWA 4QBUA 3GR0A 2V9PA 4A3JJ 4XSZF 2K9MA 5HS7A 1SKRA 2DGTA 1R1TA 2F5VA 1VQ8S 2ADCA 3R4KA 3R5DA 2UP1A 4XLFA 5JLWA 5JVTA 3BPDA 4YY3J 4QPTA 3I5BA 2HTSA 3QIPA 1B99A 1PYOB 3H98A 3BOQA 2YWFA 2YVSA 3BJAA 1FBUA 4IR9A 3MFIA 1FOWA 3MM7A 4A5MA 2CFXA 3GVAA 2KYXA 4FVMA 4BAYA 5GPAA 4EYHB 2HW3A 3CTAA 3PNVA 2JLGA 4RNMA 1E17A 2FRHA 2IPQX 3BJOA 1R36A 2DEIA 2L9DA 2LA6A 5L8RC 4F4XA 2Y0SA 3BLYA 5E1WA 3S93A 3WGIA 4LSNA 3PJRA 3D67A 2ACMA 1F9HA 4PG6A 4EI2A 3TUZC 3AQOA 4I2QA 2DR5A 1CLFA 2W9BA 4DF4A 4QR0A 4KGZB 1D9DA 5CKTA 2QKMB 1TW2A 2BXJA 1N78A 3IR6B 5CAAA 2XSFA 2K85A 1JQGA 2HHHF 3HCXA 3OTDA 3H0GJ 2BDPA 3CB4A 1FRMA 4WFXA 3R5AA 4V19J 3FXUA 2OELA 2ZWOA 3JQKA 1U2WA 2M87A 1VQMI 5K8MA 3CMQA 3SZTA 1XC9A 4WFBQ 4DV7F 2L4MA 3LSIA 3O6QA 3OPKA 5CH7B 4N8NA 2HFHA 1S1TA 2NS7A 1G3SA 1NDPA 4ZK7M 3NWRA 4WTYA 5C7PA 2KZZA 1JUSA 2O67A 2W2OP 5KFDA 2Z33A 2OIHA 3IKVA 1FDDA 1UKUA 1BM9A 2IMWP 4PPDA 1RWOB 2ISYA 2XAHA 4IOAF 2HNZA 4ZVQB 3HO1A 2V2QA 3ABLH 4P75A 1UA0A 1YW7A 4IO9F 1VCTA 2ZE2B 4EUVA 1TQIA 1S3JA 4HF1A 1FLIA 1X7VA 4OYBA 2ZSHB 2Y8WA 2OA4A 5F1RA 3DTKA 3WE3A 1HNIB 3VGTA 1IO2A 3KZIC 2GCFA 1STZA 1LFUP 2OPSB 2QSGX 3MR7A 5F0FA 4BDYA 2HQ3A 1WDDA 3FQLA 2XMUA 2OD6A 1RWMB 3DPTA 1CBKA 3FX3A 5BYSA 3OWTA 1HBOB 3VAJA 5BQTA 3M8QA 4B17A 1MH4A 4NZ0A 3GZ7A 1KTQA 4DPTA 4DXLA 2XB0X 4BE0A 1H8AC 4F0KA 1YRXA 2X48A 1P9QC 5HDNA 4WK1A 1RTJB 4U6PA 5AE3A 4U67Q 4IRCA 3LSMA 2XIGA 1YK9A 3FQKA 1TU0B 5T7LB 4E6KG 4YB7A 4CYUA 3MMBA 3BBFA 1EP4A 3JRHA 3V4MA 2CJBA 3WHBA 5DM7Q 2PMHA 4P72A 2ZBKA 2MLXA 3KLIA 2EZHA 4KT0C 3PHEA 2I9SA 2MXYA 1VISA 1VHIA 3SDEB 3NNCA 2VG6B 2WAQD 5DRKA 2O66A 2DGUA 3ZQLA 2RN7A 2W4CA 2ISZA 4LF8J 2CUJA 4HF2A 2XGQA 1KOOA 4X64F 2R7QA 4LK0F 2PO4A 5J2PB 2ZOMA 3IBWA 1JLCA 2M3DA 2HS5A 5GAGI 2OJ3A 1CS4B 2CUEA 1W7PD 1SANA 2AJ4A 3M8EA 1LE8B 3OYJA 1DARA 2M9KA 3WIUA 5BYRA 5KFFA 2B4VA 3C6TA 1S9HA 1HQCA 2BBYA 2MKHA 4BNCA 1UFKA 4C2TA 4U7CA 1OYEA 3HRMA 1ONVA 1R0AB 4L76A 4J9KA 1DLOB 4B3OA 1RT3B 3A3OB 4OU0A 4QWBA 2DR8A 2CW0F 2JA2A 5GADJ 4FX0A 3CLQA 1OWXA 1Y5LB 5K14B 4Y65A 5KFTA 2ZH4A 4YFNF 1FTRA 4JV5F 2KZGA 4QWCA 4HF0A 1XR6A 2LP4A 3GTLJ 2ZWPA 4MQVA 4NC8A 4IHVA 5LHIA 4DSKA 2F63A 4KH1B 3DI6A 4O23A 2L9VA 2UXDF 4A3FJ 2EXUA 4S0HB 2KIUA 2ASDA 4Q0BA 4PFOA 2DHAA 3H59A 3GG0A 4PR6A 1IKWB 3K4CA 2CQCA 3VGSA 1VQNI 4UOHA 4G1QB 5HQ8A 3M4OJ 3Q5FA 3BO2A 2P9CA 2DT6A 5MLCV 4U7UK 2M2EA 2STWA 2HQCA 3KDOA 2LBFA 4HNTA 2I2YA 3V42A 4C8ZA 3PW5A 1NK7A 3GILA 4JBAA 4B3RJ 2O8KA 1X4EA 4DSLA 2HI3A 2ZJPF 3MD1A 4F4YA 1F43A 3D9BA 2QLWA 4TN2A 5BXIA 5GADU 3I9ZA 2DR7A 2QLFB 1D9AA 2HK2A 2VG5B 4E2FB 2E1OA 3BSOA 5FLVA 2DA2A 1KEKA 1QSYA 4UOCA 2BV3A 2M88A 4J37A 4ZPDA 2XLJA 5T14A 1Y8RB 3FEYB 1GHCA 2UU9F 2F4VJ 2Y9YA 1NK2P 1OJLA 4WF9Q 1Z05A 4GKKF 1D1BA 3KG1A 2G0CA 5E3RA 2QLBB 1HQUA 3CJ0A 5K7ZA 3GYNA 4RB2C 3GFIA 4UOFA 3THTA 2DDBA 4UUXA 1GVJA 3K4BA 4HYEA 3OS0A 1CC8A 1GX6A 4WYWA 3LANA 3UDVA 1WJ9A 1ZTRA 2P7VB 1HC8A 4RW7A 3PEHA 2AJ1A 1PJRA 1HNWF 5IT3A 1X4OA 4DBRA 4D5FA 4X4OA 1WF2A 1DPRA 5IPAA 3S1TA 3M9OB 4YOEA 4O44A 4ENKA 4I7FA 2VG7A 4WXOA 4CLWA 2EB7A 4FISA 3AL0C 3DKXA 4Z7YA 1IBMJ 3AXMA 3FMQA 3C6UB 4PWDA 4AYBN 3ILLA 2D7SA 3C6TB 1EETB 3DM2A 3A1YA 4WE1A 4KH0B 2RF2A 3DLGA 1BD6A 4J5OA 5CYQB 2FLLA 1G3OA 4M5NA 5BR8J 5L3BA 1O3QA 3ZTOA 3AL0B 2NXCA 3NKYA 4NXNF 3QRRA 3QT7A 3S1QJ 1F9NA 1HSJA 4PSWA 1DBDA 2ACYA 5DDQC 3FKJA 1BOBA 4YELA 2CU7A 2W24A 2QM3A 4K0KF 1X5OA 2EZKA 3VTIA 1G2EA 1YS7A 3K5PA 3R9LA 4C2UA 3CCVI 4QWDA 1SKUB 4CLYA 1PC5A 4FPIA 4H4MA 2Z9OA 4XICA 2F5EA 1AA1B 3OSNA 3PRVA 4QWEA 1ON2A 4IG0A 4UW2A 4OZ0A 5KFZA 5J4VA 5EG0B 3DLKB 3I82A 3LP0A 5DDPC 4DLGA 3RTRA 3GJRB 2KMUA 4XKCA 3LO3A 3DBRB 4IG3B 4BHPA 4FDFA 4JI0F 3RAMA 2MQNA 1HW8A 3R5GA 1K78A 2BQ3A 1MWZA 2H54B 4X4RA 1IBKF 2XM3A 1ZGWA 1TP7A 3GIMA 4M5DB 3HTSB 2OZ6A 4OJ1A 1S9EA 2RAEA 1I94F 4LVOP 2UV1A 3DTEA 4PJJA 4CCLA 1R0AA 1NG7A 2Z2YB 4ZYAA 3L9ZA 4AIDA 2OPSA 2DK8A 2XRNA 1NJXA 5DG8A 5L9NA 1UCRA 2DA6A 1KVKA 4ECXA 4I56A 3B6CA 4RS8A 4KPYA 1H2UX 3UNYA 3L1PA 3C16B 1WEZA 4ZIVA 4KO0A 2DGWA 4ES3A 3CMYA 1KQSR 4W92B 5B0EA 4MFDA 4DYQA 4DL3A 4IDKA 1RB0A 3J7ZT 3K4JA 1YZ7A 4RZRA 1CJUB 4UTGA 3PUBA 5JVGF 2K3PA 1NJYA 4PJ0C 4S04A 2W7PA 4JV0A 2MY7A 2AIRB 2Q79A 4G1IA 4RLQA 1FWPA 4E7SA 5HQLA 4GKJF 3UI3A 1QVTA 1JT6A 2CJJA 3MCNA 3NAIA 4Q44A 3GU0A 2WC2A 5IYBJ 4P2XA 4ESJA 3FKBA 1TWAJ 2SXLA 3CDEA 1XPXA 4KMFA 4OX9F 4E98A 3KTQA 3MEEB 3O2PE 2XTJP 1FHTA 4WXHA 2UXCJ 2QJ3A 3PCOB 4EO6A 4AC0A 3T6BA 2W9CA 3MZIA 4HLXA 2R2SA 1XNQJ 3VYTB 1I1SA 3K4KA 5M2RA 2Z4PA 2HRUA 1JLQB 1TQPA 1X31C 3W5YA 3ZXSA 2JK3A 2PMZN 1WACA 3VF0B 3O2IA 3I9V9 4Y2KA 1SKSA 4EQQA 1Q8BA 4EEFG 1H9GA 3K4MA 3BGUA 3I58A 1S49A 1GMWA 1SVMA 2GBYA 2UXBJ 3LMMA 3AOBA 1NMEB 4A8OA 2XPWA 1FTCA 2L48A 4XK8C 3JSBA 2VI6A 2XF5A 3CJ8A 2X1EA 2HDCA 3I9V2 4UV9A 3W3SA 3CMEI 2L3MA 1BOAA 3EUHC 2XPVA 1LVKA 3H5RA 5DDGA 2BKOA 1YE9A 4MTDA 2HS0A 4ZH4F 1IJFB 2E19A 1IRFA 4G9YA 1PP8F 2LVWA 4K4ZA 1UMQA 3NRVA 4BXXJ 3BY6A 1GEHA 3T5JA 3ONQA 2JVHA 1JLEB 4ZVTB 3ZQCA 1QAJA 4X1EA 4U0WA 1X1CA 3VCDA 2W57A 2NR0A 1MMSA 4PYDA 5B0AA 2C1EB 3CMAS 2BE5F 2M30A 2Y30A 1YIJI 1FYKA 2EINH 3MAQA 3S6EA 5ETLA 4H54A 4WTOB 1ZH5A 4I2PB 3BBCA 1HBMB 2RS8A 3KP4A 2B6AB 2HZTA 1ETOA 4CHUA 1SUQA 2MDAA 3ECHA 2HWIA 1FD2A 2W4DA 3PYEA 4IKFA 2WSCC 2QE5A 4M72A 2YQ1A 2W9BB 4DV2F 2KXNB 1M5SA 3R7BB 2RUGA 1R5GA 1R8BA 2D5VA 1WHXA 4PXDA 3I54A 3VR1A 3PZPA 5I3PA 2KQRA 2WTFA 2FQ3A 3L09A 4MO7A 4Y17A 2RHQB 2GAUA 3PJ9A 2DFIA 2ESNA 4G6TB 3KLGB 2IC3B 5FKOA 3B82A 5CYQA 3EVOA 4E4HA 2MHNA 2M8HA 3HHLD 2B5JB 1DDNA 3MFKA 3HXLA 1SH2A 3V5RA 3HSRA 2L7FP 4I6WA 2IGKA 4XOPA 3J81K 3Q3SA 3T1HF 4AVPA 4F52A 2LU1A 4U7BA 2HZAA 3PY8A 2DOFA 1K73T 5EWFA 1T0FC 3O44A 1KBRA 2LKSA 2HDWA 4R8UA 1T3OA 4ZVHA 2PN6A 1WKJA 4ZP9A 3I0RA 2QENA 3OTBA 3ZNJ1 3KFWX 1TL4A 3VQSA 1T8EA 1W5TA 2YY3A 2XQCA 2LOOA 1ACIA 1DTTB 3MOZA 1AB8A 2JVOA 4A0YA 3IC1A 2BABA 3HLUA 3PYGA 2CNNB 4AXJA 1J27A 2DAOA 4LBPA 2XASA 2DT7B 3ISZA 4X66F 5DJBA 4HV5A 4A8XA 5CQEA 1EJ7L 2B4PA 2FC9A 1S48A 1NLKL 3EDRB 2HK3A 3DLHA 2Q8KA 2WAQA 2KFZA 2EFNA 2A5WA 2BBEA 3VWSA 3M9NB 4C11A 1DPUA 2OMOA 1Y1WJ 1TL3A 1Z1DA 1S79A 3HFVA 4LF2A 1IBLF 2IA0A 1FJLA 1BI0A 2Z2SB 3CJ5A 4F91B 2YNHB 1HFEL 2WY7Q 1WHVA 3KZYA 5HNFA 5HLTA 1JJ4A 2P8TA 3EQLF 1CPZA 2CQKA 5IC4B 1NDKA 3I64A 2B8PA 3K7RA 4ETZA 3DLEA 1SMTA 4OI6A 2X3DA 1FJEB 1D8KA 4TQSA 1FEXA 5M3MJ 2LREA 3MN2A 4OHXA 4FQGA 2R7ZJ 4IQJA 2V69A 2JL9A 1ZYQA 2VFUA 4Y4RA 2CV0A 3RBXA 5LHHA 3L00A 1S0OA 1UVJA 2DCUB 3MEDA 4MIMA 5H9EJ 3ZTRA 3QRFF 3LAPA 1H7WA 4IFYB 1NSAA 1PILA 1JKOC 2O01C 2ZVIA 4KSEB 3CCJS 4BQAA 1DJ0A 1OJ4A 5F6FA 2XSDC 5ICCA 2P5VA 3IAS2 2XYHB 3KPHA 1Q8LA 4NDLA 2XC9A 5ERIA 1N88A 1DHMA 4HQMA 5D3GA 4HACA 4DJBA 5EX3A 3H3UA 1LWFB 2HOTA 1X4HA 4Y6IA 2HWHA 2GJ2A 4RJVA 1HD0A 2ZFUA 4Z2XA 1ULRA 4IYQA 3TW6A 1Q1VA 3HJFA 1IW7F 5H1SV 4ED7A 1KLMB 3SYTA 2NSCA 1DTQA 3A3NB 2LP0A 4QSHA 1T39A 2CPIA 4RU2A 1XNRJ 3R8YA 2Z57B 2B0LA 1RU2A 1YJNI 1NH8A 4R8UB 2N4DA 1C0WA 3MEGA 1ZM9A 3W2VB 2DVIA 2FXAA 2H94A 1ZR2A 3PXGa 3BR2A 4OV1A 2BY0A 4LR9A 3F8BA 3S2DJ 2HEKA 3ULQB 4PUOB 2L9SA 4ED8A 4NRTA 2P6TA 4KJZA 1I5OB 3HTUA 4E7ZA 2IC3A 4PG7A 1V4RA 4C48A 1N25A 2BY3A 3C2PA 5L3FA 2VICA 2VOOA 2QX0A 3D2WA 2LSOA 1WZ2A 2P7CB 4X4TA 4II3A 3CIZA 2XMWA 5G0RB 2CJKA 2KO1A 4IL6C 3WC2A 1JLBA 1IRZA 5JJBA 5D4NA 4WX9A 3MM8A 3QJPA 3RKXA 3IBCB 1Q53A 2LEAA 4ECWA 3WTVC 1ZK8A 2OTJI 1NRKA 1ZG3A 1OMIA 3NWGA 1E6VB 1PKUA 3S32A 3KLIB 1RYSA 1RLCL 4DUYF 3G4SI 4DG1A 2JJ4D 3HC7A 2H4WB 1CQNA 3CNQP 4LG3A 4OWRB 4PYAA 1VGYA 3O1LA 4RAYA 4K2JA 1IQTA 4XO0A 1XD7A 1N8RT 2XCAA 1N48A 4DR5F 2E5NA 2UVUA 2CRLA 3HG9A 4Q4ZF 4IH6A 4DSIA 2QYOA 3D5RC 4NA3A 4G7HF 4B43A 3MXHP 2Z5UA 1PCAA 1IJEB 5E3CA 2HLUA 3QGIA 4USUA 3OIOA 4PRFA 2DNKA 4L0YB 3D0IE 2EA4A 2DA3A 1MBKA 4RM2A 4XSXF 3C3WA 3HVTA 4EWTA 2ZJPQ 1M5KC 3R61A 5KG3A 1YKWA 1LB2A 4QR2A 2O0YA 4EGZA 5CZVA 2JWTA 4HX4A 4PXEA 1ZELA 4N0BA 2HFUA 1D0ZA 2E1PA 2CWKA 5BNGA 4HT5A 2F7VA 2K3FA 1VRQC 3FBNB 1TL3B 4A4JA 4WKYA 2NSBA 1EH6A 3FZVA 3BH6B 2FX0A 2DKOB 1U5TA 4C3KA 2BVLA 3TO9A 5ADZA 2P81A 1ZGAA 4B3TF 3OL9A 1BE4A 1T05A 2AEJA 1X4GA 2V8DA 3KHGA 3E6BA 2O7OA 5EDWA 2RMLA 3A8JA 1NPPA 3R0AA 2E44A 1N34J 5FRNA 4IFVA 1UW9A 2DGXA 8RUCA 1NBEB 1JLFB 4ZVFA 5JMNA 2PE8A 1A6QA 2L9NA 3NGSA 5IQ6A 4B44A 4URGA 3BWGA 4KJIA 4PFPA 3SHFA 1ROFA 4NLYA 4Q45A 2PEXA 5KFLA 5DZ7A 4LRBA 2R93J 3NS7B 3KLVA 5KOXA 1X1DA 2DH8A 4NI2A 2LMIA 3M2VB 1ZLKA 1XQIA 2PG4A 2DPUA 4DJAA 1ZA1B 1LNWA 2IVMA 1EKRA 1VQOI 4IOAQ 4BJ6C 2HHPA 2MZTA 4FBTA 2CDQA 1GXQA 4QIFA 2Q66A 2JPCA 4IR1A 2MPUA 1IN8A 5KG5A 2IM3A 3I4PA 3PG9A 2FA5A 2EIJH 5C42A 3BN7A 4DUTA 2E66A 2E2HJ 1HHTP 5CYJA 1Z67A 1PJ6A 1NJIT 4OMZA 5J2MA 2IA1A 4RLEA 2XMTA 4C0BA 1R23A 3S15J 4XPEA 3GLXA 4DR7J 3ZZYA 1OCTC 4ZIWA 4ILRA 3LWLA 2TCTA 1O4XA 2XS5A 4WP3A 4F25A 1OIAA 3WQPA 4FN5A 2P0WA 3OHAA 4ETSA 1NKEA 2D9OA 2VJ5A 3T1YF 2FTRA 4JX6A 2MTLA 4Z2YA 3F21A 2OHDA 1XDSA 1XMAA 4DFKA 3R1HA 4WCGA 2ZOGA 4ANJA 3GCWP 4ZYGA 3ZNUA 1WC4A 2DXFA 4B1RA 1DZ5A 2Q6CA 1S6PA 1DQAA 1TKZA 2DMUA 3S17J 2F4IA 4AUXA 4QU7A 2MBFA 2W2PP 4RLFA 4YUDA 2IM2A 1R1UA 1FK9B 2CGPA 2LU2A 2E60A 5DCMB 1R3NA 3GTKJ 2CJQA 3GFLA 4BJTA 2GAHC 3ZXWA 1X4CA 1U5TB 1P1LA 2BVZA 4X62J 4USJC 2F8HA 1A6IA 4X65F 4ZTJA 2HEOA 3CPWR 5F27A 4RX6A 2M5YA 2WBMA 4GO5X 2C2ZB 2BJ7A 3ZTQA 2VKVA 3HHLA 1K47A 1YRNB 2XWYA 2OSRA 3K1PA 3BYRA 4U0VA 5LGTA 2VXDA 4K5RA 5HS8A 2VQFJ 1MMDA 1TKXA 3C7JA 3MKZA 1WDTA 3G71S 1MGTA 1Z3YA 3PM1A 3PNIA 1UFWA 3H5YA 2ROGA 3P9KA 4G6VB 4ILMA 2POKA 1UZCA 3J80Y 2OQGA 4ECVA 3LNQA 3HUGB 5D4LA 4J9MA 3NARA 3H0DA 5JHFA 1ZREA 2MC4A 2DY9A 2HSEB 2M7BA 3L7WA 1FKOB 1B0TA 2CMPA 3FMWA 1ODDA 1LW2A 5D4SA 5H20A 1D9FA 3QAEA 2WVFA 3CC4S 2PBIA 1LKZA 5F0UA 2HNYB 5HJXA 3IRWP 4Q2LA 3UD3P 2ZHOA 1UWBA 3J7AO 2DY1A 1TV6A 3VGUA 4HHJA 1R6YA 4X4QA 3JAMU 3CLOA 1FOYA 1Z4UA 2FE3A 5ICEA 3TDZC 2ZZNA 3BPVA 4BY7J 4WJBA 3OXGA 2CIMA 2W1OA 1ZR4A 2D74B 4U7UD 4AIHA 3M1VA 1FE4A 2QKLB 3AODA 1FKAF 2Y48A 1Q16B 4G12A 2LFBA 2AJQA 4YEAA 3Q83A 2DLLA 3P7NA 2K5CA 2FNAA 5GAHI 2PQ8A 4C8MA 4NLPA 3I32A 4NLRA 4LR7A 3AG2H 3EVWA 4EMSA 3QWPA 3DRYA 3ITHB 2B7CB 3J7AN 4DW6A 1WSRA 1FPQA 3KZZA 1G7CB 3QSYB 2B4UA 4DV5F 3VWBA 2G0IA 2ZJRF 2YNGA 1DFDA 2CQXA 2XGDA 2JSCA 3KYLA 3F6VA 3NNAA 3D4JA 1FIPA 3KLGA 2MQ8A 4DV0F 2MZRA 1O0PA 4JI5F 2LR8A 1IJWC 1DGRM 3RJMB 3NGRA 1CC7A 2QMUB 3GMGA 1G2HA 1BQNA 3PJWA 4N76A 1HYSB 2V8GA 2HVHA 4ZCLA 2RQMA 3CXCR 1I3AA 4UVCA 1HF0A 5IQQA 1RUSA 5BJRA 1S10A 3VEPA 1MN7A 4L3NA 3MMAA 1JUMA 5KNLA 1EQ0A 2VJIA 3DV8A 4LLLA 2KHCA 4M5IA 2FJ1A 2IJRA 3GLJA 4ZJOA 1RDRA 3QYYA 2ZC3A 5B1AH 2YR2A 5D4OA 1EA3A 1TNTA 4ZZLA 3CJTA 3W9HA 5BR8F 4ZC3A 4F3QA 3J81Z 1ACMB 2WOMA 2BZTA 1R71A 2I10A 4NLVA 1K4SA 2R8KA 3QO9A 2D41A 1S7AA 2QV6A 1N75A 2X6OA 4L75A 3HF5A 3PFEA 4QQBA 1Z6TA 4K4YA 2JZ5A 3FHZA 3D6HB 3TVKA 2ZMEC 2KTQA 4YB5A 5M5WJ 1FP1D 2QSWA 5E1XA 3M07A 2AYMA 2KIMA 2IDLA 1OKRA 2V9WA 4FVCA 4MQ9F 3ILOA 2E1CA 3WX8A 2G9WA 5IV3A 2JSXA 3NNHA 2IM1A 1P8GA 2CPXA 1E3PA 4RUCA 1Q82T 3JRDA 3GZ5A 2GWRA 4ZVSB 4LIWA 3T5HA 2J9DE 5LXYA 1FFSB 5DV5A 4YHHF 4RGRA 1W26A 3L2WA 3CJNA 2HR3A 3O8HA 1JHFA 4IQ4A 1J5YA 2WB4A 2LDUA 4N47A 2OJED 4ENMA 2CQ7A 1I27A 1N36F 4LLNA 2GGPB 1YRTA 2BOAA 2EK1A 3VVTA 3KHHA 1B59A 4CWBA 5LFAA 1FX2A 3V4IB 4CCOA 3JTOA 4PXBA 2VQCA 4F2RA 4ZP8A 1N54B 5C2GA 2FLPA 4PWUA 2V1XA 1Q86T 4CLZA 1T08B 1RHJB 1C1CB 1XGMA 2Z56B 3JYTA 1SKWA 4FS1A 1MSWD 4RW4A 4WFAQ 3OOUA 1FX7A 4B3SF 4J19A 1DGWY 1V3RA 1SC3B 3QZ7A 2LY2A 4Q7AA 2VE8A 2GFFA 1LVAA 2VU5A 2FU4A 1R8PA 2N4CA 3K58A 3JSRA 1R5HA 4FX4A 1B72B 5HL7Q 3SV4A 3J81j 2EPFA 1GFWB 1JTYA 4DN9A 2CSOA 2AW0A 1RKIA 2BE2A 1HA1A 2PIIA 4J9SA 3BQ1A 2CPJA 3I5UA 4QW8A 3BG6A 1PIEA 3ELKA 1TVRB 4ECUA 4XRFA 1FOKA 3OR1C 4BEHA 3Q89A 1Z0XA 1HNVA 3ZQQA 2LQ8A 1WI8A 5FJ4A 2O6GE 3EYIA 5E20A 1W7PB 1IUYA 1T98A 1YIOA 1RTZA 2RQ4A 3IP4B 4G1QA 1YJWS 4WYLA 2HFVA 3RB4A 1RCOB 3NP5A 1HMVA 2CWEA 4BL0B 3GEZA 2QL5B 2Z0GA 3GIKA 1N56A 1RT2A 2DEJA 3C15B 5LM7E 3A8KA 2NREA 5A6WA 2QA4S 2HOSA 1RWVB 3D66A 5KG0A 2L08A 4LGWA 2K7LA 5LLQA 4B48A 3QRPA 2XVCA 5FJ8J 3ETMA 3H90A 3OSPA 1TNSA 4M74A 1UJ5A 2VA3A 4NBQA 3N97A 1WJ5A 2ZZMA 4CCNA 1H2TZ 2Z58B 4XBFA 3GJQB 2COMA 2CQQA 2KRHA 3GTGJ 1JIHA 3I0RB 1IC8A 5A8KA 3EXYA 2HVDA 3KOAA 3R5CA 3GYXB 4RUHA 5A8RA 3SFUA 2RHSB 1VK8A 2BYCA 1QVFR 4DIQA 2OMLA 3JXOA 5EEAA 1Q0NA 4WFZA 1RR7A 1PYSB 4ID8A 4PAAA 3DLLF 4LFBJ 3OR1B 3M4XA 1TTHB 3C66A 2AT1B 3AKZA 3HKWA 5DO2A 1K83J 2X3GA 5IXUA 5KFYA 1V55H 1GXTA 2HWTA 2K7KA 3VV2B 2AZ1A 1GX5A 4DUZF 4QU6A 3TAMA 4L9JA 1VBZA 1QAXA 3OTCA 4R5PA 2XLIA 5HJYA 1RTDB 2EK6A 1RT1B 2DNYA 2HQNA 4Q43A 1XN9A 2JEIA 2ZDPA 2E9ZA 5M5XJ 4P52A 1F6TA 3HVTB 2FEZA 4DR7F 1L3LA 3F8FA 1UG2A 4NYPA 3E3VA 1Z2ZA 1RWKB 3OYCA 3ZZUA 3FJ2A 2KFNA 3EGZA 4RUAA 1XGNA 1H73A 2ID3A 3BT9A 4BY1J 2WAQN 3UO0A 4Q8EA 1SIZA 4C7QA 4FNIA 3M7VA 4YFKF 3CWJA 2AQEA 2DTRA 2JT1A 3CC4I 2M70A 1IDZA 1S9GB 4RW7B 4I67A 4O44B 1M1GA 2WCXA 5D5UB 5FKNA 1FT9A 1C4AA 1VQNS 1JLGB 4I76A 1MH3A 5A8KB 4DQSA 4HI1A 4Q5SF 1K79A 5C44J 1RHQB 4DYRA 3MEDB 2GQQA 1TT0A 1S1UA 2YNIB 3W65A 2M5WA 1WOSA 2XMMA 3JYTB 4KHRA 2VJUA 3K8WA 3MMCA 1X2MA 3FSYA 2DU9A 1UELB 4KGMA 1NB7A 1APSA 4G6DA 4CQ1A 3SZGA 2Z30B 3IS9A 5GAGJ 5D8LB 3HHLC 3UCGA 1FERA 2EVZA 1MMGA 4OYAA 1QD1A 5HNHA 1Y5NB 5L1JA 2O61A 3LQRA 3QPSA 4O4GB 1FNMA 2OUGA 2I5UA 2HHTA 2CQ0A 2VBZA 1YITI 1HW1A 5D5WB 2FB0A 2CPEA 5D6GA 4K8RA 1GMVA 4OZNA 1GMUA 1BW5A 1ETWA 1PBAA 1TFWA 2CQIA 4AE5A 1R7IA 2J5AA 3M1EA 3L7UA 2FJDB 3B8HA 5LGNA 4JI6J 3GTYX 1GAOA 3HSFA 2QLXA 2VT2A 1Z2LA 2KM8C 2DR6A 4DV1F 2W8KA 1F3VA 3KLHB 1EETA 3DM2B 3QMQA 3GJTB 5D15A 1UAWA 4J01A 3OS1A 3GFXA 1FXDA 4IG0B 1NK8A 2QUFA 4G94A 2VJ4A 3A12A 1M1EB 2A6EF 1XK8A 4KGKA 3K59A 2JDJA 3EGWB 4RBUA 1SJ3P 2KRFA 4LF5F 2MZQA 4YP3A 4IUFA 3QAHA 3TMOA 2NUHA 5D6FA 2IY5B 6PAXA 2NVXJ 1YDLA 1RT2B 1XMXA 2NXEA 2WW8A 3T8RA 3BR6A 2AF6A 1B0VA 3OBIA 1LW0A 3DOKA 1WJDA 3BR3A 4DG1B 3DP7A 5ETNA 3A8IA 2WB1A 1SAXA 2QSFA 3FBFA 3E5XA 3DXBA 3AH6A 2JEFA 3OJUA 1HPZA 3M8PB 3M6VA 5KFGA 2LKXA 4ED1A 4PQAA 2ZH9A 2BQUA 3CVKA 3HFKA 1K9MT 2E2IJ 2EK5A 4LG0B 3OTOF 3IRXA 3OYFA 3HHKA 3PTWA 1HNIA 3ZFVA 3BGOP 2XGXA 3HHLB 5JLXA 1QTNB 4M6YA 3PR4A 2JOQA 1WI6A 3RBZA 4XKBA 1G59A 3H92A 5L3DA 3TI0A 3D68A 1NSKL 2J7UA 2VPYB 2LDIA 3P9IA 4AD6A 4DQPA 3GF2A 2IJLA 3EPZA 2QIFA 5KFCA 3AAFA 1NHUA 5EDNA 3QZ8A 1VQOS 1S1TB 3JAMZ 3MM9B 2MGZA 1XMQF 3TAPA 4UF4A 1SD4A 3J7YI 1R31A 2Z16A 3MEEA 4MAKA 2CRGA 4WCEQ 1OYDA 3EZ5A 1Y7PA 5LMUF 3PNYA 4CM2A 2RU9A 5EYRA 1KHVA 1Q8IA 1FRIA 2ESHA 1JNZB 4PEOA 4XLPF 4R79A 3OFEA 3Q0WA 3QLHA 5CVIA 4OYOA 2H5IB 3V8JA 4ZYEA 3M8ZA 2COBA 5AJ3F 2LKZA 3QRQA 3UR0A 5K7FA 1TELA 3JSOA 3F6OA 4M3GA 4WZQA 2YKQA 4O3NA 3C15A 3SCKE 4LQ3A 1E0EA 1UPPA 2HQRA 2VBYA 4L9VA 5KTQA 2DNHA 2MFZA 2DNNA 5FIIA 4EK2A 4I0BA 3H1CA 2FVCA 2V9VA 3PX6A 1ZRDA 4DU7A 3IR5B 1P9YA 2GC8A 3GYGA 4L74A 1Q8KA 3I53A 2IMOA 4J9NA 2L5QA 5IT0A 1VQ9S 1VQKS 4XLAA 3PM9A 2FQQB 2D3OR 3BGFA 1JKRC 5LEJA 2VB6A 1GT8A 7FDRA 1TQMA 2CWXA 1GK8A 3PL8A 3GZNB 1VOMA 1HWUA 4KFBA 2KRCA 1UFMA 3GTPJ 1N32F 3OVAA 1VJWA 3W6KB 4BWMA 4X4VA 4QR1A 3ULHA 2WZ1A 2WV0A 3EDPA 1BN5A 3P3DA 2GX8A 2R42A 1HPZB 3M8PA 1XEZA 1M90T 2DIVA 1JKHA 2X1AA 1CG2A 4BWJA 1P1TA 1WG5A 4J9LA 4B3XA 2CUFA 4B3AA 1FI4A 3MMAB 1EARA 2LMDA 2C28A 2QQBA 4X0GA 2Q1ZB 3HM5A 5A8WA 1KZHA 3BS9A 2Y0BB 1TV6B 3T8TA 4Z6YA 4EU0A 3TAQA 3QT5A 4A8KA 2B9XA 3CJTB 2X1DA 5F1JA 4LJZF 5LRRA 4ELTA 2WB1D 4YDXA 3LFUA 1U47A 3ECOA 2OPRB 3HVWA 1FKPA 3MM5A 4KBIA 5JUMA 2DYRH 5KT6A 4AL5A 2K3IA 3FCWA 3C2BA 4L3KA 1M5VC 1RXOB 3PIPQ 2YKNB 1BR4A 2A3SA 2KFDA 3LSPA 1BW6A 7AT1B 2IYIA 2UXCF 2LKPA 1NZAA 4QOTA 2FMLA 1QA6A 2XMAA 2BW3B 1XG1A 4NC6A 2DH7A 4XQFA 3G6VA 1RKTA 4LF6F 3DGPA 1AZSB 1DTQB 3V8LA 1Y8QB 1Q78A 3H2UB 3S7RA 1WJFA 1MG7A 3P45B 2BXZA 2VQEJ 2BV6A 2KVIA 5U47A 3GLLA 4LFAF 3QU3A 5CA5A 2BKPA 2QLZA 3OD2A 1AU7A 1Q7YT 3HKZA 3DRSB 2HKOA 3IH3A 2NYHA 3G6EI 4C3LA 4OINF 1V9OA 1U8RA 3KUGA 1CJTB 3N6MA 4TXSA 3NY0A 4M5JA 5HVGA 5M2PA 5LJ3Y 2P9EA 1S59A 4OLOA 1VR6A 3K2ZA 4Q8FA 1BC6A 2B4OA 3C14A 4DR2J 5A76A 4XDCA 1TR0A 3OL3A 4ECQA 2NNNA 1JJ2R 3LSGA 2VODA 1CJKA 3B4DA 5TRDA 5E3OA 4IO9Q 4K2EA 2D1VA 1REPC 2MMYA 4GVLA 4KC5A 4WXWA 4DL2A 2WSFC 4WPAA 1VF9A 2V1NA 3RCOA 5DETA 3KK1B 1QY7A 4KFBB 3T9ZA 5HVFA 3HZJA 3FXKA 5LSOA 4I01A 1LFWA 4P6QA 2AS5F 4ITSA 4NA1A 1O5JA 1T9WA 1VHFA 3VYUB 3CCMI 2HZVA 4XKVA 3MEKA 5HROB 3RKQA 3MAJA 3OYIA 4CO4A 2OUMA 2VPXB 2MZ1A 3H4DA 1FTZA 2Z2ZA 3L4BC 1K8AT 1HHSA 5KAIC 2AXTC 2GVDB 1NDCA 3ZMZA 4DCPB 1M0SA 1EZZB 4GGGA 2B56A 3KK2B 1S1XA 4UUVA 4C8YA 1BJZA 2I8DA 4Y34A 3VAIA 2R7XA 3JQMA 2VBXA 3GFYA 2YNGB 1OPCA 2X4HA 1FXLA 5J2NB 4B9TA 2CJ9A 2XV4S 4N5SA 3I59A 5A2QK 1AHDP 1X4FA 2YNHA 3JAMY 4F04B 1M5OC 2K06A 2W84A 2ZBPA 4NPOA 3I0TA 3IH2A 1EAYC 1WWXA 4M71A 2E5HA 3HHGA 3C6UA 1O7FA 3H42A 2XI3A 3OUYA 3OYEA 4XKWA 3PVXA 2E9RX 2P8IA 2KFYA 4DWIA 1ZBTA 3RZAA 1NHKL 2MYFA 5AIQA 5EGOB 3G73A 4BUPA 1D8JA 2O9LA 1RWNB 1TUWA 4IHTA 3AD7C 1RYRA 4K2XA 2YWGA 2G0EA 1FSHA 3M32B 2ZFWA 4XRSG 2XKOA 2E5LJ 2HQFA 1SH3A 2FJEB 4MIWA 3L9FA 3C46A 1N77A 4FYVB 1YITS 3BR8A 2NXUA 4C3JJ 3NQOA 1F9EB 2LK2A 3Q8YA 5F64A 5GVQA 2MKYA 4RBVA 4Y3OA 2DPJA 3DEUA 4XLHA 1PAEX 4UQTA 4YIIA 4DV3J 3QP6A 1G4DA 4G7OF 1NK3P 1OCRH 3IUOA 1QLNA 3KXDA 4CICA 3KJVB 3IAM2 2WVCA 1VBXA 2VXZA 1ZARA 4JI1J 3EUKL 2XY7A 1HW5A 1VC5A 4I0WA 2K9NA 3J7A1 1I1GA 1FDNA 1JJ6C 1TZ0A 4DX8H 1T9XA 2ZB9A 2EILH 1I3QJ 1VQ5S 3G1LA 4U8YA 1KQ9A 2DR9A 3M6XA 5FO5A 1B8IA 3ZRGA 3HI9A 3UD4P 2PJPA 3KUEA 1TW3A 2OKQA 4O0NA 2QMXA 1TT5B 4X6AJ 4C0OC 1JJHA 4C6AA 3Q0AA 2O1PA 5FROA 3QQCD 4R5PB 4DSFA 2ZO4A 2EC2A 3DXSX 3AA9A 2RC4A 2HYFA 4AM3A 4A8SA 3WTSC 3MUVP 4PXCA 2VKHA 3ZMUA 5IT9K 1Y5IB 4MK7A 1X0FA 1U24A 3GE9A 1YI2I 2XWXA 1G3WA 4M3FA 2APOA 2I8EA 4DV1J 3BR9A 3DC2A 1B4SA 2DODA 2XMKA 2GA1A 2FY1A 3RPUA 3FEZA 2FNPA 2J7KA 1IN5A 2QQ9A 5F04A 5GADI 3HD2A 2W2MP 1QVUA 5KVRA 4GO7X 1HR0F 2RD5C 5EZHA 2LQ5A 2EV0A 4HTJA 1JWWA 2LY9A 4PABA 2KI2A 2W2QP 3T5KA 3DRPB 2HVEA 4AU7A 5J1RA 3ZCOA 2R7VA 5EG0A 3DLKA 2AYBA 1J5EJ 1JT0A 1RJJA 1ZZNA 1N5QA 1SEUA 4FXDA 2YU9J 3NGKA 4H4OA 3CMAI 2ZVSA 1QSLA 4Y2MA 3M3YJ 4F50A 2WV1A 1Z91A 3QGGA 2DK5A 4NXNJ 3RI4A 1IUFA 2UU9J 2FHJA 5GMDA 2UZKA 3IG1B 1VYAA 4R0JA 4AQYF 4ZCKA 4CNYA 3AY0A 3BKFA 1RWXB 2I5JA 2UXDJ 1VNDA 3E6MA 1HDPA 4J00A 1H0MA 4I6ZA 1VTNC 5L46A 3HHDA 1ICEB 2J9EA 2EFPA 1G8XA 1D5VA 4JYAF 3HOUJ 4BBYA 2M7SA 2XC7A 5H6QA 3B73A 4L73A 3CMES 2HNZB 3K5LA 1B1BA 1U5TC 2COLA 3NGTA 5KFIA 4DLEA 1RBOB 3T1BA 2VT3A 4DZJA 3E3XA 1IUJA 3P96A 3LALA 3G87A 4IOCF 3OLAA 2KL8A 3DRRA 2LTPA 5JR3A 3DI6B 1XERA 1SC1B 3BROA 2E9TA 3P6YC 4NRUA 1H0HB 4TLRA 3CP2A 2VG6A 3SFGA 4W4MA 2F5GA 1R22A 2QA4I 1YX3A 1JLQA 4RA2A 3N01A 2YNIA 3M1VB 3RQIA 2DK2A 4KN7X 1OQYA 5LEKA 4WFYA 4DYCA 3HOXJ 3H36A 4IHWA 2H3EB 5HSPA 3FISA 3PQJA 3MD3A 3K17A 3ISND 4NASA 5LOQA 4IH5A 1E3HA 1O57A 1FNXH 3Q0UA 3KG4A 3FWEA 3FBBA 3F73A 1DQUA 1D1UA 1LE8A 4ED2A 3M9MB 1T05B 3H5SA 2K8GA 1NSQA 1NCLA 3RGIA 5EWEA 4BE2A 1NHVA 3CUQC 2M4KA 1FWLA 1GXUA 1FJCA 5B0GA 1QRYA 1Z3XA 2MHEA 3DNCA 1FVQA 5K8OA 1RTIB 3CMMA 3BP8A 3BH7B 5ETMA 2MSTA 1RBLA 3EVMA 4UV8A 2R5YA 1W0UA 1VQ4I 4O4RA 2DN0A 3BG9A 4A3BJ 4CYCA 1OYIA 2Y75A 5HMWA 2EZIA 4Z37A 2NLWA 3CJRB 1FTTA 3IM8A 4A0ZA 3OFHA 4EZ9A 3OR1A 2EQRA 1IBKJ 2QFIA 1XTZA 2F2EA 4P96A 4LSLB 5THWA 2DW4A 3OYKA 3JW4A 2NS1B 3O6BB 4NZ7A 1S0MA 1K7AA 5IM0B 2G1HA 1XR5A 3BQ0A 1GT0C 2YKOA 1KC8T 1S9FA 2RRNA 3I56S 3LP1B 1U1QA 5HBMB 3SCLE 1U3EM 2WW4A 1R4MB 2R9LA 3NAHA 2X9DA 2UV8G 4F4WA 1HIYA 3QWLA 5K5MA 5LGUA 1DQ9A 5E79C 3F22A 1NB2A 1XWLA 3MD2A 4KA4A 2DQLA 2F5DA 4F02A 2CADA 2XAQA 3MZYA 3V81B 4MFBB 2WAFA 2XZWA 3DN9A 3OS2A 1OY8A 5EF6A 4IXAA 1Z21A 3WTWC 3ABUA 4WXCA 2OF7A 1RESA 4M5GA 6FDRA 4ANDA 1JJCB 1U2RA 5HQMA 3VVUA 2OPTA 1EKSA 4DQQA 2XSJA 5KFRA 4RBTA 2HYIB 3H35A 3KHLA 3P8BB 2R8HA 5J2PA 3TJ8A 2QEXI 2Q43A 1K1QA 2Y1JA 2YBVA 3V4GA 5DS9A 3QT8A 3K8VA 2YH1A 1NAQA 3E5QA 3G3ZA 3DDIA 1RR8C 3CP8A 4NCBA 3FIWA 1RABB 3JQJA 4DQRA 3KJQB 2PJRA 2BZ2A 3PV8A 1Y3KA 1A7GE 4OLPA 5K1YA 2CJYB 3BDDA 3PIPF 2L7KA 1X5SA 5C4XJ 2KDOA 5L1LA 1ZETA 2DO4A 3JSMA 1VQLS 3CESA 4IEJA 3AJ2A 1Y0UA 2FHJD 2X1FA