2DBDA

Solution structure of the card domain in human caspase recruitment domain protein 4 (nod1 protein)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GSSGSSGHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the CARD domain in human caspase recruitment domain protein 4 (Nod1 protein)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Caspase recruitment domain protein 4
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2dbdA00
3QF2A 4N1KA 4EWIA 3J63A 1Z6TA 4DWNA 4LWDA 1PN5A 3YGSP 2M5VA 2N1FA 2N83A 2MB9A 4RHWE 2MN4A 4I16A 2DO9A 1E41A 2OF5A 1DGNA 1C15A 4M9ZA 4P4HI 1D2ZB 4N1LA 1N3KA 1YGOA 4A2WA 1WMGA 1FADA 2MPCA 1A1ZA 4A2QA 4O9FA 2MS8A 2P1HA 2DBDA 4UZ0A 4QOBA 3YGSC 3EZQA 3LQQA 2OF5H 2YVIA 3KATA 2NAQA 1D2ZA 3CRDA 3LQRA 4M9XA 2HM2Q 2NSNA 4FH0A 2MS7A 2KN6A 4M9SA 2L9MA 4JQWA 1ICHA 2N80A 4NQKA 2LWDA 1DDFA 4O9LA 1CY5A 3T6PA 1CWWA 2N00A 2D96A 2BBZA 4IZ5E 2VGQA 4E9MA 4F44A 1A1WA 1WXPA 1WH4A 3MOPG 2N7ZA 2DBGA 4ZBWA 1UCPA 2NZ7A 2YU0A 4RHWA 4O7QA 2A5YB 3CL3A 2KM6A 2O71A 3EZQB 4IZAB 4N1JA 2A9IA 2F1SA 2DBHA 2YQFA 4JUPA 2IB1A 3MOPK 2G7RA 2LS7A 3MOPA 4F42A 4IZ7B 3J6JA 2BBRA 4O6XA 4D8OA 2GF5A 2N97A 2YGSA 2L6AA 4P4HA 2DBFA 1E3YA 2LWEA 1NGRA 2B1WA
chains in the Genus database with same CATH superfamily
3QF2A 4N1KA 4EWIA 3J63A 1Z6TA 4DWNA 4LWDA 1PN5A 3YGSP 2M5VA 2N1FA 2N83A 2MB9A 4RHWE 2MN4A 4I16A 2DO9A 1E41A 2OF5A 1DGNA 1C15A 4M9ZA 4P4HI 1D2ZB 4N1LA 1N3KA 1YGOA 4A2WA 1WMGA 1FADA 2MPCA 1A1ZA 4A2QA 4O9FA 2MS8A 2P1HA 2DBDA 4UZ0A 4QOBA 3YGSC 3EZQA 3LQQA 2OF5H 2YVIA 3KATA 2NAQA 1D2ZA 3CRDA 3LQRA 4M9XA 2HM2Q 2NSNA 4FH0A 2MS7A 2KN6A 4M9SA 2L9MA 4JQWA 1ICHA 2N80A 4NQKA 2LWDA 1DDFA 4O9LA 1CY5A 3T6PA 1CWWA 2N00A 2D96A 2BBZA 4IZ5E 2VGQA 4E9MA 4F44A 2XV9A 1A1WA 1WXPA 1WH4A 3MOPG 2N7ZA 2DBGA 4ZBWA 1UCPA 2NZ7A 2YU0A 4RHWA 4O7QA 2A5YB 3CL3A 2KM6A 2O71A 3EZQB 4IZAB 4N1JA 2A9IA 2F1SA 2DBHA 2YQFA 4JUPA 2IB1A 3MOPK 2G7RA 2LS7A 3MOPA 4F42A 4IZ7B 3J6JA 2BBRA 4O6XA 4D8OA 2GF5A 2N97A 2YGSA 2L6AA 2MJMA 4P4HA 2DBFA 1E3YA 2LWEA 1NGRA 2B1WA
chains in the Genus database with same CATH topology
3QF2A 4N1KA 4EWIA 3J63A 1Z6TA 4DWNA 4LWDA 1PN5A 3YGSP 2M5VA 2N1FA 2N83A 2MB9A 4RHWE 2MN4A 4I16A 2DO9A 1E41A 2OF5A 1DGNA 1C15A 4M9ZA 4P4HI 1D2ZB 4N1LA 1N3KA 1YGOA 4A2WA 1WMGA 1FADA 2MPCA 1A1ZA 4A2QA 4O9FA 2MS8A 2P1HA 2DBDA 4UZ0A 4QOBA 3YGSC 3EZQA 3LQQA 2OF5H 2YVIA 3KATA 2NAQA 1D2ZA 3CRDA 3LQRA 4M9XA 2HM2Q 2NSNA 4FH0A 2MS7A 2KN6A 4M9SA 2L9MA 4JQWA 1ICHA 2N80A 4NQKA 2LWDA 1DDFA 4O9LA 1CY5A 3T6PA 1CWWA 2N00A 2D96A 2BBZA 4IZ5E 2VGQA 4E9MA 4F44A 2XV9A 1A1WA 1WXPA 1WH4A 3MOPG 2N7ZA 2DBGA 4ZBWA 1UCPA 2NZ7A 2YU0A 4RHWA 4O7QA 2A5YB 3CL3A 2KM6A 2O71A 3EZQB 4IZAB 4N1JA 2A9IA 2F1SA 2DBHA 2YQFA 4JUPA 2IB1A 3MOPK 2G7RA 2LS7A 3MOPA 4F42A 4IZ7B 3J6JA 2BBRA 4O6XA 4D8OA 2GF5A 2N97A 2YGSA 2L6AA 2MJMA 4P4HA 2DBFA 1E3YA 2LWEA 1NGRA 2B1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QF2 A;  4N1K A;  4EWI A;  3J63 A;  1Z6T A;  4DWN A;  4LWD A;  1PN5 A;  3YGS P;  2M5V A;  2N1F A;  2N83 A;  2MB9 A;  4RHW E;  2MN4 A;  4I16 A;  2DO9 A;  1E41 A;  2OF5 A;  1DGN A;  1C15 A;  4M9Z A;  4P4H I;  1D2Z B;  4N1L A;  1N3K A;  1YGO A;  4A2W A;  1WMG A;  1FAD A;  2MPC A;  1A1Z A;  4A2Q A;  4O9F A;  2MS8 A;  2P1H A;  2DBD A;  4UZ0 A;  4QOB A;  3YGS C;  3EZQ A;  3LQQ A;  2OF5 H;  2YVI A;  3KAT A;  2NAQ A;  1D2Z A;  3CRD A;  3LQR A;  4M9X A;  2HM2 Q;  2NSN A;  4FH0 A;  2MS7 A;  2KN6 A;  4M9S A;  2L9M A;  4JQW A;  1ICH A;  2N80 A;  4NQK A;  2LWD A;  1DDF A;  4O9L A;  1CY5 A;  3T6P A;  1CWW A;  2N00 A;  2D96 A;  2BBZ A;  4IZ5 E;  2VGQ A;  4E9M A;  4F44 A;  1A1W A;  1WXP A;  1WH4 A;  3MOP G;  2N7Z A;  2DBG A;  4ZBW A;  1UCP A;  2NZ7 A;  2YU0 A;  4RHW A;  4O7Q A;  2A5Y B;  3CL3 A;  2KM6 A;  2O71 A;  3EZQ B;  4IZA B;  4N1J A;  2A9I A;  2F1S A;  2DBH A;  2YQF A;  4JUP A;  2IB1 A;  3MOP K;  2G7R A;  2LS7 A;  3MOP A;  4F42 A;  4IZ7 B;  3J6J A;  2BBR A;  4O6X A;  4D8O A;  2GF5 A;  2N97 A;  2YGS A;  2L6A A;  4P4H A;  2DBF A;  1E3Y A;  2LWE A;  1NGR A;  2B1W A; 
#chains in the Genus database with same CATH topology
 3QF2 A;  4N1K A;  4EWI A;  3J63 A;  1Z6T A;  4DWN A;  4LWD A;  1PN5 A;  3YGS P;  2M5V A;  2N1F A;  2N83 A;  2MB9 A;  4RHW E;  2MN4 A;  4I16 A;  2DO9 A;  1E41 A;  2OF5 A;  1DGN A;  1C15 A;  4M9Z A;  4P4H I;  1D2Z B;  4N1L A;  1N3K A;  1YGO A;  4A2W A;  1WMG A;  1FAD A;  2MPC A;  1A1Z A;  4A2Q A;  4O9F A;  2MS8 A;  2P1H A;  2DBD A;  4UZ0 A;  4QOB A;  3YGS C;  3EZQ A;  3LQQ A;  2OF5 H;  2YVI A;  3KAT A;  2NAQ A;  1D2Z A;  3CRD A;  3LQR A;  4M9X A;  2HM2 Q;  2NSN A;  4FH0 A;  2MS7 A;  2KN6 A;  4M9S A;  2L9M A;  4JQW A;  1ICH A;  2N80 A;  4NQK A;  2LWD A;  1DDF A;  4O9L A;  1CY5 A;  3T6P A;  1CWW A;  2N00 A;  2D96 A;  2BBZ A;  4IZ5 E;  2VGQ A;  4E9M A;  4F44 A;  2XV9 A;  1A1W A;  1WXP A;  1WH4 A;  3MOP G;  2N7Z A;  2DBG A;  4ZBW A;  1UCP A;  2NZ7 A;  2YU0 A;  4RHW A;  4O7Q A;  2A5Y B;  3CL3 A;  2KM6 A;  2O71 A;  3EZQ B;  4IZA B;  4N1J A;  2A9I A;  2F1S A;  2DBH A;  2YQF A;  4JUP A;  2IB1 A;  3MOP K;  2G7R A;  2LS7 A;  3MOP A;  4F42 A;  4IZ7 B;  3J6J A;  2BBR A;  4O6X A;  4D8O A;  2GF5 A;  2N97 A;  2YGS A;  2L6A A;  2MJM A;  4P4H A;  2DBF A;  1E3Y A;  2LWE A;  1NGR A;  2B1W A; 
#chains in the Genus database with same CATH homology
 3QF2 A;  4N1K A;  4EWI A;  3J63 A;  1Z6T A;  4DWN A;  4LWD A;  1PN5 A;  3YGS P;  2M5V A;  2N1F A;  2N83 A;  2MB9 A;  4RHW E;  2MN4 A;  4I16 A;  2DO9 A;  1E41 A;  2OF5 A;  1DGN A;  1C15 A;  4M9Z A;  4P4H I;  1D2Z B;  4N1L A;  1N3K A;  1YGO A;  4A2W A;  1WMG A;  1FAD A;  2MPC A;  1A1Z A;  4A2Q A;  4O9F A;  2MS8 A;  2P1H A;  2DBD A;  4UZ0 A;  4QOB A;  3YGS C;  3EZQ A;  3LQQ A;  2OF5 H;  2YVI A;  3KAT A;  2NAQ A;  1D2Z A;  3CRD A;  3LQR A;  4M9X A;  2HM2 Q;  2NSN A;  4FH0 A;  2MS7 A;  2KN6 A;  4M9S A;  2L9M A;  4JQW A;  1ICH A;  2N80 A;  4NQK A;  2LWD A;  1DDF A;  4O9L A;  1CY5 A;  3T6P A;  1CWW A;  2N00 A;  2D96 A;  2BBZ A;  4IZ5 E;  2VGQ A;  4E9M A;  4F44 A;  2XV9 A;  1A1W A;  1WXP A;  1WH4 A;  3MOP G;  2N7Z A;  2DBG A;  4ZBW A;  1UCP A;  2NZ7 A;  2YU0 A;  4RHW A;  4O7Q A;  2A5Y B;  3CL3 A;  2KM6 A;  2O71 A;  3EZQ B;  4IZA B;  4N1J A;  2A9I A;  2F1S A;  2DBH A;  2YQF A;  4JUP A;  2IB1 A;  3MOP K;  2G7R A;  2LS7 A;  3MOP A;  4F42 A;  4IZ7 B;  3J6J A;  2BBR A;  4O6X A;  4D8O A;  2GF5 A;  2N97 A;  2YGS A;  2L6A A;  2MJM A;  4P4H A;  2DBF A;  1E3Y A;  2LWE A;  1NGR A;  2B1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...