2DBDA

Solution structure of the card domain in human caspase recruitment domain protein 4 (nod1 protein)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GSSGSSGHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the CARD domain in human caspase recruitment domain protein 4 (Nod1 protein)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Caspase recruitment domain protein 4
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2dbdA00
2N97A 4IZ7B 1ICHA 2DBDA 4P4HI 4QOBA 3YGSP 2DBGA 1NGRA 2DO9A 2BBZA 1D2ZB 4M9SA 2KM6A 2KN6A 2MN4A 2YU0A 1WMGA 2NAQA 2MS8A 4A2QA 2A9IA 1CY5A 3YGSC 4N1KA 2MPCA 1Z6TA 1PN5A 4UZ0A 1D2ZA 2N80A 2OF5H 2LWDA 1CWWA 4A2WA 2M5VA 2N1FA 4N1JA 1E3YA 3EZQB 4IZ5E 4D8OA 2YGSA 1UCPA 2LWEA 4O9LA 2HM2Q 1A1WA 4O7QA 2NZ7A 3KATA 2DBFA 3CL3A 2NSNA 4JUPA 4RHWA 4ZBWA 4M9ZA 3MOPG 3QF2A 4LWDA 1DDFA 4I16A 3J6JA 4JQWA 4N1LA 2GF5A 2L6AA 4O6XA 3MOPA 4O9FA 1WXPA 4EWIA 4DWNA 2YVIA 2MS7A 2N7ZA 2VGQA 2G7RA 3T6PA 2N83A 1N3KA 4F42A 1DGNA 3LQRA 2LS7A 1YGOA 2IB1A 2BBRA 4NQKA 3LQQA 2A5YB 2B1WA 2YQFA 4RHWE 3MOPK 2P1HA 4E9MA 4FH0A 1FADA 2OF5A 1A1ZA 3CRDA 2N00A 2O71A 3J63A 3EZQA 4M9XA 2DBHA 2L9MA 1E41A 1WH4A 1C15A 2F1SA 2D96A 4F44A 4P4HA 4IZAB 2MB9A
chains in the Genus database with same CATH superfamily
2N97A 4IZ7B 1ICHA 2DBDA 4P4HI 4QOBA 3YGSP 2DBGA 1NGRA 2DO9A 2BBZA 1D2ZB 4M9SA 2KM6A 2KN6A 2MN4A 2YU0A 1WMGA 2NAQA 2MS8A 4A2QA 2A9IA 1CY5A 3YGSC 4N1KA 2MPCA 1Z6TA 1PN5A 4UZ0A 1D2ZA 2N80A 2OF5H 2LWDA 1CWWA 4A2WA 2M5VA 2XV9A 2N1FA 4N1JA 2MJMA 1E3YA 3EZQB 4IZ5E 4D8OA 2YGSA 1UCPA 2LWEA 4O9LA 2HM2Q 1A1WA 4O7QA 2NZ7A 3KATA 2DBFA 3CL3A 2NSNA 4JUPA 4RHWA 4ZBWA 4M9ZA 3MOPG 3QF2A 4LWDA 1DDFA 4I16A 3J6JA 4JQWA 4N1LA 2GF5A 2L6AA 4O6XA 3MOPA 4O9FA 1WXPA 4EWIA 4DWNA 2YVIA 2MS7A 2N7ZA 2VGQA 2G7RA 3T6PA 2N83A 1N3KA 4F42A 1DGNA 3LQRA 2LS7A 1YGOA 2IB1A 2BBRA 4NQKA 3LQQA 2A5YB 2B1WA 2YQFA 4RHWE 3MOPK 2P1HA 4E9MA 4FH0A 1FADA 2OF5A 1A1ZA 3CRDA 2N00A 2O71A 3J63A 3EZQA 4M9XA 2DBHA 2L9MA 1E41A 1WH4A 1C15A 2F1SA 2D96A 4F44A 4P4HA 4IZAB 2MB9A
chains in the Genus database with same CATH topology
2N97A 4IZ7B 1ICHA 2DBDA 4P4HI 4QOBA 3YGSP 2DBGA 1NGRA 2DO9A 2BBZA 1D2ZB 4M9SA 2KM6A 2KN6A 2MN4A 2YU0A 1WMGA 2NAQA 2MS8A 4A2QA 2A9IA 1CY5A 3YGSC 4N1KA 2MPCA 1Z6TA 1PN5A 4UZ0A 1D2ZA 2N80A 2OF5H 2LWDA 1CWWA 4A2WA 2M5VA 2XV9A 2N1FA 4N1JA 2MJMA 1E3YA 3EZQB 4IZ5E 4D8OA 2YGSA 1UCPA 2LWEA 4O9LA 2HM2Q 1A1WA 4O7QA 2NZ7A 3KATA 2DBFA 3CL3A 2NSNA 4JUPA 4RHWA 4ZBWA 4M9ZA 3MOPG 3QF2A 4LWDA 1DDFA 4I16A 3J6JA 4JQWA 4N1LA 2GF5A 2L6AA 4O6XA 3MOPA 4O9FA 1WXPA 4EWIA 4DWNA 2YVIA 2MS7A 2N7ZA 2VGQA 2G7RA 3T6PA 2N83A 1N3KA 4F42A 1DGNA 3LQRA 2LS7A 1YGOA 2IB1A 2BBRA 4NQKA 3LQQA 2A5YB 2B1WA 2YQFA 4RHWE 3MOPK 2P1HA 4E9MA 4FH0A 1FADA 2OF5A 1A1ZA 3CRDA 2N00A 2O71A 3J63A 3EZQA 4M9XA 2DBHA 2L9MA 1E41A 1WH4A 1C15A 2F1SA 2D96A 4F44A 4P4HA 4IZAB 2MB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N97 A;  4IZ7 B;  1ICH A;  2DBD A;  4P4H I;  4QOB A;  3YGS P;  2DBG A;  1NGR A;  2DO9 A;  2BBZ A;  1D2Z B;  4M9S A;  2KM6 A;  2KN6 A;  2MN4 A;  2YU0 A;  1WMG A;  2NAQ A;  2MS8 A;  4A2Q A;  2A9I A;  1CY5 A;  3YGS C;  4N1K A;  2MPC A;  1Z6T A;  1PN5 A;  4UZ0 A;  1D2Z A;  2N80 A;  2OF5 H;  2LWD A;  1CWW A;  4A2W A;  2M5V A;  2N1F A;  4N1J A;  1E3Y A;  3EZQ B;  4IZ5 E;  4D8O A;  2YGS A;  1UCP A;  2LWE A;  4O9L A;  2HM2 Q;  1A1W A;  4O7Q A;  2NZ7 A;  3KAT A;  2DBF A;  3CL3 A;  2NSN A;  4JUP A;  4RHW A;  4ZBW A;  4M9Z A;  3MOP G;  3QF2 A;  4LWD A;  1DDF A;  4I16 A;  3J6J A;  4JQW A;  4N1L A;  2GF5 A;  2L6A A;  4O6X A;  3MOP A;  4O9F A;  1WXP A;  4EWI A;  4DWN A;  2YVI A;  2MS7 A;  2N7Z A;  2VGQ A;  2G7R A;  3T6P A;  2N83 A;  1N3K A;  4F42 A;  1DGN A;  3LQR A;  2LS7 A;  1YGO A;  2IB1 A;  2BBR A;  4NQK A;  3LQQ A;  2A5Y B;  2B1W A;  2YQF A;  4RHW E;  3MOP K;  2P1H A;  4E9M A;  4FH0 A;  1FAD A;  2OF5 A;  1A1Z A;  3CRD A;  2N00 A;  2O71 A;  3J63 A;  3EZQ A;  4M9X A;  2DBH A;  2L9M A;  1E41 A;  1WH4 A;  1C15 A;  2F1S A;  2D96 A;  4F44 A;  4P4H A;  4IZA B;  2MB9 A; 
#chains in the Genus database with same CATH topology
 2N97 A;  4IZ7 B;  1ICH A;  2DBD A;  4P4H I;  4QOB A;  3YGS P;  2DBG A;  1NGR A;  2DO9 A;  2BBZ A;  1D2Z B;  4M9S A;  2KM6 A;  2KN6 A;  2MN4 A;  2YU0 A;  1WMG A;  2NAQ A;  2MS8 A;  4A2Q A;  2A9I A;  1CY5 A;  3YGS C;  4N1K A;  2MPC A;  1Z6T A;  1PN5 A;  4UZ0 A;  1D2Z A;  2N80 A;  2OF5 H;  2LWD A;  1CWW A;  4A2W A;  2M5V A;  2XV9 A;  2N1F A;  4N1J A;  2MJM A;  1E3Y A;  3EZQ B;  4IZ5 E;  4D8O A;  2YGS A;  1UCP A;  2LWE A;  4O9L A;  2HM2 Q;  1A1W A;  4O7Q A;  2NZ7 A;  3KAT A;  2DBF A;  3CL3 A;  2NSN A;  4JUP A;  4RHW A;  4ZBW A;  4M9Z A;  3MOP G;  3QF2 A;  4LWD A;  1DDF A;  4I16 A;  3J6J A;  4JQW A;  4N1L A;  2GF5 A;  2L6A A;  4O6X A;  3MOP A;  4O9F A;  1WXP A;  4EWI A;  4DWN A;  2YVI A;  2MS7 A;  2N7Z A;  2VGQ A;  2G7R A;  3T6P A;  2N83 A;  1N3K A;  4F42 A;  1DGN A;  3LQR A;  2LS7 A;  1YGO A;  2IB1 A;  2BBR A;  4NQK A;  3LQQ A;  2A5Y B;  2B1W A;  2YQF A;  4RHW E;  3MOP K;  2P1H A;  4E9M A;  4FH0 A;  1FAD A;  2OF5 A;  1A1Z A;  3CRD A;  2N00 A;  2O71 A;  3J63 A;  3EZQ A;  4M9X A;  2DBH A;  2L9M A;  1E41 A;  1WH4 A;  1C15 A;  2F1S A;  2D96 A;  4F44 A;  4P4H A;  4IZA B;  2MB9 A; 
#chains in the Genus database with same CATH homology
 2N97 A;  4IZ7 B;  1ICH A;  2DBD A;  4P4H I;  4QOB A;  3YGS P;  2DBG A;  1NGR A;  2DO9 A;  2BBZ A;  1D2Z B;  4M9S A;  2KM6 A;  2KN6 A;  2MN4 A;  2YU0 A;  1WMG A;  2NAQ A;  2MS8 A;  4A2Q A;  2A9I A;  1CY5 A;  3YGS C;  4N1K A;  2MPC A;  1Z6T A;  1PN5 A;  4UZ0 A;  1D2Z A;  2N80 A;  2OF5 H;  2LWD A;  1CWW A;  4A2W A;  2M5V A;  2XV9 A;  2N1F A;  4N1J A;  2MJM A;  1E3Y A;  3EZQ B;  4IZ5 E;  4D8O A;  2YGS A;  1UCP A;  2LWE A;  4O9L A;  2HM2 Q;  1A1W A;  4O7Q A;  2NZ7 A;  3KAT A;  2DBF A;  3CL3 A;  2NSN A;  4JUP A;  4RHW A;  4ZBW A;  4M9Z A;  3MOP G;  3QF2 A;  4LWD A;  1DDF A;  4I16 A;  3J6J A;  4JQW A;  4N1L A;  2GF5 A;  2L6A A;  4O6X A;  3MOP A;  4O9F A;  1WXP A;  4EWI A;  4DWN A;  2YVI A;  2MS7 A;  2N7Z A;  2VGQ A;  2G7R A;  3T6P A;  2N83 A;  1N3K A;  4F42 A;  1DGN A;  3LQR A;  2LS7 A;  1YGO A;  2IB1 A;  2BBR A;  4NQK A;  3LQQ A;  2A5Y B;  2B1W A;  2YQF A;  4RHW E;  3MOP K;  2P1H A;  4E9M A;  4FH0 A;  1FAD A;  2OF5 A;  1A1Z A;  3CRD A;  2N00 A;  2O71 A;  3J63 A;  3EZQ A;  4M9X A;  2DBH A;  2L9M A;  1E41 A;  1WH4 A;  1C15 A;  2F1S A;  2D96 A;  4F44 A;  4P4H A;  4IZA B;  2MB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...