2DBGA

Solution structure of the pyrin (paad-dapin) domain in human myeloid cell nuclear differentiation antigen
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
GSSGSSGMVNEYKKILLLKGFELMDDYHFTSIKSLLAYDLGLTTKMQEEYNRIKITDLMEKKFQGVACLDKLIELAKDMPSLKNLVNNLRKEKSKVASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Pyrin (PAAD-DAPIN) domain in human Myeloid cell nuclear differentiation antigen
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Myeloid cell nuclear differentiation antigen
total genus 25
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2dbgA00
2NSNA 1FADA 2A9IA 2GF5A 2LS7A 1DDFA 3LQRA 1C15A 2MB9A 4IZ5E 2G7RA 4RHWA 2D96A 4N1KA 4A2QA 4A2WA 4F44A 1WMGA 1A1WA 3CL3A 2DO9A 1D2ZA 2DBHA 4P4HI 2YGSA 1E3YA 2MN4A 2N97A 2DBFA 2OF5A 2BBRA 2DBDA 1NGRA 2BBZA 4QOBA 1D2ZB 4IZ7B 4JQWA 4FH0A 4UZ0A 4LWDA 1PN5A 2MS7A 4JUPA 4M9SA 4O9LA 3YGSP 1Z6TA 2LWEA 3J6JA 2N80A 4E9MA 4F42A 2N7ZA 4I16A 2B1WA 3MOPK 2F1SA 1CWWA 4D8OA 4O7QA 3EZQB 2IB1A 2YU0A 3J63A 3MOPG 2M5VA 2NZ7A 4RHWE 4M9XA 2YVIA 2KN6A 3CRDA 1ICHA 3QF2A 1A1ZA 1N3KA 1E41A 1CY5A 2P1HA 4M9ZA 1WXPA 2N83A 3T6PA 4DWNA 3EZQA 2HM2Q 2A5YB 4O9FA 2N1FA 4P4HA 2LWDA 2VGQA 3MOPA 2O71A 1YGOA 3KATA 1DGNA 4EWIA 2NAQA 2KM6A 4IZAB 2L6AA 1WH4A 2OF5H 3LQQA 4O6XA 4N1JA 2YQFA 1UCPA 3YGSC 2DBGA 2MPCA 4N1LA 4NQKA 4ZBWA 2N00A 2L9MA 2MS8A
chains in the Genus database with same CATH superfamily
2NSNA 1FADA 2A9IA 2GF5A 2LS7A 1DDFA 3LQRA 1C15A 2MB9A 4IZ5E 2G7RA 4RHWA 2D96A 4N1KA 4A2QA 4A2WA 4F44A 1WMGA 1A1WA 3CL3A 2DO9A 1D2ZA 2DBHA 4P4HI 2YGSA 1E3YA 2MN4A 2N97A 2DBFA 2OF5A 2BBRA 2DBDA 2XV9A 1NGRA 2BBZA 4QOBA 1D2ZB 4IZ7B 4JQWA 4FH0A 4UZ0A 4LWDA 1PN5A 2MS7A 4JUPA 4M9SA 4O9LA 3YGSP 1Z6TA 2LWEA 3J6JA 2N80A 4E9MA 4F42A 2N7ZA 4I16A 2B1WA 3MOPK 2F1SA 1CWWA 4D8OA 4O7QA 3EZQB 2IB1A 2YU0A 3J63A 3MOPG 2M5VA 2NZ7A 4RHWE 4M9XA 2YVIA 2KN6A 3CRDA 1ICHA 3QF2A 1A1ZA 1N3KA 1E41A 1CY5A 2P1HA 4M9ZA 1WXPA 2N83A 3T6PA 4DWNA 3EZQA 2HM2Q 2A5YB 4O9FA 2N1FA 4P4HA 2LWDA 2VGQA 3MOPA 2O71A 1YGOA 3KATA 1DGNA 4EWIA 2NAQA 2KM6A 4IZAB 2L6AA 1WH4A 2OF5H 3LQQA 4O6XA 4N1JA 2YQFA 2MJMA 1UCPA 3YGSC 2DBGA 2MPCA 4N1LA 4NQKA 4ZBWA 2N00A 2L9MA 2MS8A
chains in the Genus database with same CATH topology
2NSNA 1FADA 2A9IA 2GF5A 2LS7A 1DDFA 3LQRA 1C15A 2MB9A 4IZ5E 2G7RA 4RHWA 2D96A 4N1KA 4A2QA 4A2WA 4F44A 1WMGA 1A1WA 3CL3A 2DO9A 1D2ZA 2DBHA 4P4HI 2YGSA 1E3YA 2MN4A 2N97A 2DBFA 2OF5A 2BBRA 2DBDA 2XV9A 1NGRA 2BBZA 4QOBA 1D2ZB 4IZ7B 4JQWA 4FH0A 4UZ0A 4LWDA 1PN5A 2MS7A 4JUPA 4M9SA 4O9LA 3YGSP 1Z6TA 2LWEA 3J6JA 2N80A 4E9MA 4F42A 2N7ZA 4I16A 2B1WA 3MOPK 2F1SA 1CWWA 4D8OA 4O7QA 3EZQB 2IB1A 2YU0A 3J63A 3MOPG 2M5VA 2NZ7A 4RHWE 4M9XA 2YVIA 2KN6A 3CRDA 1ICHA 3QF2A 1A1ZA 1N3KA 1E41A 1CY5A 2P1HA 4M9ZA 1WXPA 2N83A 3T6PA 4DWNA 3EZQA 2HM2Q 2A5YB 4O9FA 2N1FA 4P4HA 2LWDA 2VGQA 3MOPA 2O71A 1YGOA 3KATA 1DGNA 4EWIA 2NAQA 2KM6A 4IZAB 2L6AA 1WH4A 2OF5H 3LQQA 4O6XA 4N1JA 2YQFA 2MJMA 1UCPA 3YGSC 2DBGA 2MPCA 4N1LA 4NQKA 4ZBWA 2N00A 2L9MA 2MS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSN A;  1FAD A;  2A9I A;  2GF5 A;  2LS7 A;  1DDF A;  3LQR A;  1C15 A;  2MB9 A;  4IZ5 E;  2G7R A;  4RHW A;  2D96 A;  4N1K A;  4A2Q A;  4A2W A;  4F44 A;  1WMG A;  1A1W A;  3CL3 A;  2DO9 A;  1D2Z A;  2DBH A;  4P4H I;  2YGS A;  1E3Y A;  2MN4 A;  2N97 A;  2DBF A;  2OF5 A;  2BBR A;  2DBD A;  1NGR A;  2BBZ A;  4QOB A;  1D2Z B;  4IZ7 B;  4JQW A;  4FH0 A;  4UZ0 A;  4LWD A;  1PN5 A;  2MS7 A;  4JUP A;  4M9S A;  4O9L A;  3YGS P;  1Z6T A;  2LWE A;  3J6J A;  2N80 A;  4E9M A;  4F42 A;  2N7Z A;  4I16 A;  2B1W A;  3MOP K;  2F1S A;  1CWW A;  4D8O A;  4O7Q A;  3EZQ B;  2IB1 A;  2YU0 A;  3J63 A;  3MOP G;  2M5V A;  2NZ7 A;  4RHW E;  4M9X A;  2YVI A;  2KN6 A;  3CRD A;  1ICH A;  3QF2 A;  1A1Z A;  1N3K A;  1E41 A;  1CY5 A;  2P1H A;  4M9Z A;  1WXP A;  2N83 A;  3T6P A;  4DWN A;  3EZQ A;  2HM2 Q;  2A5Y B;  4O9F A;  2N1F A;  4P4H A;  2LWD A;  2VGQ A;  3MOP A;  2O71 A;  1YGO A;  3KAT A;  1DGN A;  4EWI A;  2NAQ A;  2KM6 A;  4IZA B;  2L6A A;  1WH4 A;  2OF5 H;  3LQQ A;  4O6X A;  4N1J A;  2YQF A;  1UCP A;  3YGS C;  2DBG A;  2MPC A;  4N1L A;  4NQK A;  4ZBW A;  2N00 A;  2L9M A;  2MS8 A; 
#chains in the Genus database with same CATH topology
 2NSN A;  1FAD A;  2A9I A;  2GF5 A;  2LS7 A;  1DDF A;  3LQR A;  1C15 A;  2MB9 A;  4IZ5 E;  2G7R A;  4RHW A;  2D96 A;  4N1K A;  4A2Q A;  4A2W A;  4F44 A;  1WMG A;  1A1W A;  3CL3 A;  2DO9 A;  1D2Z A;  2DBH A;  4P4H I;  2YGS A;  1E3Y A;  2MN4 A;  2N97 A;  2DBF A;  2OF5 A;  2BBR A;  2DBD A;  2XV9 A;  1NGR A;  2BBZ A;  4QOB A;  1D2Z B;  4IZ7 B;  4JQW A;  4FH0 A;  4UZ0 A;  4LWD A;  1PN5 A;  2MS7 A;  4JUP A;  4M9S A;  4O9L A;  3YGS P;  1Z6T A;  2LWE A;  3J6J A;  2N80 A;  4E9M A;  4F42 A;  2N7Z A;  4I16 A;  2B1W A;  3MOP K;  2F1S A;  1CWW A;  4D8O A;  4O7Q A;  3EZQ B;  2IB1 A;  2YU0 A;  3J63 A;  3MOP G;  2M5V A;  2NZ7 A;  4RHW E;  4M9X A;  2YVI A;  2KN6 A;  3CRD A;  1ICH A;  3QF2 A;  1A1Z A;  1N3K A;  1E41 A;  1CY5 A;  2P1H A;  4M9Z A;  1WXP A;  2N83 A;  3T6P A;  4DWN A;  3EZQ A;  2HM2 Q;  2A5Y B;  4O9F A;  2N1F A;  4P4H A;  2LWD A;  2VGQ A;  3MOP A;  2O71 A;  1YGO A;  3KAT A;  1DGN A;  4EWI A;  2NAQ A;  2KM6 A;  4IZA B;  2L6A A;  1WH4 A;  2OF5 H;  3LQQ A;  4O6X A;  4N1J A;  2YQF A;  2MJM A;  1UCP A;  3YGS C;  2DBG A;  2MPC A;  4N1L A;  4NQK A;  4ZBW A;  2N00 A;  2L9M A;  2MS8 A; 
#chains in the Genus database with same CATH homology
 2NSN A;  1FAD A;  2A9I A;  2GF5 A;  2LS7 A;  1DDF A;  3LQR A;  1C15 A;  2MB9 A;  4IZ5 E;  2G7R A;  4RHW A;  2D96 A;  4N1K A;  4A2Q A;  4A2W A;  4F44 A;  1WMG A;  1A1W A;  3CL3 A;  2DO9 A;  1D2Z A;  2DBH A;  4P4H I;  2YGS A;  1E3Y A;  2MN4 A;  2N97 A;  2DBF A;  2OF5 A;  2BBR A;  2DBD A;  2XV9 A;  1NGR A;  2BBZ A;  4QOB A;  1D2Z B;  4IZ7 B;  4JQW A;  4FH0 A;  4UZ0 A;  4LWD A;  1PN5 A;  2MS7 A;  4JUP A;  4M9S A;  4O9L A;  3YGS P;  1Z6T A;  2LWE A;  3J6J A;  2N80 A;  4E9M A;  4F42 A;  2N7Z A;  4I16 A;  2B1W A;  3MOP K;  2F1S A;  1CWW A;  4D8O A;  4O7Q A;  3EZQ B;  2IB1 A;  2YU0 A;  3J63 A;  3MOP G;  2M5V A;  2NZ7 A;  4RHW E;  4M9X A;  2YVI A;  2KN6 A;  3CRD A;  1ICH A;  3QF2 A;  1A1Z A;  1N3K A;  1E41 A;  1CY5 A;  2P1H A;  4M9Z A;  1WXP A;  2N83 A;  3T6P A;  4DWN A;  3EZQ A;  2HM2 Q;  2A5Y B;  4O9F A;  2N1F A;  4P4H A;  2LWD A;  2VGQ A;  3MOP A;  2O71 A;  1YGO A;  3KAT A;  1DGN A;  4EWI A;  2NAQ A;  2KM6 A;  4IZA B;  2L6A A;  1WH4 A;  2OF5 H;  3LQQ A;  4O6X A;  4N1J A;  2YQF A;  2MJM A;  1UCP A;  3YGS C;  2DBG A;  2MPC A;  4N1L A;  4NQK A;  4ZBW A;  2N00 A;  2L9M A;  2MS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...