2DBHA

Solution structure of the carboxyl-terminal card-like domain in human tnfr-related death receptor-6
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
102
Chain Sequence
GSSGSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIFDDMLHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the carboxyl-terminal CARD-like domain in human TNFR-related death receptor-6
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Tumor necrosis factor receptor superfamily member 21
total genus 20
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2dbhA01
1PN5A 1WH4A 2O71A 4N1JA 2NAQA 4I16A 2A9IA 4DWNA 3MOPG 3CL3A 3YGSC 2DBGA 2NZ7A 4RHWE 3J6JA 2MN4A 3MOPK 3CRDA 4N1KA 4NQKA 1D2ZB 2N97A 4O9FA 3EZQA 4F42A 2G7RA 4O7QA 1CY5A 4P4HA 1A1WA 2N80A 2LWEA 4JUPA 4O9LA 2A5YB 2OF5H 3LQQA 1DDFA 1CWWA 2YU0A 3YGSP 2MB9A 1ICHA 2M5VA 4E9MA 1YGOA 2BBRA 1DGNA 3EZQB 2MPCA 4UZ0A 3LQRA 4ZBWA 4EWIA 4M9SA 4FH0A 2HM2Q 2P1HA 2DBDA 1Z6TA 1WMGA 2L9MA 2F1SA 2N7ZA 2YGSA 4O6XA 3T6PA 3QF2A 3MOPA 1E3YA 4D8OA 2MS8A 2MS7A 2OF5A 2LWDA 1A1ZA 2LS7A 2B1WA 2BBZA 2YVIA 4IZ5E 1E41A 4IZAB 2KM6A 4A2WA 2DBFA 3J63A 4M9XA 2NSNA 1N3KA 1UCPA 2YQFA 2L6AA 2D96A 2VGQA 4JQWA 4QOBA 1WXPA 3KATA 4A2QA 4IZ7B 1D2ZA 4P4HI 2IB1A 1C15A 1NGRA 2N83A 4N1LA 2KN6A 2DBHA 4LWDA 4RHWA 2N00A 4F44A 2N1FA 4M9ZA 2GF5A 1FADA 2DO9A
chains in the Genus database with same CATH superfamily
1PN5A 1WH4A 2O71A 4N1JA 2NAQA 4I16A 2A9IA 4DWNA 3MOPG 3CL3A 3YGSC 2DBGA 2NZ7A 4RHWE 3J6JA 2MN4A 3MOPK 3CRDA 4N1KA 4NQKA 1D2ZB 2N97A 4O9FA 3EZQA 4F42A 2G7RA 4O7QA 1CY5A 4P4HA 1A1WA 2N80A 2LWEA 4JUPA 4O9LA 2A5YB 2OF5H 3LQQA 1DDFA 1CWWA 2YU0A 3YGSP 2MB9A 1ICHA 2M5VA 4E9MA 1YGOA 2BBRA 1DGNA 3EZQB 2MPCA 4UZ0A 3LQRA 4ZBWA 4EWIA 4M9SA 4FH0A 2HM2Q 2P1HA 2DBDA 1Z6TA 1WMGA 2L9MA 2F1SA 2N7ZA 2YGSA 4O6XA 3T6PA 3QF2A 3MOPA 1E3YA 4D8OA 2MS8A 2MS7A 2OF5A 2LWDA 1A1ZA 2MJMA 2LS7A 2B1WA 2BBZA 2YVIA 4IZ5E 1E41A 4IZAB 2KM6A 4A2WA 2DBFA 3J63A 4M9XA 2NSNA 1N3KA 1UCPA 2YQFA 2L6AA 2D96A 2VGQA 4JQWA 4QOBA 1WXPA 3KATA 4A2QA 4IZ7B 1D2ZA 4P4HI 2IB1A 1C15A 1NGRA 2N83A 4N1LA 2KN6A 2DBHA 4LWDA 4RHWA 2N00A 2XV9A 4F44A 2N1FA 4M9ZA 2GF5A 1FADA 2DO9A
chains in the Genus database with same CATH topology
1PN5A 1WH4A 2O71A 4N1JA 2NAQA 4I16A 2A9IA 4DWNA 3MOPG 3CL3A 3YGSC 2DBGA 2NZ7A 4RHWE 3J6JA 2MN4A 3MOPK 3CRDA 4N1KA 4NQKA 1D2ZB 2N97A 4O9FA 3EZQA 4F42A 2G7RA 4O7QA 1CY5A 4P4HA 1A1WA 2N80A 2LWEA 4JUPA 4O9LA 2A5YB 2OF5H 3LQQA 1DDFA 1CWWA 2YU0A 3YGSP 2MB9A 1ICHA 2M5VA 4E9MA 1YGOA 2BBRA 1DGNA 3EZQB 2MPCA 4UZ0A 3LQRA 4ZBWA 4EWIA 4M9SA 4FH0A 2HM2Q 2P1HA 2DBDA 1Z6TA 1WMGA 2L9MA 2F1SA 2N7ZA 2YGSA 4O6XA 3T6PA 3QF2A 3MOPA 1E3YA 4D8OA 2MS8A 2MS7A 2OF5A 2LWDA 1A1ZA 2MJMA 2LS7A 2B1WA 2BBZA 2YVIA 4IZ5E 1E41A 4IZAB 2KM6A 4A2WA 2DBFA 3J63A 4M9XA 2NSNA 1N3KA 1UCPA 2YQFA 2L6AA 2D96A 2VGQA 4JQWA 4QOBA 1WXPA 3KATA 4A2QA 4IZ7B 1D2ZA 4P4HI 2IB1A 1C15A 1NGRA 2N83A 4N1LA 2KN6A 2DBHA 4LWDA 4RHWA 2N00A 2XV9A 4F44A 2N1FA 4M9ZA 2GF5A 1FADA 2DO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PN5 A;  1WH4 A;  2O71 A;  4N1J A;  2NAQ A;  4I16 A;  2A9I A;  4DWN A;  3MOP G;  3CL3 A;  3YGS C;  2DBG A;  2NZ7 A;  4RHW E;  3J6J A;  2MN4 A;  3MOP K;  3CRD A;  4N1K A;  4NQK A;  1D2Z B;  2N97 A;  4O9F A;  3EZQ A;  4F42 A;  2G7R A;  4O7Q A;  1CY5 A;  4P4H A;  1A1W A;  2N80 A;  2LWE A;  4JUP A;  4O9L A;  2A5Y B;  2OF5 H;  3LQQ A;  1DDF A;  1CWW A;  2YU0 A;  3YGS P;  2MB9 A;  1ICH A;  2M5V A;  4E9M A;  1YGO A;  2BBR A;  1DGN A;  3EZQ B;  2MPC A;  4UZ0 A;  3LQR A;  4ZBW A;  4EWI A;  4M9S A;  4FH0 A;  2HM2 Q;  2P1H A;  2DBD A;  1Z6T A;  1WMG A;  2L9M A;  2F1S A;  2N7Z A;  2YGS A;  4O6X A;  3T6P A;  3QF2 A;  3MOP A;  1E3Y A;  4D8O A;  2MS8 A;  2MS7 A;  2OF5 A;  2LWD A;  1A1Z A;  2LS7 A;  2B1W A;  2BBZ A;  2YVI A;  4IZ5 E;  1E41 A;  4IZA B;  2KM6 A;  4A2W A;  2DBF A;  3J63 A;  4M9X A;  2NSN A;  1N3K A;  1UCP A;  2YQF A;  2L6A A;  2D96 A;  2VGQ A;  4JQW A;  4QOB A;  1WXP A;  3KAT A;  4A2Q A;  4IZ7 B;  1D2Z A;  4P4H I;  2IB1 A;  1C15 A;  1NGR A;  2N83 A;  4N1L A;  2KN6 A;  2DBH A;  4LWD A;  4RHW A;  2N00 A;  4F44 A;  2N1F A;  4M9Z A;  2GF5 A;  1FAD A;  2DO9 A; 
#chains in the Genus database with same CATH topology
 1PN5 A;  1WH4 A;  2O71 A;  4N1J A;  2NAQ A;  4I16 A;  2A9I A;  4DWN A;  3MOP G;  3CL3 A;  3YGS C;  2DBG A;  2NZ7 A;  4RHW E;  3J6J A;  2MN4 A;  3MOP K;  3CRD A;  4N1K A;  4NQK A;  1D2Z B;  2N97 A;  4O9F A;  3EZQ A;  4F42 A;  2G7R A;  4O7Q A;  1CY5 A;  4P4H A;  1A1W A;  2N80 A;  2LWE A;  4JUP A;  4O9L A;  2A5Y B;  2OF5 H;  3LQQ A;  1DDF A;  1CWW A;  2YU0 A;  3YGS P;  2MB9 A;  1ICH A;  2M5V A;  4E9M A;  1YGO A;  2BBR A;  1DGN A;  3EZQ B;  2MPC A;  4UZ0 A;  3LQR A;  4ZBW A;  4EWI A;  4M9S A;  4FH0 A;  2HM2 Q;  2P1H A;  2DBD A;  1Z6T A;  1WMG A;  2L9M A;  2F1S A;  2N7Z A;  2YGS A;  4O6X A;  3T6P A;  3QF2 A;  3MOP A;  1E3Y A;  4D8O A;  2MS8 A;  2MS7 A;  2OF5 A;  2LWD A;  1A1Z A;  2MJM A;  2LS7 A;  2B1W A;  2BBZ A;  2YVI A;  4IZ5 E;  1E41 A;  4IZA B;  2KM6 A;  4A2W A;  2DBF A;  3J63 A;  4M9X A;  2NSN A;  1N3K A;  1UCP A;  2YQF A;  2L6A A;  2D96 A;  2VGQ A;  4JQW A;  4QOB A;  1WXP A;  3KAT A;  4A2Q A;  4IZ7 B;  1D2Z A;  4P4H I;  2IB1 A;  1C15 A;  1NGR A;  2N83 A;  4N1L A;  2KN6 A;  2DBH A;  4LWD A;  4RHW A;  2N00 A;  2XV9 A;  4F44 A;  2N1F A;  4M9Z A;  2GF5 A;  1FAD A;  2DO9 A; 
#chains in the Genus database with same CATH homology
 1PN5 A;  1WH4 A;  2O71 A;  4N1J A;  2NAQ A;  4I16 A;  2A9I A;  4DWN A;  3MOP G;  3CL3 A;  3YGS C;  2DBG A;  2NZ7 A;  4RHW E;  3J6J A;  2MN4 A;  3MOP K;  3CRD A;  4N1K A;  4NQK A;  1D2Z B;  2N97 A;  4O9F A;  3EZQ A;  4F42 A;  2G7R A;  4O7Q A;  1CY5 A;  4P4H A;  1A1W A;  2N80 A;  2LWE A;  4JUP A;  4O9L A;  2A5Y B;  2OF5 H;  3LQQ A;  1DDF A;  1CWW A;  2YU0 A;  3YGS P;  2MB9 A;  1ICH A;  2M5V A;  4E9M A;  1YGO A;  2BBR A;  1DGN A;  3EZQ B;  2MPC A;  4UZ0 A;  3LQR A;  4ZBW A;  4EWI A;  4M9S A;  4FH0 A;  2HM2 Q;  2P1H A;  2DBD A;  1Z6T A;  1WMG A;  2L9M A;  2F1S A;  2N7Z A;  2YGS A;  4O6X A;  3T6P A;  3QF2 A;  3MOP A;  1E3Y A;  4D8O A;  2MS8 A;  2MS7 A;  2OF5 A;  2LWD A;  1A1Z A;  2MJM A;  2LS7 A;  2B1W A;  2BBZ A;  2YVI A;  4IZ5 E;  1E41 A;  4IZA B;  2KM6 A;  4A2W A;  2DBF A;  3J63 A;  4M9X A;  2NSN A;  1N3K A;  1UCP A;  2YQF A;  2L6A A;  2D96 A;  2VGQ A;  4JQW A;  4QOB A;  1WXP A;  3KAT A;  4A2Q A;  4IZ7 B;  1D2Z A;  4P4H I;  2IB1 A;  1C15 A;  1NGR A;  2N83 A;  4N1L A;  2KN6 A;  2DBH A;  4LWD A;  4RHW A;  2N00 A;  2XV9 A;  4F44 A;  2N1F A;  4M9Z A;  2GF5 A;  1FAD A;  2DO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...