2DBUA

Crystal structure of gamma-glutamyltranspeptidase from escherichia coli
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
359
structure length
359
Chain Sequence
APPVSYGVEEDVFHPVRAKQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKNGNTTAIDFREMAPAKATRDMFLDDQGNPDSKKSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYGSEVLPNHENSKAIFWKEGEPLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRSEYLGDPDFVKVPWQALTNKAYAKSIADQIDINKAKPSSEIRPGKLAPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-glutamyltranspeptidase
publication title Crystal structures of gamma-glutamyltranspeptidase from Escherichia coli, a key enzyme in glutathione metabolism, and its reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 99
structure length 359
sequence length 359
chains with identical sequence C
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2005-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dbuA02
2Z8IA 3WHRA 3WHSA 2QM6A 2DBWA 5BPKA 4Z9OA 5B5TA 4ZC6A 4GG2A 2V36A 2DBXA 2E0YA 4OTTA 2DG5A 2DBUA 2E0XA 2QMCA 4ZBKA 3A75A 2Z8JA 3WHQA 3FNMA 2Z8KA 2NQOA 4ZCGA 4OTUA 4GDXA
chains in the Genus database with same CATH superfamily
3H37A 2KWFA 3WHSA 2DBWA 3LU6A 1HK4A 5FUOA 1J7EA 1BM0A 4D7XA 3LU7A 4LUHA 2BXHA 5ID9A 4N3ZA 2BXOA 2XMOA 4G03A 4LB2A 2XSIA 3NVKA 2I2ZA 4FIPB 4BKEA 1HA2A 4E99A 2BXKA 2BXMA 2AGHB 2DYOA 1MA9A 2DG5A 1H9ZA 2YDFA 4MBEC 3B9LA 4OTTA 5HOZA 1AO6A 3A75A 1TF0A 4F5SA 3NMUA 4OT2A 1MIYA 2I30A 1HK1A 2Z8JA 3CX9A 3KIKA 3FNMA 4GDLB 4L8UA 3W1SA 3TDLA 2EFDA 5GIOA 4OTUA 1GNJA 4M70B 1MIVA 2Z8IA 3FWCC 4PO0A 2BXIA 2LXSA 3VQIA 4F5TA 3JRYA 5BPKA 2BXFA 4K2CA 4JK4A 3SQJA 4J2VA 2BXNA 2OT3A 4OR0A 2K0NA 4Z9OA 5B5TA 4GG2A 4K71A 3KJLA 3B9MA 4G04A 4LUFA 2BXCA 3A73A 1VZSA 1E7GA 3GA9L 2V36A 2VDBA 4ZBQA 5DBYA 2LOQA 2XVWA 4EMXA 1TXUA 3NVIA 3UIVA 1BJ5A 1E7CA 2E0XA 3BPJA 4G01A 2BXDA 5DQFA 1KW2A 2JUHA 5D7GA 3PLAA 2VUEA 5IJFA 1IJGA 1KXPD 5IIXA 2EFEA 2BXAA 4FK5B 3LU8A 4HGKA 4DHXB 1LNSA 4IW1A 4GDXA 1E78A 4I9OA 4WA6B 4N0FD 5IIHA 4S1YA 1MIWA 4NAWB 1HK3A 1UORA 4F5VA 1E7BA 5GHKA 1JNBA 3V09A 4ZC6A 1N5UA 2LXTA 3G9KD 4L9QA 4C31B 4HGMB 1FOUA 1GNIA 2XW1A 2KBZA 2BXQA 3V03A 2XVVA 4TQ1A 4W4UB 3V08A 2DYMA 4TQ0A 5IIUA 5ID7A 2AJEA 1MUHA 2DBUA 1E7IA 2NNWA 4ZUXV 3SIUB 1HK5A 1NT2B 1J78A 2LQHA 5IJEA 1LOTA 2CKXA 2XW0A 4FJCB 5IFOA 4Z69A 2Z8KA 4IW2A 3ECPA 4ZBRA 5GINA 4ZCGA 2XVQA 3FWBC 1E7HA 3H3AA 4GDKB 4LA0A 1E7AA 3JQZA 4DM0A 3WHRA 2LQIA 2ROHA 4F5UA 5GIPA 2EFCA 2QM6A 3NVMA 4BY9C 1E7EA 2BXPA 2QHBA 2BXBA 2OZBB 1HK2A 3M99C 3GQUA 2XVUA 2BX8A 5IJ5A 2EFHA 1H5WA 1VFIA 3MHSB 3MHHB 4LB9A 4N0UD 2E0YA 2DBXA 1BKEA 1E7FA 1O9XA 3GQXA 2BXGA 3ICXA 2QMCA 4ZBKA 3SIVB 2GUTA 3WHQA 1MUSA 2VUFA 1SB0A 2NQOA 1KDXA 2BXLA 2BXEA 1MM8A 4L9KA
chains in the Genus database with same CATH topology
3H37A 3WHSA 2DBWA 3LU6A 1HK4A 5FUOA 1J7EA 1BM0A 3LU7A 4LUHA 2BXHA 5ID9A 4N3ZA 2BXOA 2XMOA 4G03A 4LB2A 2XSIA 3NVKA 2I2ZA 4FIPB 4BKEA 1HA2A 4E99A 2BXKA 2BXMA 2YDFA 2DYOA 1MA9A 2DG5A 1H9ZA 4MBEC 4OTTA 3B9LA 5HOZA 1AO6A 3NMUA 3A75A 1TF0A 4F5SA 4OT2A 1MIYA 2I30A 1HK1A 2Z8JA 3CX9A 3KIKA 3FNMA 4GDLB 4L8UA 3W1SA 3TDLA 2EFDA 5GIOA 4OTUA 1GNJA 4M70B 1MIVA 2Z8IA 3FWCC 4PO0A 2BXIA 3VQIA 4F5TA 3JRYA 5BPKA 2BXFA 4K2CA 4JK4A 3SQJA 4J2VA 2BXNA 2OT3A 4OR0A 4Z9OA 5B5TA 4GG2A 4K71A 3KJLA 3B9MA 4G04A 4LUFA 2BXCA 3A73A 1VZSA 1E7GA 3GA9L 2V36A 2VDBA 4ZBQA 5DBYA 2LOQA 2XVWA 4EMXA 1TXUA 3NVIA 3UIVA 1BJ5A 1E7CA 2E0XA 5DQFA 4G01A 2BXDA 3PLAA 1KW2A 2JUHA 5D7GA 2VUEA 5IJFA 1IJGA 1KXPD 5IIXA 2EFEA 2BXAA 4FK5B 3LU8A 4HGKA 4DHXB 1LNSA 4IW1A 4GDXA 1E78A 4WA6B 4N0FD 5IIHA 4S1YA 1MIWA 4NAWB 1HK3A 1UORA 4F5VA 1E7BA 5GHKA 1JNBA 3V09A 4ZC6A 1N5UA 3G9KD 4L9QA 4C31B 4HGMB 1FOUA 1GNIA 2XW1A 2KBZA 2BXQA 3V03A 2XVVA 4TQ1A 4W4UB 3V08A 2DYMA 4TQ0A 5IIUA 5ID7A 2AJEA 1E7IA 2DBUA 2NNWA 4ZUXV 3SIUB 1HK5A 1NT2B 1J78A 5IJEA 1LOTA 2CKXA 2XW0A 4FJCB 5IFOA 4Z69A 2Z8KA 4IW2A 4ZBRA 5GINA 4ZCGA 2XVQA 3FWBC 1E7HA 3H3AA 4GDKB 4LA0A 1E7AA 3JQZA 3WHRA 4F5UA 2ROHA 5GIPA 2EFCA 2QM6A 3NVMA 4BY9C 1E7EA 2BXPA 2QHBA 2BXBA 2OZBB 1HK2A 3M99C 3GQUA 2XVUA 2BX8A 5IJ5A 2EFHA 1H5WA 1VFIA 3MHSB 3MHHB 4LB9A 4N0UD 2E0YA 2DBXA 1BKEA 1E7FA 1O9XA 3GQXA 2BXGA 3ICXA 2QMCA 4ZBKA 3SIVB 3WHQA 2VUFA 2NQOA 2BXLA 2BXEA 4L9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8I A;  3WHR A;  3WHS A;  2QM6 A;  2DBW A;  5BPK A;  4Z9O A;  5B5T A;  4ZC6 A;  4GG2 A;  2V36 A;  2DBX A;  2E0Y A;  4OTT A;  2DG5 A;  2DBU A;  2E0X A;  2QMC A;  4ZBK A;  3A75 A;  2Z8J A;  3WHQ A;  3FNM A;  2Z8K A;  2NQO A;  4ZCG A;  4OTU A;  4GDX A; 
#chains in the Genus database with same CATH topology
 3H37 A;  2KWF A;  3WHS A;  2DBW A;  3LU6 A;  1HK4 A;  5FUO A;  1J7E A;  1BM0 A;  4D7X A;  3LU7 A;  4LUH A;  2BXH A;  5ID9 A;  4N3Z A;  2BXO A;  2XMO A;  4G03 A;  4LB2 A;  2XSI A;  3NVK A;  2I2Z A;  4FIP B;  4BKE A;  1HA2 A;  4E99 A;  2BXK A;  2BXM A;  2AGH B;  2DYO A;  1MA9 A;  2DG5 A;  1H9Z A;  2YDF A;  4MBE C;  3B9L A;  4OTT A;  5HOZ A;  1AO6 A;  3A75 A;  1TF0 A;  4F5S A;  3NMU A;  4OT2 A;  1MIY A;  2I30 A;  1HK1 A;  2Z8J A;  3CX9 A;  3KIK A;  3FNM A;  4GDL B;  4L8U A;  3W1S A;  3TDL A;  2EFD A;  5GIO A;  4OTU A;  1GNJ A;  4M70 B;  1MIV A;  2Z8I A;  3FWC C;  4PO0 A;  2BXI A;  2LXS A;  3VQI A;  4F5T A;  3JRY A;  5BPK A;  2BXF A;  4K2C A;  4JK4 A;  3SQJ A;  4J2V A;  2BXN A;  2OT3 A;  4OR0 A;  2K0N A;  4Z9O A;  5B5T A;  4GG2 A;  4K71 A;  3KJL A;  3B9M A;  4G04 A;  4LUF A;  2BXC A;  3A73 A;  1VZS A;  1E7G A;  3GA9 L;  2V36 A;  2VDB A;  4ZBQ A;  5DBY A;  2LOQ A;  2XVW A;  4EMX A;  1TXU A;  3NVI A;  3UIV A;  1BJ5 A;  1E7C A;  2E0X A;  3BPJ A;  4G01 A;  2BXD A;  5DQF A;  1KW2 A;  2JUH A;  5D7G A;  3PLA A;  2VUE A;  5IJF A;  1IJG A;  1KXP D;  5IIX A;  2EFE A;  2BXA A;  4FK5 B;  3LU8 A;  4HGK A;  4DHX B;  1LNS A;  4IW1 A;  4GDX A;  1E78 A;  4I9O A;  4WA6 B;  4N0F D;  5IIH A;  4S1Y A;  1MIW A;  4NAW B;  1HK3 A;  1UOR A;  4F5V A;  1E7B A;  5GHK A;  1JNB A;  3V09 A;  4ZC6 A;  1N5U A;  2LXT A;  3G9K D;  4L9Q A;  4C31 B;  4HGM B;  1FOU A;  1GNI A;  2XW1 A;  2KBZ A;  2BXQ A;  3V03 A;  2XVV A;  4TQ1 A;  4W4U B;  3V08 A;  2DYM A;  4TQ0 A;  5IIU A;  5ID7 A;  2AJE A;  1MUH A;  2DBU A;  1E7I A;  2NNW A;  4ZUX V;  3SIU B;  1HK5 A;  1NT2 B;  1J78 A;  2LQH A;  5IJE A;  1LOT A;  2CKX A;  2XW0 A;  4FJC B;  5IFO A;  4Z69 A;  2Z8K A;  4IW2 A;  3ECP A;  4ZBR A;  5GIN A;  4ZCG A;  2XVQ A;  3FWB C;  1E7H A;  3H3A A;  4GDK B;  4LA0 A;  1E7A A;  3JQZ A;  4DM0 A;  3WHR A;  2LQI A;  2ROH A;  4F5U A;  5GIP A;  2EFC A;  2QM6 A;  3NVM A;  4BY9 C;  1E7E A;  2BXP A;  2QHB A;  2BXB A;  2OZB B;  1HK2 A;  3M99 C;  3GQU A;  2XVU A;  2BX8 A;  5IJ5 A;  2EFH A;  1H5W A;  1VFI A;  3MHS B;  3MHH B;  4LB9 A;  4N0U D;  2E0Y A;  2DBX A;  1BKE A;  1E7F A;  1O9X A;  3GQX A;  2BXG A;  3ICX A;  2QMC A;  4ZBK A;  3SIV B;  2GUT A;  3WHQ A;  1MUS A;  2VUF A;  1SB0 A;  2NQO A;  1KDX A;  2BXL A;  2BXE A;  1MM8 A;  4L9K A; 
#chains in the Genus database with same CATH homology
 3H37 A;  3WHS A;  2DBW A;  3LU6 A;  1HK4 A;  5FUO A;  1J7E A;  1BM0 A;  3LU7 A;  4LUH A;  2BXH A;  5ID9 A;  4N3Z A;  2BXO A;  2XMO A;  4G03 A;  4LB2 A;  2XSI A;  3NVK A;  2I2Z A;  4FIP B;  4BKE A;  1HA2 A;  4E99 A;  2BXK A;  2BXM A;  2YDF A;  2DYO A;  1MA9 A;  2DG5 A;  1H9Z A;  4MBE C;  4OTT A;  3B9L A;  5HOZ A;  1AO6 A;  3NMU A;  3A75 A;  1TF0 A;  4F5S A;  4OT2 A;  1MIY A;  2I30 A;  1HK1 A;  2Z8J A;  3CX9 A;  3KIK A;  3FNM A;  4GDL B;  4L8U A;  3W1S A;  3TDL A;  2EFD A;  5GIO A;  4OTU A;  1GNJ A;  4M70 B;  1MIV A;  2Z8I A;  3FWC C;  4PO0 A;  2BXI A;  3VQI A;  4F5T A;  3JRY A;  5BPK A;  2BXF A;  4K2C A;  4JK4 A;  3SQJ A;  4J2V A;  2BXN A;  2OT3 A;  4OR0 A;  4Z9O A;  5B5T A;  4GG2 A;  4K71 A;  3KJL A;  3B9M A;  4G04 A;  4LUF A;  2BXC A;  3A73 A;  1VZS A;  1E7G A;  3GA9 L;  2V36 A;  2VDB A;  4ZBQ A;  5DBY A;  2LOQ A;  2XVW A;  4EMX A;  1TXU A;  3NVI A;  3UIV A;  1BJ5 A;  1E7C A;  2E0X A;  5DQF A;  4G01 A;  2BXD A;  3PLA A;  1KW2 A;  2JUH A;  5D7G A;  2VUE A;  5IJF A;  1IJG A;  1KXP D;  5IIX A;  2EFE A;  2BXA A;  4FK5 B;  3LU8 A;  4HGK A;  4DHX B;  1LNS A;  4IW1 A;  4GDX A;  1E78 A;  4WA6 B;  4N0F D;  5IIH A;  4S1Y A;  1MIW A;  4NAW B;  1HK3 A;  1UOR A;  4F5V A;  1E7B A;  5GHK A;  1JNB A;  3V09 A;  4ZC6 A;  1N5U A;  3G9K D;  4L9Q A;  4C31 B;  4HGM B;  1FOU A;  1GNI A;  2XW1 A;  2KBZ A;  2BXQ A;  3V03 A;  2XVV A;  4TQ1 A;  4W4U B;  3V08 A;  2DYM A;  4TQ0 A;  5IIU A;  5ID7 A;  2AJE A;  1E7I A;  2DBU A;  2NNW A;  4ZUX V;  3SIU B;  1HK5 A;  1NT2 B;  1J78 A;  5IJE A;  1LOT A;  2CKX A;  2XW0 A;  4FJC B;  5IFO A;  4Z69 A;  2Z8K A;  4IW2 A;  4ZBR A;  5GIN A;  4ZCG A;  2XVQ A;  3FWB C;  1E7H A;  3H3A A;  4GDK B;  4LA0 A;  1E7A A;  3JQZ A;  3WHR A;  4F5U A;  2ROH A;  5GIP A;  2EFC A;  2QM6 A;  3NVM A;  4BY9 C;  1E7E A;  2BXP A;  2QHB A;  2BXB A;  2OZB B;  1HK2 A;  3M99 C;  3GQU A;  2XVU A;  2BX8 A;  5IJ5 A;  2EFH A;  1H5W A;  1VFI A;  3MHS B;  3MHH B;  4LB9 A;  4N0U D;  2E0Y A;  2DBX A;  1BKE A;  1E7F A;  1O9X A;  3GQX A;  2BXG A;  3ICX A;  2QMC A;  4ZBK A;  3SIV B;  3WHQ A;  2VUF A;  2NQO A;  2BXL A;  2BXE A;  4L9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...