2DBXA

Crystal structure of gamma-glutamyltranspeptidase from escherichia coli complexed with l-glutamate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
351
structure length
351
Chain Sequence
EEDVFHPVRAKQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKNGNTTAIDFREMAPAKATRDMFLDDQGNPDSKKSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYGSEVLPNHENSKAIFWKEGEPLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRSEYLGDPDFVKVPWQALTNKAYAKSIADQIDINKAKPSSEIRPGKLAPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-glutamyltranspeptidase
publication title Crystal structures of gamma-glutamyltranspeptidase from Escherichia coli, a key enzyme in glutathione metabolism, and its reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 97
structure length 351
sequence length 351
chains with identical sequence C
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2005-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dbxA02
4ZCGA 2Z8KA 2QM6A 3FNMA 2QMCA 5BPKA 5B5TA 2DBXA 3WHRA 3A75A 4ZBKA 4OTTA 2E0YA 2Z8JA 4GDXA 2E0XA 2DBWA 3WHSA 2V36A 4ZC6A 2DBUA 4GG2A 4OTUA 2DG5A 2Z8IA 3WHQA 4Z9OA 2NQOA
chains in the Genus database with same CATH superfamily
3VQIA 1LOTA 2XVWA 2EFHA 4OT2A 1IJGA 4F5VA 3SIUB 3V09A 2BX8A 1HK3A 3TDLA 1E7IA 2QM6A 2LXTA 4D7XA 4W4UB 5IIXA 4ZBQA 4MBEC 5B5TA 2NNWA 3A75A 2XW1A 4OTTA 1J7EA 1E7CA 5GHKA 1HA2A 2E0YA 2Z8JA 3NVIA 1MIWA 3MHHB 2VUEA 4Z69A 1MIYA 4OR0A 2I30A 2XVUA 4ZBRA 3LU8A 4DHXB 5HOZA 1E7GA 3JQZA 4ZC6A 2OT3A 2OZBB 1E78A 1TXUA 2VUFA 3B9MA 4TQ1A 1LNSA 2DG5A 4LUHA 2Z8IA 1MM8A 2BXNA 1BJ5A 3GQUA 5ID7A 4I9OA 3GA9L 2EFEA 4K71A 3NVMA 4L9QA 1H5WA 1GNIA 4WA6B 4LB2A 3UIVA 4FIPB 4IW2A 4PO0A 2QMCA 3FNMA 3JRYA 5DBYA 3SIVB 3WHRA 3SQJA 1SB0A 2BXFA 4FK5B 1BKEA 1NT2B 4GDXA 1MUSA 2E0XA 2DBWA 5FUOA 4G01A 3H37A 2DYMA 1KXPD 2LQIA 4BY9C 1N5UA 2BXKA 4NAWB 5D7GA 2DYOA 2XSIA 2EFCA 1FOUA 1MA9A 1BM0A 3WHQA 1KDXA 1GNJA 1E7EA 4EMXA 2XMOA 2BXQA 1HK5A 2CKXA 2BXPA 5GIPA 3B9LA 4HGMB 4IW1A 3W1SA 3G9KD 5IFOA 3ICXA 4M70B 4LA0A 1J78A 1O9XA 2EFDA 2Z8KA 2AGHB 2BXOA 2BXLA 2I2ZA 2LOQA 1KW2A 3CX9A 3LU7A 2ROHA 5DQFA 5GINA 1AO6A 5BPKA 3ECPA 2DBXA 4L8UA 1E7BA 2KWFA 2BXMA 2VDBA 3FWCC 1UORA 4J2VA 1JNBA 3BPJA 3WHSA 2JUHA 4ZUXV 3FWBC 4C31B 4DM0A 4F5SA 4BKEA 1E7HA 4GDKB 1H9ZA 4F5TA 4HGKA 2AJEA 4OTUA 4N3ZA 2KBZA 5ID9A 1HK1A 3KIKA 2BXBA 4Z9OA 4JK4A 2NQOA 4F5UA 1E7AA 4G03A 2GUTA 4E99A 4ZCGA 1MUHA 4N0FD 2YDFA 1HK2A 3V03A 5IJFA 2BXIA 2BXDA 4GDLB 3V08A 4TQ0A 2BXHA 5IJEA 4G04A 4LB9A 2BXAA 4ZBKA 5IIUA 2XVVA 1MIVA 1VZSA 2BXCA 3PLAA 2BXGA 4S1YA 1TF0A 4LUFA 3KJLA 2BXEA 5IIHA 3H3AA 4L9KA 3NVKA 5IJ5A 2XW0A 5GIOA 2QHBA 2V36A 1E7FA 3M99C 1VFIA 2LQHA 1HK4A 2DBUA 2XVQA 4GG2A 3NMUA 2K0NA 2LXSA 4K2CA 3GQXA 4FJCB 3A73A 3MHSB 4N0UD 3LU6A
chains in the Genus database with same CATH topology
3VQIA 1LOTA 2XVWA 2EFHA 4OT2A 1IJGA 4F5VA 3SIUB 3V09A 2BX8A 1HK3A 3TDLA 1E7IA 2QM6A 5IIXA 4W4UB 4ZBQA 4MBEC 5B5TA 2NNWA 3A75A 2XW1A 4OTTA 1J7EA 1E7CA 5GHKA 1HA2A 2E0YA 2Z8JA 3NVIA 1MIWA 3MHHB 2VUEA 4Z69A 1MIYA 4OR0A 2I30A 2XVUA 4ZBRA 3LU8A 4DHXB 5HOZA 1E7GA 3JQZA 4ZC6A 2OT3A 2OZBB 1E78A 1TXUA 2VUFA 3B9MA 4TQ1A 1LNSA 2DG5A 4LUHA 2Z8IA 2BXNA 1BJ5A 3GQUA 5ID7A 3GA9L 2EFEA 4K71A 3NVMA 4L9QA 1H5WA 1GNIA 4WA6B 4LB2A 3UIVA 4FIPB 4IW2A 4PO0A 2QMCA 3FNMA 3JRYA 5DBYA 3SIVB 3WHRA 3SQJA 2BXFA 4FK5B 1BKEA 1NT2B 4GDXA 2E0XA 2DBWA 5FUOA 4G01A 3H37A 2DYMA 1KXPD 4BY9C 1N5UA 2BXKA 4NAWB 5D7GA 2DYOA 2XSIA 2EFCA 1FOUA 1MA9A 1BM0A 3WHQA 1GNJA 1E7EA 4EMXA 2XMOA 2BXQA 1HK5A 2CKXA 2BXPA 5GIPA 3B9LA 4HGMB 4IW1A 3W1SA 3G9KD 5IFOA 3ICXA 4M70B 4LA0A 1J78A 1O9XA 2EFDA 2Z8KA 2I2ZA 2BXOA 2BXLA 3CX9A 2LOQA 1KW2A 3LU7A 5DQFA 2ROHA 5GINA 1AO6A 5BPKA 2DBXA 4L8UA 1E7BA 2BXMA 2VDBA 3FWCC 1UORA 4J2VA 1JNBA 3WHSA 4ZUXV 2JUHA 3FWBC 4C31B 4F5SA 4BKEA 1E7HA 4GDKB 1H9ZA 4F5TA 4HGKA 2AJEA 4OTUA 4N3ZA 2KBZA 5ID9A 1HK1A 3KIKA 2BXBA 4Z9OA 4JK4A 2NQOA 4F5UA 1E7AA 4G03A 4E99A 4ZCGA 4N0FD 2YDFA 1HK2A 3V03A 5IJFA 2BXIA 2BXDA 4GDLB 3V08A 4TQ0A 2BXHA 5IJEA 4G04A 4LB9A 2BXAA 4ZBKA 5IIUA 2XVVA 1MIVA 1VZSA 2BXCA 3PLAA 2BXGA 4S1YA 1TF0A 4LUFA 3KJLA 2BXEA 5IIHA 3H3AA 4L9KA 3NVKA 5IJ5A 2XW0A 5GIOA 2QHBA 2V36A 1E7FA 3M99C 1VFIA 1HK4A 2DBUA 2XVQA 4GG2A 3NMUA 4K2CA 3GQXA 4FJCB 3A73A 3MHSB 4N0UD 3LU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZCG A;  2Z8K A;  2QM6 A;  3FNM A;  2QMC A;  5BPK A;  5B5T A;  2DBX A;  3WHR A;  3A75 A;  4ZBK A;  4OTT A;  2E0Y A;  2Z8J A;  4GDX A;  2E0X A;  2DBW A;  3WHS A;  2V36 A;  4ZC6 A;  2DBU A;  4GG2 A;  4OTU A;  2DG5 A;  2Z8I A;  3WHQ A;  4Z9O A;  2NQO A; 
#chains in the Genus database with same CATH topology
 3VQI A;  1LOT A;  2XVW A;  2EFH A;  4OT2 A;  1IJG A;  4F5V A;  3SIU B;  3V09 A;  2BX8 A;  1HK3 A;  3TDL A;  1E7I A;  2QM6 A;  2LXT A;  4D7X A;  4W4U B;  5IIX A;  4ZBQ A;  4MBE C;  5B5T A;  2NNW A;  3A75 A;  2XW1 A;  4OTT A;  1J7E A;  1E7C A;  5GHK A;  1HA2 A;  2E0Y A;  2Z8J A;  3NVI A;  1MIW A;  3MHH B;  2VUE A;  4Z69 A;  1MIY A;  4OR0 A;  2I30 A;  2XVU A;  4ZBR A;  3LU8 A;  4DHX B;  5HOZ A;  1E7G A;  3JQZ A;  4ZC6 A;  2OT3 A;  2OZB B;  1E78 A;  1TXU A;  2VUF A;  3B9M A;  4TQ1 A;  1LNS A;  2DG5 A;  4LUH A;  2Z8I A;  1MM8 A;  2BXN A;  1BJ5 A;  3GQU A;  5ID7 A;  4I9O A;  3GA9 L;  2EFE A;  4K71 A;  3NVM A;  4L9Q A;  1H5W A;  1GNI A;  4WA6 B;  4LB2 A;  3UIV A;  4FIP B;  4IW2 A;  4PO0 A;  2QMC A;  3FNM A;  3JRY A;  5DBY A;  3SIV B;  3WHR A;  3SQJ A;  1SB0 A;  2BXF A;  4FK5 B;  1BKE A;  1NT2 B;  4GDX A;  1MUS A;  2E0X A;  2DBW A;  5FUO A;  4G01 A;  3H37 A;  2DYM A;  1KXP D;  2LQI A;  4BY9 C;  1N5U A;  2BXK A;  4NAW B;  5D7G A;  2DYO A;  2XSI A;  2EFC A;  1FOU A;  1MA9 A;  1BM0 A;  3WHQ A;  1KDX A;  1GNJ A;  1E7E A;  4EMX A;  2XMO A;  2BXQ A;  1HK5 A;  2CKX A;  2BXP A;  5GIP A;  3B9L A;  4HGM B;  4IW1 A;  3W1S A;  3G9K D;  5IFO A;  3ICX A;  4M70 B;  4LA0 A;  1J78 A;  1O9X A;  2EFD A;  2Z8K A;  2AGH B;  2BXO A;  2BXL A;  2I2Z A;  2LOQ A;  1KW2 A;  3CX9 A;  3LU7 A;  2ROH A;  5DQF A;  5GIN A;  1AO6 A;  5BPK A;  3ECP A;  2DBX A;  4L8U A;  1E7B A;  2KWF A;  2BXM A;  2VDB A;  3FWC C;  1UOR A;  4J2V A;  1JNB A;  3BPJ A;  3WHS A;  2JUH A;  4ZUX V;  3FWB C;  4C31 B;  4DM0 A;  4F5S A;  4BKE A;  1E7H A;  4GDK B;  1H9Z A;  4F5T A;  4HGK A;  2AJE A;  4OTU A;  4N3Z A;  2KBZ A;  5ID9 A;  1HK1 A;  3KIK A;  2BXB A;  4Z9O A;  4JK4 A;  2NQO A;  4F5U A;  1E7A A;  4G03 A;  2GUT A;  4E99 A;  4ZCG A;  1MUH A;  4N0F D;  2YDF A;  1HK2 A;  3V03 A;  5IJF A;  2BXI A;  2BXD A;  4GDL B;  3V08 A;  4TQ0 A;  2BXH A;  5IJE A;  4G04 A;  4LB9 A;  2BXA A;  4ZBK A;  5IIU A;  2XVV A;  1MIV A;  1VZS A;  2BXC A;  3PLA A;  2BXG A;  4S1Y A;  1TF0 A;  4LUF A;  3KJL A;  2BXE A;  5IIH A;  3H3A A;  4L9K A;  3NVK A;  5IJ5 A;  2XW0 A;  5GIO A;  2QHB A;  2V36 A;  1E7F A;  3M99 C;  1VFI A;  2LQH A;  1HK4 A;  2DBU A;  2XVQ A;  4GG2 A;  3NMU A;  2K0N A;  2LXS A;  4K2C A;  3GQX A;  4FJC B;  3A73 A;  3MHS B;  4N0U D;  3LU6 A; 
#chains in the Genus database with same CATH homology
 3VQI A;  1LOT A;  2XVW A;  2EFH A;  4OT2 A;  1IJG A;  4F5V A;  3SIU B;  3V09 A;  2BX8 A;  1HK3 A;  3TDL A;  1E7I A;  2QM6 A;  5IIX A;  4W4U B;  4ZBQ A;  4MBE C;  5B5T A;  2NNW A;  3A75 A;  2XW1 A;  4OTT A;  1J7E A;  1E7C A;  5GHK A;  1HA2 A;  2E0Y A;  2Z8J A;  3NVI A;  1MIW A;  3MHH B;  2VUE A;  4Z69 A;  1MIY A;  4OR0 A;  2I30 A;  2XVU A;  4ZBR A;  3LU8 A;  4DHX B;  5HOZ A;  1E7G A;  3JQZ A;  4ZC6 A;  2OT3 A;  2OZB B;  1E78 A;  1TXU A;  2VUF A;  3B9M A;  4TQ1 A;  1LNS A;  2DG5 A;  4LUH A;  2Z8I A;  2BXN A;  1BJ5 A;  3GQU A;  5ID7 A;  3GA9 L;  2EFE A;  4K71 A;  3NVM A;  4L9Q A;  1H5W A;  1GNI A;  4WA6 B;  4LB2 A;  3UIV A;  4FIP B;  4IW2 A;  4PO0 A;  2QMC A;  3FNM A;  3JRY A;  5DBY A;  3SIV B;  3WHR A;  3SQJ A;  2BXF A;  4FK5 B;  1BKE A;  1NT2 B;  4GDX A;  2E0X A;  2DBW A;  5FUO A;  4G01 A;  3H37 A;  2DYM A;  1KXP D;  4BY9 C;  1N5U A;  2BXK A;  4NAW B;  5D7G A;  2DYO A;  2XSI A;  2EFC A;  1FOU A;  1MA9 A;  1BM0 A;  3WHQ A;  1GNJ A;  1E7E A;  4EMX A;  2XMO A;  2BXQ A;  1HK5 A;  2CKX A;  2BXP A;  5GIP A;  3B9L A;  4HGM B;  4IW1 A;  3W1S A;  3G9K D;  5IFO A;  3ICX A;  4M70 B;  4LA0 A;  1J78 A;  1O9X A;  2EFD A;  2Z8K A;  2I2Z A;  2BXO A;  2BXL A;  3CX9 A;  2LOQ A;  1KW2 A;  3LU7 A;  5DQF A;  2ROH A;  5GIN A;  1AO6 A;  5BPK A;  2DBX A;  4L8U A;  1E7B A;  2BXM A;  2VDB A;  3FWC C;  1UOR A;  4J2V A;  1JNB A;  3WHS A;  4ZUX V;  2JUH A;  3FWB C;  4C31 B;  4F5S A;  4BKE A;  1E7H A;  4GDK B;  1H9Z A;  4F5T A;  4HGK A;  2AJE A;  4OTU A;  4N3Z A;  2KBZ A;  5ID9 A;  1HK1 A;  3KIK A;  2BXB A;  4Z9O A;  4JK4 A;  2NQO A;  4F5U A;  1E7A A;  4G03 A;  4E99 A;  4ZCG A;  4N0F D;  2YDF A;  1HK2 A;  3V03 A;  5IJF A;  2BXI A;  2BXD A;  4GDL B;  3V08 A;  4TQ0 A;  2BXH A;  5IJE A;  4G04 A;  4LB9 A;  2BXA A;  4ZBK A;  5IIU A;  2XVV A;  1MIV A;  1VZS A;  2BXC A;  3PLA A;  2BXG A;  4S1Y A;  1TF0 A;  4LUF A;  3KJL A;  2BXE A;  5IIH A;  3H3A A;  4L9K A;  3NVK A;  5IJ5 A;  2XW0 A;  5GIO A;  2QHB A;  2V36 A;  1E7F A;  3M99 C;  1VFI A;  1HK4 A;  2DBU A;  2XVQ A;  4GG2 A;  3NMU A;  4K2C A;  3GQX A;  4FJC B;  3A73 A;  3MHS B;  4N0U D;  3LU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...