2DCKA

A tetragonal-lattice structure of alkaliphilic xynj from bacillus sp. 41m-1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
327
structure length
320
Chain Sequence
AITSNEIGTHDGYDYEFWKDSGGSGSMTLNSGGTFSAQWSNVNNILFRKGKKFDETQTHQQIGNMSINYGATYNPNGNSYLTVYGWTVDPLVEFYIVDSWGTWRPPGGTPKGTINVDGGTYQIYETTRYNQPSIKGTATFQQYWSVRTSKRTSGTISVSEHFRAWESLGMNMGNMYEVALTVEGYQSSGSANVYSNTLTIGATRVEAESMTKGGPYTSNITSPFNGVALYANGDNVSFNHSFTKANSSFSLRGASNNSNMARVDLRIGGQNRGTFYFGDQYPAVYTINNINHGIGNQLVELIVTADDGTWDAYLDYLEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A two-domain structure of alkaliphilic XynJ from Bacillus sp. 41M-1
rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords xylanase J
total genus 74
structure length 320
sequence length 327
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2006-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dckA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2dckA02
3K4AA 1DP0A 1UYZA 2ORZA 5JUVA 1ENXA 1M4WA 1XNDA 3VZJA 1H6XA 1REDA 1JYNA 3C7EA 1JZ5A 1JYWA 2ORXA 1UMIA 3MO4A 1HN1A 4A44A 2VCCA 1KS5A 5HXVA 3HD8B 2WABA 4PT6A 3WF0A 2Y6KA 3WQBA 5I0DA 3AKRA 1US3A 4AAXA 1O59A 4JHZA 2CDOA 5G05L 3C7FA 4UI9L 1H6YA 4HKWA 1NLRA 1JU3A 4W8JA 5IFPA 3VD4A 3HNBM 3A7QA 2BVVA 4DUWA 5EJ1B 1IGOA 1UXXX 3WF3A 2W5FA 3P1IA 4XVHA 5FUIA 3DYMA 3EB7A 3I3EA 3UETA 2LS6A 4AG4A 4XQ4A 3VD7A 2XOMA 4MGSA 3T09A 1UMHA 2B9VA 1TG7A 3HN3A 3I2IA 4LPLA 5EJ3A 4DXTA 2Y6JA 4XUOA 1NAEA 4BK4A 3ACFA 3AKQA 4A41A 1H8VA 2BWCA 1BK1A 2VG9A 1GUIA 2Y6HA 2V5DA 3CZUA 4A42A 4JKLA 3EYPA 2X05A 3C7OA 4W50A 2NLRA 3VDBA 3A23A 3IDAA 4XUNA 3WT3A 1W9TA 2ZEYA 3K4ZA 3CIHA 4P02B 2C4XA 1KS4A 3LPFA 4S2GA 2VZPA 4M4PA 3ACIA 3WNNA 1OH4A 2VGDA 4CVUA 2VZUA 2KD7A 1UWWA 2QQJA 3WQ0A 5J1XA 4RYDA 4E8CA 3WF2A 3DYOA 2JD9A 5CYYA 3SEEA 2X10A 3RI9A 4ZY9A 3HNMA 3AC0A 3BGAA 1NUKA 3AKSA 3VZLA 3AKPA 1W8OA 2VZVA 3C8XA 1F4HA 4QAWA 4YPJA 3RI8A 5JMOA 4HKLA 1HV1A 3AMHA 1UYYA 2VMFA 2WN3A 3B7MA 4BDVB 2WO1A 4S2FA 3VHOA 4TXWA 1P8JA 3SKVA 4D0QA 3A21A 5K9YA 5K7PA 1XC6A 3OGVA 3NNGA 5EJZB 2DCYA 1I5PA 2VMEA 1OF3A 3ETPA 3WP5A 1JZ8A 1BCXA 4UOJA 3M4FA 3VL8A 4ZXEA 1XNKA 2W1QA 2E33A 4QX0A 2W9XA 3OBAA 2QQIA 2ZXQA 5LA2A 1H0BA 4P5YA 3VDAA 1PMJX 2HYXA 3JXSA 1GOGA 3CDZB 5JXJA 3SEPA 4A4AA 1W99A 2DFCA 2VCAA 1WCQA 1CIYA 1SDDB 5HXMA 4D8MA 3LQCA 2WO3A 3ABZA 1RYYA 3AMNA 2B4KA 2J1EA 3I2GA 1W0NA 3VD5A 3VDCA 2BERA 5DQ0A 3T0DA 3I97A 2WDBA 3WF4A 4L0PA 3GM8A 2QZ2A 1UX7A 3I2HA 2W47A 3CKHA 3VD9A 3OGSA 1QH7A 2B45X 4A6OA 2BW8A 2VZRA 3VHPA 3ZM8A 2QQKA 4A45A 5IFTA 3T2OA 2BZDA 2CDPA 2JEMA 5B4XA 1JZ6A 4MOAA 4A3ZA 3J7HA 2JDAA 3WP3A 5JXGA 1US2A 1PX4A 3MBWA 1CZTA 2VQUA 2BGPA 1JU4A 1H4GA 3LPGA 3LEIA 3MUZ1 2VZOA 1UZ0A 3OGRA 1GMMA 2Y6LA 3WR0A 3EXUA 3CZJA 4QB6A 1CZVA 1KEXA 5DN2A 3HNYM 2W3JA 2VMCA 2Z79A 3GGLA 4S2HA 2BGOA 5G04L 1EUTA 1R64A 1LNSA 1F5JA 2J1AA 3GXUA 5IJRA 4CUBA 3UNPA 1CZSA 2DDUA 3K75B 3HPNA 2W87A 3AMMA 1TE1B 2JICA 2W91A 1GQPA 3I2JA 1OLQA 1T6GC 4ET7A 1UY3A 3OG2A 3PUHA 4XURA 3LEGA 2QQLA 4OMDA 4MO3M 1JYVA 4S2DA 2WZ8A 3NRUA 1JZ3A 4QX1A 4MADA 3K77A 5EIYB 1DLCA 4CU9A 4HK8A 4DEVA 1ULOA 2QQNA 2J1UA 5B4NA 4BXSV 4IXLA 4ARXA 1K12A 4QDRA 4XUTA 5A1AA 3LGRA 4CUAA 1PMHX 2RVAA 1UU5A 4GWIA 1W9WA 2XONA 5LA0A 4DUVA 3PUIA 3LB9A 4P08A 1REFA 1F4AA 4JX0A 3VHNA 1NKGA 3DYPA 3VZMA 5IHRA 1K3IA 2XHNA 3FL7A 4ZZ8A 2X09A 1UY4A 4E8DA 4KMQA 2Y8KA 1OA3A 4GWJA 2VZSA 4XQWA 3T08A 1YNAA 3VL9A 3A22A 4BJ0A 2W46A 3IAQA 3WP4A 2VMDA 2WYSA 4CU8A 5LA1A 3WEZA 1ULPA 3AMPA 2YB7A 4TTGA 3CQOA 3ACGA 3I3BA 2J1SA 2VZQA 2ZEZA 2VL4A 4QDSA 2VOTA 2B42B 3MV11 4IUGA 2WZEA 3W5NA 2VR4A 4XQDA 2YFUA 4M4RA 3P6BA 1T2XA 4LQRA 4P00B 1UKRA 4H7MA 5C71A 3WNMA 2D97A 1UY2A 2WUHA 1UU4A 2VUJA 2WAOA 3ECQA 4XUQA 3I2KA 3WP6A 2E32A 3IIIA 2J1TA 2B46X 4JKKA 2EICA 2LW8A 4OZOA 2W92A 1J83A 1JYXA 4QX2A 2VQTA 3D3AA 1AXKA 2YC2A 1BVVA 3FN9A 1C5IA 2DCZA 2JE8A 3WSOA 3NQHA 2RV9A 3C7GA 4XUPA 4QB1A 2DFBA 4OYUA 1H4HA 4NPRA 1O8SA 2C1FA 2QQOA 1OD3A 1NX9A 3I2FA 2R7EB 4CU6A 2Y64A 1CX1A 1PX3A 1W8NA 3NJXA 1REEA 5JXIA 2W95A 3SKJE 4MGQA 3T0AA 2EIBA 2W1UA 2EIDA 1XXNA 1WKYA 2W94A 3VD3A 3WX5A 1JI6A 1YQ2A 3WY6A 1L7RA 1W2UA 3WQ7A 1BHGA 1XNCA 2QBXA 5JR2A 3WNPA 4DUXA 5IYYA 2C26A 2V4VA 1OLRA 3LE0A 3VZNA 3BN6A 5C7GA 3T0BA 1K42A 3THDA 1D7PM 1MPXA 3E1F1 1OA4A 2WAAA 2QQMA 4XZUG 4QX3A 3VGIA 4ARYA 3F2ZA 3WF1A 3WNKA 5HPOA 3AKTA 2HLEA 3WXPA 1GNYA 2VZ3A 5JXHA 1XNTA 3VZKA 1OT5A 4FI9A 5LCWL 3IB3A 2YFZA 2DCJA 1O8PA 3MUY1 2VC9A 2VJXA 1XYNA 3MFCA 3ZSEA 3MFAA 3WQ1A 3FHAA 4LKSA 1TVGA 3THCA 3MF9A 2VM9A 2PQSA 1K45A 1XYOA 4DXSA 1L7QA 3UESA 1XYPA 3CMGA 1XNAA 1JZ4A 4QPWA 2ZEWA 4HK9A 2BBAA 3T2PA 1PVXA 1H1AA 1OA2A 5CZKA 2WBKA 3ACHA 4CU7A 1HIXA 4PQQA 2J22A 4ZZ5A 2YG0A 2ID4A 3HJRA 2VTFA 2WN2A 3NJVA 4JKMA 4W4ZA 1UU6A 3VLBB 3LEKA 2W1WA 3K46A 3VZOA 1KGYA 4QDQA 4LHSA 4GZ9A 1QH6A 2Y6GA 3MV01 3GDBA 1IQDC 2VO5A 2YC4A 4DEQA 3I3DA 2WQ8A 2Z4FA 2VZTA 1GU3A 4BK5A 1XNBA 3MF6A 2J1VA 4HKOA 1EUUA 1W9SA 3K4DA 1SHWB 5F7UA 2VZ1A 2NQYA 4QB2A 3HOBA 5C70A 4UAPA 1JZ7A 2F6BA 1DYOA 2ZEXA 3B5LB 4KWUA 5DPNA 4PF1A 3T2QA 1GOFA 2VCBA 4KI5M 3FHQA 2V72A 3C7HA 1HV0A 3O7OA 4DXRA 2RJ2A 3OB8A 2JENA 3W5MA 4OUEA 4OMCA 2OKXA 3WNOA 3OEAA 1JHJA 1OF4A 1XPWA 2WO2A 4XPVA 3DECA 2L9LA 1SG3A 3WNLA 2J7MA 4CUCA 4HG6B 2QZ3A 1GOHA 2E31A 5DMYA 2EIEA 4Z2AA 1UYXA 3HEIA 2W1SA 1UY1A 1C5HA 3OEBA 2C9KA 3IAPA 1UXZA 3U37A 2BWAA 1UY0A 3AMQA 1J84A 2XQXA 2DCKA 4RN5A 2VULA 2J1RA 1JZ2A 2E26A 2D98A 2JKXA
chains in the Genus database with same CATH superfamily
3K4AA 4Y5Z0 5F6LB 4YVSB 4QT6A 5A7PA 2NN8A 1XNDA 2CAUA 3VBUB 2D44A 1U0AA 4CCMA 5IVEA 2IFWA 1U5YA 3AB0A 1JYNA 1TMF3 1REDA 2DVFA 3ZXKA 1QJX2 1RUG3 2ORXA 1XU1A 3AK0A 4YRDA 3JB4C 5CA6A 5FWJA 1UO9A 3HD8B 3IPVA 2ZGLA 1HDKA 1ULDA 1SACA 4I0WB 1IS5A 2WNVC 3A0NA 3AKRA 4AAXA 4CZSA 1R1A1 4I0AA 4JHZA 1RUH2 4FFGA 1PIV3 2WNVA 4UI9L 5BNPC 4PLNA 1FPN2 4HKWA 1NQJA 2A71A 5CFCB 3M8LA 5IFPA 5JSPA 2X53S 1XB9A 2BVBA 2D5FA 4Y24A 1HKDA 1VMFA 2K9ZA 3K3OA 4DUWA 1UXXX 1V70A 3HAGA 5FAXA 2DF7A 2OVUA 4ASLA 3RGBA 3JB8A 4OI4A 4AG4A 3T09A 1G6NA 1G7YA 2PN5A 3MI8A 3HN3A 2XLFA 3VBUC 3WNXA 4PLMA 5F1RA 4DXZA 2H0BA 3B93A 3PVNA 4AHZA 3OSDA 2XHKA 1ZYBA 3WD5A 3BU7A 2VOWA 3OGJA 1W6QA 1NLQA 1LESA 4XUOA 3RZGA 1OI6A 5FY4A 3USUB 4Y20B 3VN4A 2JG9B 4BK4A 5LEKA 4A41A 4FOVA 1RJ7A 3ZXAC 2BWCA 1ZZ8A 3CEWA 2VG9A 3N3HA 5LA9A 1KITA 2XWJB 2V5YA 4V2VA 4R52A 2A70A 5FZMA 1GWLA 2VQAA 1GICA 2X05A 1TNFA 3HBKA 5FY8A 2MEV3 5FYMA 5I0SA 2GN3A 3WT3A 3W58A 4C91A 3ZMOA 1OXCA 1J3RA 1QJY3 5DZEA 4M4PA 2NM1A 4Z8BA 4CCCA 3J8F1 4TLGA 3ASIA 4N9HA 1W8ZA 3BPSA 5FYIA 2WWJA 3WQ0A 3LFMA 2Q1MA 4RYDA 4BQ5A 4E4HA 3M3CA 3O0WA 3J26N 1QNYA 4R9DA 3RYKA 4XF0A 1LB2A 3WF2A 1GFF2 3WZ1A 2UURA 1WMFA 1AX2A 4GWNA 4DS0A 3HNMA 5JI9A 3VZLA 2VZVA 4LHKA 3H1YA 1OFNA 5JOYA 1ZRRA 2WA4A 3ZFEC 4Z2WA 1WCKA 1HB1A 2GNTA 3BODA 2VMFA 3TN93 4PI2A 3O0VA 2GC2A 2YBPA 4S2FA 4WM8B 3SKVA 1J3PA 1H8TC 2TEPA 2YBSA 4LEJA 1VRH3 2IXKA 3AX4A 1XC6A 5A6ZA 2PLV2 3NNGA 4BYYA 4LK6A 1LJ7A 4P14A 2WL1A 5BNPB 3DKQA 4GB31 1SLBA 1FV2A 1VALA 1WUVA 2C24A 4XF4A 3WP5A 4CDWC 1BJQA 4JDNA 4EN7B 1JZ8A 4KU8A 4UOJA 3PIJA 5C3RA 1HQNA 2CYFA 3M4FA 2XL9A 4AR2A 1FMD2 1S1AA 3OJBA 4LIVA 1CD3G 3AP9A 5KHHA 1HX6A 4UFLA 1OBNA 2LALA 2ZXQA 1SLAA 4IEVA 5FZIA 1HJGA 4PF5A 3JXSA 1RHI2 1W6QB 4EN9B 2Q8DA 2GP3A 1VJ2A 2VCAA 3U75A 1SDDB 1O4ZA 3BTZA 2WO3A 3OYWB 3ABZA 2BU9A 2DVGA 4AVCA 5CFDC 1RYYA 4FCAA 4DFSA 2UWCA 3I2GA 4BH9A 1ZZ9A 4FO9A 4LLOA 5FDBA 5L9VA 4BE3A 2QVSB 2JB4A 2HKXA 3B00A 1OPMA 3KV5A 5FYBA 4Y22A 5EYXA 5IVFA 5JDBA 4K1YA 1UX7A 5A6QA 3V64A 3KWVA 2NMOA 4UFJA 1VAVA 3THTA 3VD9A 3VBSA 2OT7A 2P4EA 4LOTA 1QH7A 2B45X 4A6OA 1AZDA 1YO8A 4XJWA 2ZGRA 5JOZA 3KCYA 1HXS1 2CDPA 2I74A 1GR3A 2JEMA 2PHTA 1TME1 4COZA 1FI2A 5JPMB 1I9RA 1GZTA 4OFGA 1LOAA 2JE9A 4WZFA 1DDLA 1JYTA 1SCRA 3J7LA 2AEZA 1RHI1 2EAKA 1ZM1A 1ND2C 1JU4A 3AXDA 1H4GA 3BOWA 4P9WA 1ASJ3 4COYA 3MHZA 1DIWA 1YQ8A 4J25A 2XJRA 5D8AA 2A7AA 4URTA 3EXUA 1UOGA 3CZJA 2CNAA 5DN2A 4NOTA 3HNYM 4GMP1 4E4ZA 4N53C 2WS93 2Z79A 3KD4A 2ADEA 1W2OA 1PO21 1XRUA 1GZ9A 3RQ0A 1H1IA 4E27A 2YU2A 4CEYC 3U4SA 1Y9GA 4PIZA 1DZQA 2AR6A 4LO7A 5E88A 1DZTA 2KM2A 1G8WA 1QF3A 2RS32 4AFAA 4FPHA 3O12A 1AL0G 3UNPA 2O0OA 2ZX2A 3K75B 3HPNA 3FBYA 1AR81 1K5JA 4IERA 5GLVA 4MGTA 2JICA 2BOJA 3O14A 2B8MA 1C8M1 3WUCA 1NT0A 2PLV1 1IOAA 1CAXB 2I45A 1DYPA 2ZHLA 4TSVA 3ES1A 5IAXA 2MEV2 1H30A 2VU9A 3OG2A 4XURA 5FUNA 1RTVA 1POV3 4BPZA 1XE0A 2LRPA 3URFA 4D6SA 4LBQB 1RINA 2XXZA 4LUMA 4R9BA 1O3SA 1R081 5FZEA 2OZJA 5FMOL 5HI0A 1WCDJ 5EIYB 5CAZA 3UL2A 1DLCA 1RUI2 1FPN3 2D3RA 3SNMA 3ZFFC 1UIJA 5J09A 4QKDA 1RUH1 4O7XA 5EFUA 2VY0A 3EQEA 5B4NA 4DOUA 1YJKA 4NPLA 4ARXA 2D6KA 1CAVA 1K12A 5FZHA 5F5QA 1R092 2FZ1A 2ZS6B 3HQRA 4WM7C 4Y1VA 2MHFA 1CONA 2RVAA 1UU5A 3J8F2 3NAPB 3ILRA 4WM7A 2RMU3 5FZCA 5FZDA 4DUVA 5GZFA 3LB9A 1XJAA 2BGCA 2FHRA 1F4AA 1AJOA 1KJLA 5J98B 3HN1A 3VHNA 1NKGA 3DYPA 3ILFA 5F9TA 1AR92 3RZJA 2XJQA 4E8DA 2HYKA 4FPOB 5FPZA 1RXGA 1J59A 2BFUS 2R16A 1OA3A 2Y8KA 4D6QA 1BMV1 2VZSA 4QKNA 5APAA 2ZOEB 4Q4Y2 4Q4V2 5B2GB 4K8RB 2VVEA 3JQXA 4LO6B 1SBDA 5GM0A 2W46A 4BJ0A 3IAQA 4OUSA 4XDPA 5E16A 3SITA 1RITA 4LBNA 1COV2 2OQ6A 3AMPA 2GNBA 4BQ3A 2C0ZA 4K40A 1RVF1 4RR3B 1VBB1 4UXAA 3CQOA 3ACGA 5LRSA 2ZEZA 3J8F3 2FDKA 2EVXA 2VOTA 2B42B 5FO9B 4IEUA 4XQDA 1DGWX 1URXA 5FZKA 1WMXA 5L7OA 2MPFA 2GH8A 4HETA 3ZXLA 4FAHA 2WS91 4AHYA 2VOXA 5KXBA 1UY2A 2D97A 4MGKE 2KR2A 1B35C 3KSCA 3I2KA 3UK9A 1RUE1 4E2GA 4MHUA 5LBEA 3TEYA 1WWYA 1PNGA 4JKKA 5BNOB 2J42A 4FPKA 1V6KA 2LW8A 3OOXA 2W68A 1QNWA 4N9IA 4QX2A 2JG8C 1S2BA 5DZGA 5A7WB 1JYXA 3D3AA 1ULGA 2IVJA 4ZU4A 1WD3A 3EO6A 2Q8OA 2YC2A 5I8TA 3TEWA 4HN0A 5FOJB 4A2UA 2D40A 5FXVA 2ZPXA 5LEJA 2AGSA 1R1ZA 1HB4A 3U14A 5FXWA 4CEYB 1G9FA 1HXS2 3ZDSA 1NYWA 1RB8G 1H4HA 1YQ6A 2C1FA 2EA7A 2QQOA 4G4FA 5KR7A 4HFSA 1E5RA 2BNOA 3RZHA 2ILMA 2ZTNA 1PHMA 4XFFA 5DUXA 1ULCA 1UYPA 1D0HA 4IEYA 3IDEA 4NAOA 2ZGQA 3LA3A 3ZFFB 2W95A 3POJA 1R1A2 1JUIA 4CCLA 4MV2A 1LULA 4B7KA 3FFQA 1FMD3 4QQ2A 1ZREA 1S4CA 5CFCA 5FXXA 1M06G 3JQWA 4YW6A 1F35A 2HEYF 4Q0VA 5FLJA 1JI6A 5D2AA 4FPYA 1Q56A 3RYRA 3WQ7A 1LEDA 1XNCA 2DCTA 4WM8A 1J3QA 1VRH1 1GZWA 2DWRA 4C90A 4YSFA 5FMDA 4UF0A 2EXIA 3I49A 5FBJA 1AYN3 3D0SA 3BN6A 2V4AA 4XFHA 3IM0A 4QMAA 2CGPA 2HBTA 3NKGA 2ZABA 5BY5A 2P17A 1ZBE1 1WA4A 2QQMA 2VW1A 4YVWB 4QX3A 3F2ZA 3QLQA 3WNKA 5HPOA 4ISRA 3AKTA 3ZLIA 2OIIA 4UW5A 3AP4A 1RMU3 2YGMA 1ONAA 1HB3A 2QQVA 4BU2A 2VZ3A 2VUDA 3WCRA 1CPNA 5JXHA 1W6NB 1BBT2 4XJ9A 4Y5TA 4BLJA 3ZIWA 2XVGA 4BOWA 3PTYA 1QWRA 4M3CE 3VKNA 3RMYA 5F6KA 2VJXA 2JX9A 3OPWA 4EROA 2WINB 3H8UA 4H2AA 5HV0A 2BEOA 3HQXA 3CO2A 4M3CF 3MICA 5FPLA 2QDRA 4DXSA 1XYPA 3CMGA 3G7DA 4B1MA 4CDUA 2Z42A 1BYHA 1GNHA 3BIEA 1QJU1 1SCSA 4RR3A 4C0BA 5FZ3A 4U36A 4ORFA 2PFWA 3ACHA 1TMF2 1HIXA 1V9U1 2BFUL 2J22A 5BNNA 5KC5A 3VB9A 1OOPA 2RMU2 3MLLA 2ID4A 3N9OA 3R4UA 4V2WA 4JKMA 3ZXEA 4W4ZA 4YZ2A 3N9QA 2WNUC 2W1WA 2WRAA 1F2NA 5FLIA 4AGVA 3KT4A 2OUJA 4QDQA 3LDKA 1MS4A 1BLZA 3NW4A 1QH6A 1XU2A 3VBHA 1ND3C 3RRDA 4XFIA 3MV01 4Q4V3 3UYJA 4B1LA 2VO5A 2JDMA 4DEQA 3FUQA 4CDQC 4BMBA 2VUAA 3CJIC 3IDCB 2E9QA 5EP9A 4UW6A 3RWKX 5A7OA 2EALA 2GMEA 4IE5A 1GU3A 1Q8PA 1AYM3 4Q4W1 1A8DA 3Q8CA 3LIGA 2XKPA 2PQQA 3LA7A 4QD2A 4RQPC 4HKOA 4YW7A 5A32B 3TNQA 2IUWA 2NQYA 2P3KA 1N1TA 3ILNA 5DABA 5GLUA 1FNZA 2X5IA 4LBJA 4Q8LA 3SISA 5FZ9A 3E5XA 2E53A 2X5IC 3MGUA 4KWUA 2GC1A 4PF1A 3BKZA 2BV4A 2UY9A 2RS53 5AC91 1V6JA 2IXIA 2F17A 2YROA 1SBEA 2LUWA 1YFWA 3FHQA 4OHYA 2WZPP 3C7HA 2HEVF 1N1YA 5C4WA 2IFRA 3AVSA 3Q9OA 4IE6A 3ZN6B 1C8M3 4WVMB 4OUEA 5KC6A 3JBG2 1Z7S1 4BMEA 5C4WC 5FPVA 3OEAA 4MXWB 1JHJA 3B69A 2GC3A 4UFMA 4CDUB 1CAXA 3DECA 2L9LA 1SG3A 3QH7A 1LOFC 2VUCA 4META 2LM3A 3AM2A 5F2WA 2BP6A 5DMYA 4YG0A 3HEIA 1VAMA 4OUMA 1ZZ7A 4Q0UA 5K0UB 4NRMA 1PO11 3OY8B 4GH4A 2BWAA 4GXLA 4QM9A 5HV4A 1V6NA 1B09A 4GMP0 1T6BX 2CY6A 5DDJ1 1LCLA 5H9RA 1UAIA 3AMQA 2XQXA 5CADA 4N7IA 5L7OB 2RHPA 1MS1A 4BIOA 2E26A 4Z92B 2XBO1 2ZHKA 2JKXA 1W06A 5H9PA 1UYZA 1VAKA 3ATGA 4F7ZA 1W0OA 1AR83 4IV1C 4JDMA 3H0OA 1H6XA 3VZJA 1JYWA 1WW6A 1JZ5A 4URAA 3MO4A 2YHJA 3LFIA 1HN1A 2R071 2VCCA 1KS5A 1VBA3 2XH6A 4PT6A 5A3TA 4PDWA 5I0DA 1BKZA 4AVVA 1QJFA 2SLIA 3VBRC 5C33A 3I8TA 3AZYA 4EJRA 4M0HA 5AFBA 4FTBA 5G05L 2FDJA 1FX5A 3ES4A 3ZYIB 4RHV3 4Z1VA 1ZRIA 2ZGPA 1NLRA 1BZWA 3IT8A 4L9BA 3HT1A 4MGIE 3KM5A 1W2TA 3WCSA 1SMVA 2HWB2 2P5BA 4EWAA 3MIDA 3CJIB 2WJSA 2BVVA 4QXBA 5EJ1B 4BLIA 1RJ8A 2P3IA 2A73B 1I5ZA 2G4IA 5IK4A 1W6PB 3EJKA 1CAVB 4NN0A 4BQWA 3I3EA 1A3KA 1NCRC 1ODNA 3ALQA 1OH3A 2CHHA 5I0TA 5L36A 4R8HA 1UMHA 2ZX3A 3ORJA 4OLLA 4JDOA 5EWSA 1JUHA 2VNGA 4L8QA 1JYIA 3V0BB 3ELNA 2PA7A 2Y0OA 3KV6A 4UFKA 5FPUA 5LBBA 5IVBA 4XJZA 3B94A 2X5IB 2PHXA 5D1IA 2DUQA 4QWNA 2VW0A 1X7NA 3ACFA 3VBRB 1H8VA 2EAAA 2Y6HA 1Q43A 3BUCA 3ZFEA 5FY9A 5FY5A 4FP3A 1STMA 2K46A 1OQ1A 4JKLA 4A42A 3EYPA 1LHNA 3FZ3A 2W08A 1X33A 2GALA 2E7TA 3MYXA 5F32A 3A23A 4XUNA 1W9TA 3K4ZA 2VMIA 4WZCA 2RDNA 1AYN1 3W20A 3LPFA 1F5FA 1WA6X 1O5UA 1Q3EA 3NO8A 3H7YA 2BPA2 2O8OA 1OH4A 5FY7A 5LY1A 3PUAA 2Q30A 1X50A 4KQ7A 3W9AA 1Q5OA 1MS0A 1CJDA 4YW3A 4K1ZA 2D3PA 4LBOA 1RUD3 3C2UA 2NMNA 1XE8A 3B9IA 4JGZA 1PNFA 5J1XA 1W6OB 5JLVA 3P5BA 3WHUA 1IQAA 1PM4A 2JDUA 3E5UA 4NHKA 3VV1A 3W59A 2PXJA 1LECA 3VBOC 5LWBA 4LBQD 3OPTA 5GLTA 2JD9A 3SEEA 2X10A 4LKEA 3RI9A 2DVBA 3AC0A 5FYYA 4NIGA 4AI9A 1COV1 2ZGKA 4L97A 1FATA 1W8OA 4XCBA 3ZYPA 5M0TA 1F4HA 4FPLA 4YPJA 2JDKA 5JMOA 4KL1A 4HKLA 5FMOS 1BBT3 1HV1A 3QCWA 3R0RA 4E2SA 4YGDA 1ZA7A 2LTNA 5AVPA 1MS9A 1P8JA 2ADDA 1EV11 3ZFGA 4A6SA 1F9KA 1TNRA 1DGLA 2ENRA 3A21A 3BCWA 4FT8A 4YWAA 4D0QA 5K7PA 1CAWB 1DZRA 1VBC2 3GJBA 4KG8A 2WSUA 3ZXFA 5BNNC 2DV9A 2FZ2A 2ZGNA 2A6ZA 4J1XA 4DPNA 2VMEA 1HN0A 4TZDA 1K5MA 4JC1A 4EN0A 1O6UA 4WVMA 1POV1 2JG8A 4ZXEA 3VL8A 1KJRA 4HLTA 2BNMA 4G9SB 1ND2A 2VTXA 3GBFA 4AEKA 3GF6A 2HH9A 4P5YA 4BWOA 1POQA 4Y1XA 3VDAA 3O1UA 1A34A 1GOGA 5JSOA 5EPAA 1DQ6A 4CYDA 3SEPA 4A4AA 4LITA 1W99A 1Z7S2 5DAWA 2DFCA 4LBQA 1WCQA 4MHRA 5HXMA 4D8MA 3LQCA 2JDHA 4Q4X3 1PZ8A 4D3WA 2J1EA 2DURA 2YY1A 3AMNA 4EE2A 3VD5A 5L19A 4SLIA 3KLSA 2BERA 5DQ0A 2YXSA 4Y5SA 4NHMA 2JJ6A 3GM8A 2WFF3 3U11A 4CE8A 2A5ZA 3AJYA 1PO12 2A1XA 4I01A 4QPIA 5T5OA 1AX0A 5T55A 1U5ZA 1RUF3 1BMV2 3N7LA 2NYYA 1NA1C 1WBLA 1S0FA 3T1LA 2BW8A 2VZRA 4NIIA 3ZM8A 3T2OA 2BZDA 1Z7S3 2XBO2 5A1LA 1OUXA 3SC7X 1QY4A 4BIFA 3J7HA 2ZZQA 3ITQA 1VRBA 2JDAA 4PDWB 5CIRA 3IWZA 4NIAA 1V0AA 4DY3A 1PX4A 2HWE1 2YV8A 1HRI1 3MBWA 1UZYA 4XMAA 3M2MA 1C8M2 1CZTA 3KV9A 2VQUA 4SBVA 2BGPA 2P3JA 3IIAA 2HWD3 3H7JA 3JBG3 3PU3A 4LE4A 3HMYA 4NROA 2JD4A 4CEWC 2YPDA 4EQVA 2G1MA 2PTMA 3N7JA 1YLLA 2E6VA 1GMMA 2PHLA 2Y6LA 4JAAA 3THPA 4AWDA 1PO13 2GSYA 3LA2A 5BUVA 2WKKA 3UV9A 1TQ5A 1YQ5A 1KEXA 3ZN4A 4HN1A 4CXXA 5JZGA 4O9EA 2BBVA 1RUI1 2Z5WA 1AL22 1BXHA 4N43C 4C0HA 5G04L 2CAVA 1EUTA 4D6RA 3CBNA 3ST7A 1NZIA 2XBO3 5HCFA 5A7NA 3DPRB 3UJQA 1QOSA 1OLME 1PK6B 1RUJ1 3GXUA 1W3XA 3R4DB 5IJRA 5C9AA 4A7YA 1JXNA 1PIV2 2XUEA 4FOQA 4HVOA 1CZSA 2DDUA 3H1WA 1RXFA 1TE1B 2NZ9A 2W91A 5DG1A 3SH4A 1MVEA 1S0GA 1GQPA 4P9IA 3BTAA 3SH5A 3S30A 4CA9A 3I2JA 3KHBA 1S0IA 1E5SA 3DEMA 1T6GC 4ET7A 1UY3A 1QQP2 4GQ7A 4I3PA 1AR82 5IUQA 2AUYA 4RR3C 5JOWA 1AL23 5I8YA 1JYVA 1G9AA 4UW3A 2R063 3UKTA 1HRI3 2SBAA 3DUIA 4HPKA 3KV4A 2DYCA 1CESA 3K2OA 2K0GA 1W03A 3LSEA 1ULOA 1QKQA 2DBNA 4RA0A 4XIOA 2QQNA 4DEVA 4AZZA 3ZKYA 5A3WA 4FTSA 3MZHA 1I6XA 1N3OA 5CKMA 1QIQA 4XUTA 2I07B 1YFUA 2RE9A 4ES8A 4CUAA 1RUG1 5GZGA 5KBFA 4GWIA 1OURA 3MIEA 1EAH3 2WZR3 4E2QA 4P08A 4IL7A 3AZZA 3POWA 5DAXA 3VZMA 1JYCA 2XHNA 4ZZ8A 4RS5B 1UY4A 5CISA 4GWJA 1AF9A 3TOJA 4XQWA 1SEFA 3AYDA 3T08A 3ZOIA 4XFAA 1POV0 3ZPYA 1X36A 1ODMA 2WYSA 3O5SA 4CU8A 5LA1A 1ZBA3 1ULPA 2HWE3 1HQLA 3LDRA 2P1BA 4XACA 5C3QA 1ZZBA 2YB7A 3DN7A 1CAUB 3VBOA 4TTGA 4NIHA 2WIIB 4QGNA 3PL0A 3O1VA 4CPBA 1W9YA 3CF6E 2JXAA 3MV11 4A7ZA 4R9CA 5CBLA 4Q0PA 3W5NA 4LHNA 1ENSA 5GZCA 4CCDA 4M4RA 3I2DA 1GKBA 1E5IA 3BPZA 1DQ0A 1AVBA 4P00B 5FREA 5KHGA 5FZLA 3WDXA 1IHMA 5FYSA 3D5OA 3FMGA 3TNPB 1UU4A 4GH4C 1D4M1 4XUQA 5A3OA 3DPRC 1VBE1 3RNSA 2DU0A 2DU1A 3IIIA 4XFGA 4Q4X2 4LE3A 4CP0A 1AR91 3WVJA 4AEDA 2HWE2 2Y6FA 4Q2FA 3CHXA 2W92A 1J83A 4JTOA 1NE6A 4N90A 3H9AA 3UT0A 1PVC2 3ZFEB 1RUOA 1HRV3 1AXKA 4YNIA 4UWDA 1UKGA 1QEXA 1VB4A 3ETQA 4XHBA 4Z82A 5FYUA 3U10A 1W8WA 3FN9A 4CP2A 4YZ5A 2ZGMA 4JHTA 3NQHA 2RV9A 1IKQA 1UW8A 5C8CC 4XUPA 5IATA 4QB1A 4AQ6A 4UW4A 1RUF2 1HQWA 2DFBA 4OYUA 1O7FA 1G86A 1QJY1 1VBD2 1YHFA 4FXGB 4JVAA 4LR4A 5I0UA 4NPRA 4BQ1A 1OD3A 1NX9A 4LA2A 4XF3A 5DXDA 2YYOA 2R061 2XJUA 3GJAA 5E89A 2PYTA 4YGEA 4CDWB 3M3OA 1REEA 3WINE 5C3PA 3SKJE 2XKOA 4MGQA 1W05A 1RUJ2 4TWTA 4FOYA 4QXKA 2W1UA 1JOBA 3ZX7A 1WW4A 2W94A 4AQTA 4FVVA 1S0JA 4AFMA 5FZFA 3VD3A 1YFXA 5CKNA 3AXEA 1LHVA 4GB32 4V1PA 3TN92 5KWRA 4IESA 4D7SA 4LBLA 4FBFA 1D4M3 1ZRDA 1OKQA 5FYZA 5LK5A 4EYUA 4L11A 2QBXA 4Y33A 5CFDB 3AP5A 2ZMKA 5I8SA 3N7MA 4I0BA 4AI3A 2WFPA 3AVRA 4LKDA 5FFOC 4IE7A 1IS6A 1J1TA 4AXOA 4XW3A 4LORA 4HL0A 1EPWA 1ZX5A 1K42A 3THDA 1D7PM 1MPXA 2FCUA 4EWEA 2PAEA 3ZPOA 4QX8A 4CDQB 5IK8A 4ARYA 3EHKA 3WF1A 1RUD1 2P34A 1BQPA 1W39A 1JMUB 4D94A 4KWKA 3WXPA 1AR63 1TME3 3MEPA 4QXHA 3N9LA 1ULEA 3VBFC 1D4M2 4X6QB 1OT5A 3GHNA 4FI9A 3POIA 5FPBA 5LCWL 4IGOA 4P9YA 3OBZA 1O8PA 1APNA 2DCJA 2R062 5KXCA 1W2AX 5FOBB 3ZO0B 1XYNA 2VD7A 3FHAA 2XUMA 3WQ1A 4LKSA 1TVGA 4XF9A 3MF9A 4DY5A 2D93A 1XYOA 3S5AA 1W2NA 3BTYA 4B8EA 4QPWA 4WM7B 3OBTA 4RD7A 1YI9A 5IW0A 4MXWA 2ZMLA 1YJLA 4GA9A 4YM3A 3T2PA 1H1AA 2WLPA 1OA2A 1V6IA 2WBKA 4LULA 4AFBA 4CU7A 3S57A 4PQQA 5GZEA 4AGGA 3WG4A 5C3SA 3LOIA 1GWMA 1F15A 1UOFA 2VPVA 2WR9A 1PZ7A 2WN2A 3LKJA 3ZDVA 2RS11 3RDIA 4LLFA 3LEKA 5A70A 2ZA9A 3DKWA 3VZOA 3AZXA 1KGYA 3OUHA 1NY72 3C3VA 4ZPIA 1Y43B 1L7LA 1U5IA 1MACA 3GDBA 3B02A 4LUKA 4XJUA 2DVDA 1QOOA 1YQCA 5GLWA 5A32A 3NAPA 5JR7B 4BK5A 4AEDC 2RS31 4QPGA 4ONUA 4MGZE 2YBKA 1SHWB 4Q4X1 2X8KA 5FPXA 1I3HA 5C70A 1MS8A 1QJX3 3HVDA 4Y20A 5CKQA 3TEZA 3LOBA 1F8VA 1B35A 4AQ2A 1OHFA 2D7FA 1VMHA 3OF1A 5IAVA 5FZOA 2XGXA 3OUIA 1C57A 1RUNA 5DPNA 2GDFA 4M3CA 1SLTA 4HZFA 2IVIB 2HBUA 2BUKA 5ACA2 2ZGOA 4KI5M 4I3GA 1GWKA 3MPPG 1RUF1 1GANA 1HV0A 3O7OA 3TEXA 1L3JA 1E5HA 4DXRA 4Y4YA 4P9LA 2QUOA 3W5MA 2JG8B 1LOCA 4RFT0 2OKXA 5BXXA 2ES3A 2Q8EA 2R1DA 5AVAA 1OF4A 4MX3A 4LO5B 1KQRA 4YG6A 1GBGA 4NRPA 3WNLA 5FK7A 4WVWA 4CUCA 1W04A 4XJAA 4L2NA 1PMIA 2QZ3A 4KGGA 5J7MA 2EIEA 1NCRB 2PAMA 2FBEA 5JIAA 1GP6A 3WDVA 4Z2AA 3POBA 3NV2A 1NA1A 2C9KA 3GCXA 2OW4A 1GQGA 1UXZA 2BRTA 3IAPA 1GYKA 3IPVB 1WW7A 3PTRB 1FPN1 3M1HA 4X8PA 4ZHNA 1Y9QA 2P3YA 3E6DA 3WW2A 1YC61 3M70A 3GBGA 3R6SA 5A3UA 2RM23 4DB5A 4AFCA 1WCUA 2YDEA 1O5LA 4XAEA 1QXRA 2A3WA 3RSJA 3GZUC 4LBKA 3RMXA 4B4QA 4IV3B 2ZJCA 1AJKA 2D6NA 4EN8B 1RUJ3 4FXKB 1ENXA 5FMCA 2W52A 1M4WA 2ZCWA 3LSDA 3BU0A 3ZN6A 4I02A 3KHCA 4JGZB 1PGSA 3Q8AA 4KG0A 4CDXC 4EV0A 2FCTA 2Q1FA 2WABA 2RR11 5ABJA 5EQUA 2Y6KA 4CDXA 3MLJA 1UOBA 3FUOA 4IEZA 5EV7A 4RS5A 2RS13 2CDOA 2PHRA 4YARA 1DG6A 3OD4A 1H8TA 2YC0A 1AL21 4NIDA 3PUQA 4YM2A 1SLLA 4R4ZA 1X8MA 5LBCA 3HNBM 3RS6A 3ZR5A 1WMEA 4PBOA 1W6PA 2IXHA 3KF3A 3WF3A 3P1IA 5J48A 3QACA 5FUIA 3DL3A 3DYMA 5T5JA 2XJVA 3EB7A 2LS6A 1AR62 2RDRA 3VBHB 4YZ1A 5F3IA 3HBZA 2XOMA 4MGSA 3VD7A 1PGL2 1F31A 4LO4B 5T3NA 3I2IA 1XQNA 3GBWA 3AFKA 2WA3A 4YFZA 1BVP1 4FFFA 5E6HA 4OHVA 4O65A 3KF5A 4DXTA 4RFRB 1KD7A 1S55A 1O3TA 2Y6JA 1NAEA 2VOVA 3ZSLA 1WZXA 4HVRA 3AKQA 4B3NA 1YUDA 4L99A 1BK1A 3CJXA 4CSWA 1GUIA 2ARCA 1YRZA 1CVNA 1SPPB 3CZUA 2XVKA 2DUOA 1AX1A 2R0HA 3VKFC 4CCNA 2B5HA 2KXLA 4B4PA 2YUEA 3IDAA 3VDBA 4GB33 1DCSA 3AL6A 5CU1A 3S7EA 5FTTC 2WNVB 2C4XA 1VE0A 4P02B 1HXS3 1KS4A 2QCSB 1MZ5A 4ZS3A 1PIV1 2DTYA 3IDBB 4QHBA 1LRHA 4S2GA 3ACIA 4NJ4A 2X29A 2ZX1A 5FYCA 5H9QA 5F39A 5CB7A 3ZYGA 4CVUA 4OULA 5ABJB 1DQ4A 3GNEA 1Q8QA 4INDA 1RUC1 1UWWA 2KD7A 4W65A 3UGGA 4IEQA 5ERLA 5FZ8A 4IV1A 4Y1YA 4QXCA 5D8AC 5EHDA 3I3QA 4DNYA 4E8CA 1N3QA 4Q1RA 2OA2A 3MPBA 4XETA 3DYOA 2ET7A 4NO4A 4JV4A 2D6MA 3TRSB 4LT5A 2VNVA 4IV3C 1NUKA 3AKSA 5FLHA 5SV8A 2QJVA 2PMWB 3C8XA 2CGOA 3PU8A 1BEV2 2H0VA 3E97A 4QAWA 2VBDA 4ZXKA 4XAAA 1J1LA 1Q8SA 3M3EA 2IZWA 5A3LA 1UYYA 2WN3A 3LWCA 3SCGA 3B7MA 2ZGTA 3E5QA 1KDKA 4XDQA 5JWPA 2WO1A 1NA1B 3VHOA 3AP6A 2F4LA 5K9YA 5ACA3 1AYN2 1JS9A 2Q0AA 2WWSA 1MQTB 3OGVA 5EJZB 2DCYA 4XXAA 5F3EA 4OQ8A 3KQRA 4LK7A 2XB6C 1I5PA 1DHKB 2IXCA 4Y4RA 3I59B 3N9PA 4NVPA 1OF3A 1SBFA 2YU1A 4XFBA 4ES9A 2JKBA 3I4IA 4M0NA 1LENA 2VNOA 1LR5A 1FXZA 2W1QA 5FUPA 1QXJA 1YIPA 1Q8OA 2E33A 2W9XA 1OSGA 4FPJA 4MVTA 5LB6A 2HWC1 3UGHA 2QQIA 3ZSKA 5FZBA 1GNZA 1PMJX 2HYXA 4CXYA 4R4XA 3CDZB 4EZHA 1NQDA 4AGRA 2Y38A 4N53B 1GSLA 2C6SA 3RFRA 2RS33 1CIYA 5ANQA 3IMNA 5K4LA 2R0FA 4PHZA 2VMGA 5T54A 3Q8FA 4RQPB 4K7JA 2N7GA 2UWAA 3LZZA 2AYHA 5E1RA 4HT1T 3T0DA 3R4SA 3I97A 2WDBA 1CJPA 2ET1A 4L0PA 3WF4A 4AI2A 3OTFA 2O8QA 4CP1A 3KGLA 5A7QA 4XIKA 3I2HA 5T50A 4DIQA 3WLUA 2Q1ZB 3CKHA 1LEMA 2R30A 1ALYA 1PK6A 5BNQA 1UN1A 2YMZA 4AYUA 1WD4A 4A45A 2QQKA 1MZFA 1LGBA 3MIBA 1RMU1 1ZZCA 5IFTA 3PVOA 3S7IA 3AL5A 4MOAA 4IDZA 1QU0A 5T5LA 5J37A 1ZRCA 3IMMA 4O61A 3WP3A 5JXGA 1US2A 4JCKA 1X9PA 4NPMA 4CXWA 3ZXDA 2Z69A 5FP4A 4Q4W3 4YZ4A 1XSRA 1LTEA 1AYM2 3SCFA 3H8RA 5D8AB 4LO8A 2VZOA 2GAUA 4Y1UA 3PUSA 1YXWA 3WR0A 2EIGA 4CCOA 4NE9A 3ZFGC 4NRQA 2QDNA 2RJLA 2RM21 2VMCA 3GGLA 4S2HA 2BGOA 1YCIA 1H2KA 2CU5A 2WO7A 3AZVA 1SFPA 4QM8A 4AE2A 1R64A 1LNSA 5L7OC 1F5JA 3AP7A 5FJKA 1EAH1 2WZR1 4AEMA 4ATFA 1V9U3 2J1AA 4M3CB 4I2OA 4CUBA 1UX6A 1AR71 2HJIA 3J9SA 2ZGUA 4QHOA 3PDQA 4TLFA 5FZ7A 5FZOB 1CWPA 4N43A 2XPJA 2W87A 2VXRA 4Q4W2 5F3GA 3WG1A 2XLGA 4AI1A 1W28A 1PGW2 5F3CA 1SZBA 3VHRA 5FYVA 2UYBA 1OLQA 2HWF1 4MG2A 3GYDA 5A33B 1H1MA 2OZ6A 5F5AA 3ZYHA 4JGYA 4YW5A 1AHSA 1KRIA 2OPWA 3HQUA 3LEGA 5K8SA 1WLWA 2G9GA 4AVBA 4UF0B 2WNUB 4IGPA 4MO3M 4N53A 2WZ8A 1JZ3A 2R042 1MR5A 4QX1A 1UF2C 3L2HA 3RZMA 3K77A 3O1OA 2VMHA 1V9U2 3IZOA 1HW5A 5FYTA 5C5TA 4HK8A 3ZYJB 4KH9A 2VAUA 4OZXA 1DGRA 1OQDA 4DO0A 2AC1A 2QFEA 4NHXA 5I93A 1B35B 2J1UA 2WWUA 3NNMA 3Q8BA 4YW2A 3U07A 1IG3A 3U4XA 5FZGA 4COUA 4LMFA 5BNPA 3LGRA 4UBGA 2WQZC 1ZZ6A 1RC6A 2V09A 3OPZA 4IEOA 4HVQA 5JCTA 3I7DA 1W9WA 1GLHA 1NXD1 2EF6A 2XONA 5F2SA 3PUIA 3AFGA 4K3UA 1CN1A 1REFA 1R091 4H3WA 4AHXA 5IHRA 1K3IA 1KFUL 3S5QA 2VVFA 2X09A 4KMQA 3G6JB 4YW4A 3DXTA 2WC2A 3F95A 4BQ4A 4XF1A 1LGNA 1Z0HA 5CVRA 3NNLA 1ZBE3 3VL9A 5ABJC 5C6CA 5JZGC 1SDWA 3OGGA 2QTWB 4Q4Y1 2HWB3 2VMDA 3WP4A 4P9JA 3HT2A 4UYBA 3WEZA 5FBZA 3JCIA 4AAPA 1IS4A 1DLLA 1DBNA 3I3BA 1O3RA 5J96B 1CR7A 2CWSA 2J1SA 3D4KA 4LJHA 4QDSA 1HJFA 4YVWA 5T5PA 4B7EA 4IV3A 1W6OA 5A80A 4IUGA 4YZ3A 5C9AC 2WZEA 2B39A 5K0UC 4JZRA 1NG0A 4FTEA 3P6BA 4LQRA 1UKRA 4H7MA 4P9GA 3MW4A 1BEV1 4XILA 5SV5A 3NJZA 3N9MA 1LODA 5FZ4A 3MW3A 1FOD2 1LHWA 3WP6A 4COWA 1VBC3 2E32A 2G9FA 2B46X 2ZAAA 1NCRA 4QKFA 1X8EA 3AYCA 3POSA 5FP8A 5DAPA 2EICA 5L73A 4YYOA 4C1WA 4IQPA 1V6LA 5FY1A 3TN91 3BB6A 1SPPA 5JMCA 3QBQA 2VBBA 1RUC2 4NUBA 2H6CA 1C1LA 4Y3OA 5CFCC 1R093 5LRRA 1XOYA 4A3XA 1Y9MA 1VLNA 4FPCA 5BPXA 3TBDA 1OKOA 4Q0SA 2D5HA 1DF0A 5AC92 4M01A 4ZU5A 1O8SA 3KMHA 1UPIA 1UL9A 1GZWB 4NAMA 4CU6A 4PLOA 4MLOA 2Y64A 5DUWA 4G3YC 4CUGA 4PQ9A 1VBB3 3A0KA 2DUPA 3NJXA 3NJYA 5JXIA 4N8MA 3W21A 4PI0A 4DZGA 3P3PA 4CP9B 1COV3 5FZAA 3S6PA 2EIDA 2JDZA 1WKYA 3VBUA 4DQAA 3SXWA 3WHTA 3VUOA 2A6WA 3EBRA 1HB2A 5KXDA 1RGSA 1JOPA 2VE1A 4RQPA 5C8WA 1N47A 3WW4A 4X6RB 1NLSA 1YQ2A 4I09A 1QJU3 3UKVA 1H2NA 2R49A 4FPEA 3WY6A 2ETEA 1HLCA 2RS51 4CDWA 4GWMA 3KT1A 5AC93 1PK6C 5JR2A 4UFHA 4FP2A 3EMRA 3WNPA 2MEV1 5IYYA 5FWEA 2C26A 1JBCA 1OLRA 2V4VA 2HWC2 3KCXA 5FCCA 1VRH2 2DBIA 1E57A 3SCHA 1LU2A 4MXVA 2UYAA 1VBB2 3PVEA 5ACA1 2RDQA 5FKCA 3NKTA 3ZSJA 1YYNA 2HWD2 2WAAA 5JZGB 4MSVA 1QXPA 1O91A 1EP0A 3VGIA 5DUVA 3WDUA 3ZYBA 3GALA 4Q4V1 3VKLA 4WVVA 3USSA 3RJRA 2HLEA 2FDGA 1WW5A 1Y7BA 3UJOA 1OVSA 1QDCA 3ZIXA 3MIHA 2RR12 5FQ0A 5HBAA 2CGNA 1XNTA 3VZKA 4X8NA 3KQ4B 2GZWA 3V0AA 3IB3A 2YFZA 3I3MA 3ZFGB 1NCQA 2XJPA 3MUY1 2RG4A 2ZKLA 3IKWA 2VC9A 3MFCA 1OC1A 3RJ2X 4Q29A 1DQ1A 2P37A 1JOJA 1BBT1 2VM9A 1KFXL 2PQSA 1UZWA 4GD4A 4RHV2 5F37A 2UU8A 3POEA 1L7QA 5CEHA 3WW1A 4BQ2A 5FO8B 2OYZA 5IT6A 1JZ4A 2IXLA 4QQHA 2H6BA 3J7NA 1DQ5A 1W0PA 2P6CA 4D7TA 2ZX4A 2JWPA 2BNNA 4ZKTB 5CZKA 4NMIA 3N9NA 2BDRA 5C4WB 3Q8EA 2FQPA 3T30A 2RR13 2WT0A 1Z78A 4LKFA 3N4MA 3H3ZA 2A3XA 3HJRA 3UGFA 3P3NA 1JHNA 2XDVA 3NJVA 4IEXA 5CG8A 3NVCA 2FMYA 1UQXA 4EWDA 1DYKA 3V0BA 5BNNB 2XVLA 1DGRN 3JZVA 4LHSA 2Q4SA 2PLV3 3PURA 2W2IA 2OS2A 4M00A 1S0BA 3M3QA 3PLQA 1JW6A 1ENQA 2GNDA 2YC4A 4HANA 1QMJA 4UBHA 3I3DA 4W6WA 3X29B 3RZKA 2AENA 4XYXA 4HMZA 4H55A 2IC1A 5FZ1A 3LAGA 1XNBA 2J1VA 3LIHA 1ASJ1 1H9PA 2VTXJ 3MF6A 4QGLA 4C1XA 3O1RA 2ARAA 1UNBA 4QB2A 1VP6A 2JG9A 2Y26A 2YZ4A 4UAPA 1JZ7A 4IGQA 1MEC3 5FYHA 4FPFA 3NAPC 1D2SA 2F6BA 2WS92 2ZEXA 1PVC1 3APBA 3B01A 3FBMA 3NMBA 4D69A 3B5LB 5FP3A 3MIFA 4CDXB 1UIKA 1AXYA 4AEJA 1DQ2A 2G9ZA 4H7LA 4WM8C 3RWNA 1PGL1 1Y4WA 2V72A 1RUD2 2B9UA 4GAZA 2WLQA 1CGPA 3FLPA 5LZ6A 3PIGA 3OB8A 1W90A 1R1A3 3M3IA 3U0ZA 1ZA4A 4OMCA 4AL9A 3D0JA 1IKPA 1LKNA 3CJIA 1XPWA 2WNOA 4BM8A 1SFYA 4Q1PA 5A7WA 2VVDA 3JD72 4I30A 4E9KA 1GOHA 4IEPA 5C3OA 4RS5C 3WV6A 1UPSA 4XTMA 4AW7A 1RUE2 4YW1A 1HRI2 1UY1A 2PELA 3OEBA 4XBQA 1GP5A 4KBBA 2JIJA 5K0UA 5C9AB 2FDIA 1LGCA 3U37A 1OUSA 2A6YA 3H8XA 1FAYA 3ZYFA 2E63A 5EXOA 2WQ4A 1RUI3 4P5HA 2EXHA 4QGMA 3N7KA 3T4VA 4AK3A 2JDYA 2WSVA 4XTPA 2J1RA 4XZPA 1W8UA 4GJYA 3O1MA 4F8AA 1WCSA 1ASJ2 2YG0A 1D4VB 1DP0A 1YEWA 3MW2A 2PHDA 3WW3A 2ORZA 2RDSA 4ZONA 5JUVA 1AR73 1PVC3 1SLCA 4FFIA 1QOTA 4FQ4A 1BEV3 2RMU1 3LDBA 3MIGA 5EYYA 2QQUA 4XHXA 5KHKA 4MGYE 3C7EA 3DCQA 1UMIA 1RUE3 1V00A 3K48A 1VBC1 4A44A 1IS3A 1QJU2 4RGAA 5GALA 1PZ9A 4GH4B 5HXVA 1OOPC 2Y60A 3D82A 1VBD3 3FC0A 5JI7A 3WF0A 3WQBA 5IVCA 1US3A 3GZAA 1O59A 3JUUA 5IWFA 3HIFA 5DZFA 5FZ0A 2GMPA 3E6CC 1EYBA 2AREA 3C7FA 1H6YA 4OHWA 4P9XA 3BYWA 4Q4Y3 5TSWA 1JU3A 1JN2P 1LOEA 4E4SA 2JECA 2KA3A 1R083 5FJHA 4W8JA 4DRRA 4GKYA 3VD4A 3KVBA 2W0XA 5HCAA 1RUC3 1IPJA 3A7QA 3KZ4C 1AR72 5KHIA 1IGOA 1VBE2 2W5FA 3FE5A 3QH6A 4XVHA 4YGCA 2D43A 2NP0A 3UETA 3L2YA 4LTAA 4XQ4A 1QQP1 3RYPA 3U78A 3NL1A 1S0DA 2B9VA 1TG7A 3LD8A 4ASKA 5AFEA 3K51A 4HBNA 4HSJA 1VMJA 4LPLA 1JODA 4CCEA 3M7AA 1PO22 1LHOA 1OMIA 5EJ3A 1ZVFA 2A3YA 4XBNA 4JGYC 4F83A 2A6XA 1OOPB 2PHUA 1EV12 2YGLA 2AH2A 1KDMA 3WDTA 1GP4A 4YM0A 2V5DA 5LBFA 1EPZA 3PMSA 2R6QA 4AQSA 1GZCA 1UMZA 3O1SA 2XLAA 1W9FA 1N1SA 3C7OA 2BQPA 3KCCA 4W50A 5LK7B 2VQ0A 2NLRA 5FY0A 1N3PA 2ZEYA 4RGGA 5C5UA 2E51A 4TN7A 1TME2 2JB8A 3CIHA 3I59A 4C8DA 2PHFA 2DTWA 2VZPA 4RHV1 2FD8A 1MQTA 1RVF3 2WT2A 3WNNA 2VGDA 1U5XA 3BIWE 2RS52 1XSQA 1NCQC 2HWC3 3DPRA 3TAYA 5FIXA 3OY8A 4A7KA 2VZUA 4BZ4A 1X9TA 2GN7A 2Q5TA 2QQJA 4Q8KA 2P2KA 2D3SA 4QX7A 5FXZA 1Y3TA 3NNJA 4CEWA 2CWMA 3D6EA 4Q26A 3T2TA 1ST8A 3ME2A 4MUVA 1G9CA 1FMD1 5CYYA 4Z07A 5FP7A 4ZY9A 2OQ7A 2VXJA 3PJQA 1NZCA 3BGAA 5FZ6A 3AKPA 4FFHA 3WOGA 2VNRA 2JE7A 1LU1A 3RI8A 4BCUA 4Q0QA 5F5IA 2OUHA 3I2OA 1RUG2 2GNMA 2CTVA 2GP5A 3AMHA 3KS7A 3VBRA 4AEDB 5KXEA 4DRVA 1O4YA 4XE9A 1GV9A 4BDVB 3O1TA 1WLDA 4TXWA 4BB3A 3V0AB 4JTNA 4CRQA 4UT5A 3ACLA 3DV8A 2FCVA 5JVVA 3INAA 4PIYA 4CCJA 1ND3B 1CIWA 1CX4A 3V56A 4B4RA 1O3QA 2C9AA 3ZN5A 2A6VA 3ETPA 3AYAA 3L9JT 4RL7A 2CSGA 2HEWF 4OCTA 1BCXA 1YI7A 4UFIA 1XNKA 1AUYA 4QX0A 3WUDA 3NV4A 2AEYA 3OBAA 4TYSA 1JTZX 3GZTB 1LAJA 4DMIA 5LA2A 1H9WA 1H0BA 1VBA2 4FOWA 3RG0A 2C5DA 4BA6A 4AF9A 4XJ8A 5JAXA 4JQRA 5A6XA 2W39A 4NHYA 5LATA 4EZ4A 2EXKA 5JXJA 2WNUA 2JDPA 2ZHMA 1OLMA 2ZGSA 4CEYA 4LBMA 1UOJA 4OVEA 1QDOA 4LNVA 4XDOA 4JGYB 5LASA 4WVZA 5CNAA 2B4KA 2Z2SB 4ZS2A 3AJZA 5A7SA 1ZRFA 1W0NA 4NHLA 3FHIB 5GLZA 4OQ9A 3VBFA 3VDDC 3VDCA 5A1FA 2FMDA 4QPGB 5BNOC 3LF7A 1CPMA 4CP9A 1SLIA 3POFA 2GC0A 1W3VA 2QQWA 2QZ2A 4XC9A 1K5MB 1OQEA 1SFNA 1VPHA 2W47A 3FJSA 3B3QE 3OGSA 2ZACA 2O14A 1H8TB 3VHPA 2XG3A 5FO7B 3JD71 2CV6A 4YG3A 3WDWA 5DG2A 3SH3A 1JZ6A 4E4DX 4U2AA 4A3ZA 4GKXA 5DUUA 3H42B 3ZXJA 1NCQB 2WYFA 3VKMA 1NE4A 3R05A 3FLRA 5A3NA 4B29A 2TBVA 2QQPA 2K2SA 4WV8A 2Y0IA 3CNAA 3V65A 4CPBD 5D21A 3LPGA 1XE7A 1JH5A 3LEIA 3MUZ1 1S0EA 1V6OA 4KWJA 1UZ0A 3OGRA 4NR1A 1NOVA 1UD1A 2TNFA 1AYM1 2ZBJA 4YLZA 4AVSA 3VDDB 4QB6A 1CZVA 1MS3A 1EAH2 2WZR2 4NWWA 3PNAA 2D6LX 2W3JA 3T4HB 4XCAA 4FSJA 4YFWA 4IV1B 3MDPA 4Q5OA 1MEC1 2JIGA 3DF0A 2VECA 3CU7A 3BVCA 5CG9A 3BTXA 1NXMA 1LOFA 1LOGA 3QD6A 4LXLA 1W6NA 1FOD3 3VBSC 4W6XA 1EV13 5ANNA 2QKDA 4D7YA 1H2LA 4QPIB 3AMMA 2Y33A 4QPYA 1TMF1 4BISA 1ZNPA 1FYUA 2BYVE 3FLTA 1W6MB 3J7MA 5HCHA 2E7AA 3GHMA 5DAVA 4RSUA 4IW3A 1VB2A 5FPAA 5J36A 3LEMA 3PUHA 2XWBB 3VKOA 2QQLA 4OMDA 3ZFFA 3ZMNA 5I91A 3T1MA 3H1MA 5T52A 3ZKUA 3ZYRA 3BOPA 5C8CA 2VCMA 3NRUA 4S2DA 4MADA 2VBPA 1RHI3 2HWD1 1QJX1 1H2MA 1LOBA 1A6CA 2RM22 4N7UA 4CU9A 4FAGA 2RJKA 5FR3A 1X82A 1ND2B 3PMEA 3J4UH 1UZVA 5JSRA 5LW9A 1W8TA 2TUNA 1XBFA 4LOSA 3CLPA 4BXSV 4IXLA 5EZWA 4QQPA 1VBE3 2BJSA 2XR4A 4QPIC 4QDRA 5A1AA 3S0MA 1WBFA 3E6BA 2GU9A 4FPGA 3HR9A 4N43B 1PMHX 4QX5A 1ACCA 4EN6B 5LA0A 3H3LA 2R073 4HSLA 4CDUC 3BALA 1S2KA 4JX0A 3NV1A 3AZWA 5IK7A 4HONA 4JRLA 2XMLA 2ATFA 2XQRA 3RZZA 2VH9A 1MVQA 3FL7A 5C8CB 1YIFA 5DAQA 1WLTA 4K9SA 1MQTC 3H8OA 1GQHA 2OXBA 3WG2A 1OPOA 4PCRA 1IZ3A 1YNAA 4OI0A 3A22A 3ENRA 1U12A 2R041 4XBLA 2Y34A 3T3YA 5F8PA 3D8CA 4XXPA 4BHPA 3O1PA 3OCPA 2BOIA 3B9CA 4L92A 4WBBA 2MNGA 4QHZA 2WFF2 3MLKA 2VZQA 1QQP3 2VL4A 4CDQA 2R072 2PAKA 4XEZA 1G9DA 2VR4A 4BQYA 1WLCA 3IN9A 2YFUA 1AXZA 1T2XA 4IEWA 5GZDA 1C28A 5C71A 1YWKA 3WNMA 1I1EA 1S2EA 4DINB 2WUHA 3GCWA 1N1VA 4IE0A 2VUJA 2WAOA 3ECQA 2ZHNA 5A3PA 5FK8A 1V6MA 3ZXGA 2J1TA 1FOD1 2NPIA 2GMMA 1CAUA 4OZOA 5ISLA 4KNCA 4YM1A 3N36A 5IVYA 4K21A 3CL1A 5I0RA 2VQTA 1BK0A 2CL2A 2FDHA 4LA3A 4JGZC 4FQZA 1BVVA 3BI3A 3SQOA 1C5IA 2DCZA 2JE8A 3OYWA 3WSOA 2HWF3 3C7GA 2LROA 2D6OX 3A4UA 3U1XA 2G19A 3ZSMA 2QE3A 2Q8CA 4LHLA 2OX0A 3QOPA 5GKAC 1SQ4A 2HWB1 3I2FA 4QU1A 5CFDA 4O9GA 5E8AA 2R7EB 5H9SA 2ARBA 1CX1A 2OPKA 1PX3A 1DGWA 1W8NA 3TWIA 1FNYA 2AACA 4AI0A 3FWEA 3IBMA 3H3UA 3NWKA 3T0AA 5LY2A 2EIBA 1ZBA2 2F4PA 2O1QA 4NWVA 1XXNA 5IVJA 3VBHC 1OFSA 1QHDA 4KBZA 1C3HA 4K8FA 4QPGC 4JRAA 1MEC2 2YPJA 5FP9A 2R1BA 2HWF2 3SLIA 3WX5A 1RL3A 5L9BA 1L7RA 3N35A 4GALA 1K5MC 2WT1A 3POYA 1W2UA 1BHGA 5KHJA 3PHMA 2WNEA 2BTVC 1AR93 5J3UA 4DUXA 2FDFA 4AHWA 3OUJA 1WMDA 3LE0A 1J58A 3VZNA 2D6PA 1LHUA 3NSTA 4AVAA 2WFF1 5JIUA 5C7GA 3T0BA 1HRV1 4R9AA 4RGKA 1FT9A 1KXGA 4PDWC 4GIQA 4J1WA 4W6YA 4QU2A 3E1F1 1OA4A 3NNFA 1W6MA 3PJYA 3SMHA 4ASMB 1OD5A 4XZUG 2VW2A 3DXUA 5FMBA 5L9RA 4AFDA 4AOCA 1HRV2 3JD73 3VBOB 4ATEA 1ZBA1 4PIXA 1GNYA 4CEWB 2VOKA 1YFYA 2XL7A 4BXFA 1A78A 4KGQA 4MH0E 4MZUA 1A8MA 4XMIA 2IWGB 4J6GA 1CAWA 2EXJA 5F5CA 1IPKA 3LCPA 3RPQA 5FV3A 3OD0A 2DVAA 4OI1A 4QKBA 4K20A 1C8NA 1C1FA 1FV3A 3GZEA 3UKNA 3WG3A 4QQOA 1PGW1 3ZSEA 1TEIA 3MFAA 3POGA 3THCA 3ZR6A 2E7QA 4OHZA 1MZEA 1PM7A 1K45A 5FKBA 2ZKNA 2ZMNA 1EY2A 3UESA 4KU7A 3DGTA 4GULA 1XNAA 3VBSB 4ITCA 4F3JA 2QNKA 4GJZA 3H50A 1VR3A 1UCXA 2UY8A 4Q27A 5GJ6A 2ZEWA 2ZAHA 5DDJ2 2BBAA 4HK9A 4HXCA 1DFQA 5IVVA 1PVXA 4Y22B 1ENRA 3SHRA 1DU3D 2A75A 1W8HA 1VBA1 2ZZJA 3USUA 1QJY2 1ULFA 1VBD1 2ERFA 4COVA 4ZZ5A 1QJZA 3NV3A 2VTFA 4IETA 1VIWB 4ISQA 1UU6A 3VLBB 4MYEA 4CCKA 4XABA 3K46A 1TZOA 2ZX0A 5HCBA 1D0GA 4GZ9A 4Y26A 3FFZA 4Y1ZA 4AI8A 4XOGA 5IK5A 2Y6GA 3JBG1 1R082 1IQDC 4LIUA 1G9BA 4YVWC 3O0XA 4HOOA 2JDNA 1D2QA 1AR61 3KB5A 2WQ8A 4CTEA 2Z4FA 2VZTA 4XFCA 4AVTA 5A3MA 5DDJ3 5A33A 3VBFB 1W9SA 1EUUA 3K4DA 3TYJA 5F7UA 2VZ1A 1S0CA 4GMP3 5BYNA 2XJTA 3HOBA 3KT7A 1W8FA 4JQTA 3PVBB 4PBPA 2UWBA 1DYOA 5A6YA 4H14A 3ZVXA 1PO23 2P6HA 1QGLA 3T2QA 4IE4A 1GOFA 4OI2A 2I2SA 2VCBA 1WGPA 2R32A 2RS12 2JG9C 3I54A 3TB0A 1RIRA 3WDYA 4BQXA 4HPKB 3RZLA 1OVPA 2IXJA 3JU9A 4YVSC 1ZBE2 2RJ2A 2JENA 3KGZA 1CQ9A 4YGBA 3ON7A 4YVSA 3K3NA 3WNOA 1UZZA 1C4RA 5FRAA 3VDDA 2WO2A 4XPVA 3ROUA 1ND3A 4OHXA 2J7MA 4ZU7A 1Q8VA 1QJEA 1RMU2 2V73A 2ARXA 3FX3A 4HG6B 3HWJA 4K6BA 2E31A 2GH2A 3KVAA 5BNOA 4PJYA 1IPSA 1RVF2 1UYXA 2XJSA 2W1SA 2R043 1C5HA 5JPNB 1NY71 1MS5A 4KWLA 3OBRA 5JOXA 3RVHA 2AZ5A 1UY0A 1O4TA 1MZ6A 1RUH3 1J84A 5BV6A 5FQ0B 2DCKA 2B7YA 3AYEA 4RN5A 2VULA 1JZ2A 5B4XA 1IG0A 2PHWA 2D98A 4QQLA
chains in the Genus database with same CATH topology
3K4AA 4Y5Z0 5F6LB 4YVSB 4QT6A 2NN8A 1XNDA 2CAUA 3VBUB 2D44A 1U0AA 2IFWA 1U5YA 3AB0A 1JYNA 1TMF3 1REDA 2DVFA 3ZXKA 1QJX2 1RUG3 2ORXA 1XU1A 3AK0A 4YRDA 3JB4C 5CA6A 3IPVA 3HD8B 2ZGLA 1HDKA 1ULDA 1SACA 4I0WB 1IS5A 2WNVC 3A0NA 3AKRA 4AAXA 4CZSA 1R1A1 4I0AA 4JHZA 1RUH2 1PIV3 2WNVA 4UI9L 5BNPC 4PLNA 1FPN2 4HKWA 1NQJA 2A71A 5CFCB 3M8LA 5IFPA 5JSPA 2X53S 2BVBA 2D5FA 4Y24A 1HKDA 4DUWA 2K9ZA 1UXXX 1V70A 3HAGA 5FAXA 2DF7A 2OVUA 4ASLA 3JB8A 4OI4A 4AG4A 3T09A 1G6NA 1G7YA 2PN5A 3MI8A 3VBUC 2XLFA 3WNXA 3HN3A 4PLMA 5F1RA 4DXZA 2H0BA 3B93A 3PVNA 4AHZA 2XHKA 1ZYBA 3WD5A 3BU7A 2VOWA 3OGJA 1W6QA 1LESA 4XUOA 1OI6A 3USUB 3VN4A 4Y20B 5LEKA 2JG9B 4BK4A 4A41A 4FOVA 1RJ7A 3ZXAC 2BWCA 1ZZ8A 3CEWA 2VG9A 3N3HA 1KITA 2XWJB 2V5YA 4R52A 2A70A 2X05A 2VQAA 1GICA 1TNFA 2MEV3 5I0SA 2GN3A 3WT3A 3W58A 4C91A 3ZMOA 1QJY3 1J3RA 5DZEA 4M4PA 2NM1A 4Z8BA 3J8F1 3ASIA 4N9HA 3WQ0A 2Q1MA 4RYDA 3M3CA 3O0WA 3J26N 1QNYA 4R9DA 3RYKA 4XF0A 1LB2A 3WF2A 1GFF2 3WZ1A 2UURA 1WMFA 1AX2A 4GWNA 4DS0A 3HNMA 5JI9A 3VZLA 4LHKA 2VZVA 3H1YA 1OFNA 5JOYA 1ZRRA 2WA4A 3ZFEC 4Z2WA 1WCKA 2GNTA 3BODA 3TN93 2VMFA 3O0VA 2GC2A 4S2FA 4WM8B 3SKVA 1J3PA 1H8TC 2TEPA 4LEJA 1VRH3 2IXKA 3AX4A 1XC6A 2PLV2 3NNGA 4BYYA 1LJ7A 4P14A 2WL1A 5BNPB 4GB31 1SLBA 1FV2A 1VALA 1WUVA 4XF4A 3WP5A 4CDWC 1BJQA 4JDNA 4EN7B 1JZ8A 4KU8A 4UOJA 1HQNA 2CYFA 3M4FA 2XL9A 1FMD2 1S1AA 3OJBA 1CD3G 3AP9A 5KHHA 1HX6A 2LALA 2ZXQA 1SLAA 4IEVA 4PF5A 3JXSA 1RHI2 1W6QB 4EN9B 1VJ2A 2VCAA 1SDDB 1O4ZA 2WO3A 3OYWB 4AVCA 2DVGA 3ABZA 5CFDC 4FCAA 1RYYA 4DFSA 2UWCA 4BH9A 5FDBA 1ZZ9A 4FO9A 4LLOA 3I2GA 4BE3A 2QVSB 2HKXA 3B00A 1OPMA 4Y22A 5EYXA 5JDBA 4K1YA 1UX7A 3V64A 2NMOA 3THTA 1VAVA 3VD9A 3VBSA 1QH7A 2B45X 4A6OA 1AZDA 1YO8A 4XJWA 2ZGRA 5JOZA 3KCYA 1HXS1 2CDPA 2I74A 1GR3A 2JEMA 2PHTA 1TME1 4COZA 1FI2A 5JPMB 1I9RA 4OFGA 1LOAA 2JE9A 4WZFA 1DDLA 1SCRA 1RHI1 2EAKA 1ZM1A 1ND2C 1JU4A 3AXDA 1H4GA 3BOWA 4P9WA 1ASJ3 4COYA 1DIWA 5D8AA 2XJRA 2A7AA 4URTA 3EXUA 3CZJA 2CNAA 5DN2A 4NOTA 4GMP1 3HNYM 4E4ZA 4N53C 2WS93 2Z79A 3KD4A 1PO21 1XRUA 1GZ9A 3RQ0A 1H1IA 4E27A 4PIZA 1DZQA 2AR6A 4LO7A 5E88A 1DZTA 2KM2A 1G8WA 1QF3A 2RS32 4AFAA 4FPHA 3O12A 1AL0G 3UNPA 2O0OA 2ZX2A 4IERA 3HPNA 3FBYA 1AR81 5GLVA 3K75B 2JICA 3O14A 2B8MA 1C8M1 3WUCA 2PLV1 1IOAA 1CAXB 2I45A 1DYPA 2ZHLA 4TSVA 3ES1A 2MEV2 1H30A 2VU9A 3OG2A 4XURA 1RTVA 1POV3 4BPZA 3URFA 4LBQB 1RINA 4LUMA 4R9BA 1O3SA 1R081 2OZJA 5FMOL 5HI0A 1WCDJ 5EIYB 5CAZA 3UL2A 1DLCA 1RUI2 1FPN3 2D3RA 3SNMA 3ZFFC 1UIJA 5J09A 1RUH1 5EFUA 2VY0A 3EQEA 5B4NA 4DOUA 1YJKA 4ARXA 2D6KA 1CAVA 1K12A 5F5QA 1R092 2FZ1A 2ZS6B 4WM7C 4Y1VA 2MHFA 1CONA 3NAPB 1UU5A 3J8F2 4WM7A 3ILRA 2RVAA 2RMU3 4DUVA 5GZFA 3LB9A 2BGCA 2FHRA 1F4AA 1AJOA 1KJLA 5J98B 3HN1A 3VHNA 1NKGA 3DYPA 3ILFA 5F9TA 1AR92 2XJQA 4E8DA 2HYKA 4FPOB 5FPZA 1J59A 2BFUS 2R16A 1OA3A 2Y8KA 1BMV1 2VZSA 2ZOEB 4Q4Y2 4Q4V2 5B2GB 4LO6B 2VVEA 3JQXA 5GM0A 1SBDA 4BJ0A 2W46A 3IAQA 4OUSA 5E16A 3SITA 1RITA 4LBNA 1COV2 3AMPA 2GNBA 2C0ZA 4K40A 1RVF1 4RR3B 1VBB1 4UXAA 3CQOA 3ACGA 5LRSA 2ZEZA 3J8F3 2EVXA 2VOTA 2B42B 5FO9B 4IEUA 4XQDA 1DGWX 1URXA 5L7OA 2MPFA 2GH8A 4HETA 3ZXLA 4FAHA 2WS91 4AHYA 2VOXA 5KXBA 2D97A 4MGKE 1UY2A 1B35C 3KSCA 3I2KA 3UK9A 1RUE1 4E2GA 1PNGA 4JKKA 5BNOB 4FPKA 1V6KA 2LW8A 2W68A 1QNWA 4N9IA 5DZGA 1S2BA 2JG8C 4QX2A 1JYXA 3D3AA 1ULGA 4ZU4A 1WD3A 3EO6A 2Q8OA 2YC2A 5I8TA 4HN0A 5FOJB 4A2UA 2D40A 2ZPXA 5LEJA 2AGSA 1R1ZA 4CEYB 1G9FA 1HXS2 3ZDSA 1NYWA 1RB8G 1H4HA 2C1FA 2EA7A 2QQOA 4G4FA 4HFSA 2BNOA 2ILMA 2ZTNA 1PHMA 4XFFA 5DUXA 1ULCA 1D0HA 4IEYA 3IDEA 2ZGQA 3LA3A 3ZFFB 2W95A 1R1A2 1JUIA 4MV2A 1LULA 4B7KA 3FFQA 1FMD3 4QQ2A 1ZREA 5CFCA 1M06G 3JQWA 2HEYF 4Q0VA 5FLJA 1JI6A 4FPYA 1Q56A 3RYRA 3WQ7A 1LEDA 1XNCA 2DCTA 4WM8A 1J3QA 1VRH1 1GZWA 2DWRA 4C90A 4YSFA 2EXIA 1AYN3 3D0SA 3BN6A 4XFHA 3IM0A 4QMAA 2CGPA 3NKGA 2ZABA 5BY5A 2P17A 1ZBE1 1WA4A 2VW1A 4YVWB 2QQMA 4QX3A 3QLQA 3F2ZA 3WNKA 5HPOA 4ISRA 3AKTA 2OIIA 4UW5A 3AP4A 1RMU3 2YGMA 1ONAA 2VZ3A 3WCRA 1CPNA 5JXHA 1W6NB 1BBT2 4XJ9A 4BLJA 3ZIWA 2XVGA 4BOWA 3PTYA 1QWRA 4M3CE 3VKNA 3RMYA 5F6KA 2VJXA 2JX9A 4EROA 2WINB 3H8UA 2BEOA 3HQXA 3CO2A 4M3CF 3MICA 2QDRA 4DXSA 1XYPA 3CMGA 3G7DA 4CDUA 2Z42A 1BYHA 1GNHA 1QJU1 1SCSA 4RR3A 4C0BA 4U36A 4ORFA 2PFWA 3ACHA 1TMF2 1HIXA 1V9U1 2BFUL 5KC5A 2J22A 1OOPA 2RMU2 3MLLA 2ID4A 3R4UA 3ZXEA 4YZ2A 4JKMA 4W4ZA 2WNUC 2W1WA 1F2NA 5FLIA 4AGVA 3KT4A 2OUJA 4QDQA 1MS4A 3NW4A 1QH6A 1XU2A 3VBHA 1ND3C 3RRDA 4XFIA 3MV01 4Q4V3 2VO5A 4DEQA 3FUQA 4CDQC 4BMBA 2VUAA 3CJIC 3IDCB 2E9QA 4UW6A 2EALA 2GMEA 1Q8PA 4Q4W1 1AYM3 1GU3A 1A8DA 4RQPC 4QD2A 2XKPA 2PQQA 3LA7A 5A32B 4HKOA 3TNQA 2NQYA 2P3KA 1N1TA 3ILNA 5GLUA 1FNZA 2X5IA 4LBJA 4Q8LA 3SISA 3E5XA 2E53A 2X5IC 3MGUA 4KWUA 2GC1A 4PF1A 2UY9A 2RS53 5AC91 1V6JA 2IXIA 2YROA 1SBEA 1YFWA 2LUWA 4OHYA 3FHQA 2WZPP 3C7HA 2HEVF 1N1YA 5C4WA 2IFRA 3Q9OA 3ZN6B 1C8M3 4WVMB 5KC6A 4OUEA 3JBG2 1Z7S1 4BMEA 5C4WC 3OEAA 4MXWB 1JHJA 3B69A 2GC3A 4CDUB 1CAXA 3DECA 2L9LA 3QH7A 1SG3A 1LOFC 4META 2LM3A 3AM2A 5DMYA 4YG0A 3HEIA 1VAMA 4OUMA 1ZZ7A 4Q0UA 5K0UB 1PO11 3OY8B 4GH4A 2BWAA 4GXLA 4QM9A 1V6NA 1B09A 4GMP0 2CY6A 5DDJ1 1LCLA 5H9RA 1UAIA 3AMQA 2XQXA 5CADA 4N7IA 5L7OB 2RHPA 1MS1A 4BIOA 2E26A 4Z92B 2ZHKA 2XBO1 2JKXA 5H9PA 1UYZA 1VAKA 3ATGA 4F7ZA 1W0OA 1AR83 4IV1C 4JDMA 3H0OA 3VZJA 1H6XA 1JYWA 1WW6A 1JZ5A 3MO4A 2YHJA 1HN1A 2R071 2VCCA 1KS5A 1VBA3 2XH6A 4PT6A 4PDWA 5I0DA 1BKZA 4AVVA 2SLIA 3VBRC 5C33A 3I8TA 3AZYA 4EJRA 4M0HA 5AFBA 4FTBA 3ZYIB 3ES4A 1FX5A 4Z1VA 5G05L 4RHV3 2ZGPA 1NLRA 1BZWA 3IT8A 4L9BA 3HT1A 4MGIE 3KM5A 3WCSA 1SMVA 2HWB2 4EWAA 3MIDA 3CJIB 2WJSA 2BVVA 5EJ1B 4BLIA 1RJ8A 2P3IA 2A73B 1I5ZA 2G4IA 5IK4A 1W6PB 3EJKA 1CAVB 4NN0A 3I3EA 1A3KA 1NCRC 3ALQA 5I0TA 5L36A 4R8HA 2ZX3A 4OLLA 1UMHA 5EWSA 4JDOA 1JUHA 2VNGA 4L8QA 1JYIA 3V0BB 3ELNA 2PA7A 2Y0OA 4XJZA 3B94A 2X5IB 2PHXA 5D1IA 2DUQA 2VW0A 1X7NA 3ACFA 3VBRB 1H8VA 2EAAA 2Y6HA 1Q43A 3ZFEA 4FP3A 1OQ1A 4JKLA 4A42A 3EYPA 1LHNA 3FZ3A 2W08A 1X33A 2GALA 2E7TA 3MYXA 3A23A 4XUNA 1W9TA 3K4ZA 2VMIA 4WZCA 1AYN1 3LPFA 1F5FA 1O5UA 1Q3EA 3NO8A 3H7YA 2BPA2 2O8OA 1OH4A 4KQ7A 2Q30A 1X50A 3W9AA 1Q5OA 1MS0A 1CJDA 4YW3A 4K1ZA 2D3PA 4LBOA 1RUD3 3C2UA 2NMNA 1XE8A 3B9IA 4JGZA 1PNFA 5J1XA 1W6OB 5JLVA 3WHUA 1IQAA 3E5UA 3VV1A 4NHKA 3W59A 1LECA 3VBOC 4LBQD 5GLTA 2JD9A 3SEEA 2X10A 3RI9A 2DVBA 3AC0A 1COV1 2ZGKA 4L97A 1FATA 1W8OA 3ZYPA 4FPLA 1F4HA 4YPJA 5JMOA 4KL1A 4HKLA 5FMOS 1BBT3 1HV1A 3QCWA 3R0RA 4E2SA 4YGDA 2LTNA 5AVPA 1MS9A 1P8JA 1EV11 3ZFGA 1F9KA 1TNRA 1DGLA 2ENRA 3BCWA 4FT8A 3A21A 4D0QA 5K7PA 1CAWB 1DZRA 1VBC2 4KG8A 3ZXFA 2WSUA 5BNNC 2DV9A 2FZ2A 2ZGNA 2A6ZA 4J1XA 4DPNA 2VMEA 4TZDA 1K5MA 4JC1A 4EN0A 4WVMA 1POV1 2JG8A 3VL8A 4ZXEA 1KJRA 4HLTA 2BNMA 4G9SB 1ND2A 3GBFA 4AEKA 3GF6A 4BWOA 4P5YA 4Y1XA 3VDAA 5JSOA 1GOGA 1DQ6A 4CYDA 3SEPA 4A4AA 1W99A 1Z7S2 2DFCA 4LBQA 1WCQA 5HXMA 4D8MA 3LQCA 4Q4X3 1PZ8A 4D3WA 3AMNA 2DURA 2YY1A 2J1EA 3VD5A 5L19A 4SLIA 3KLSA 2BERA 5DQ0A 2YXSA 4NHMA 2JJ6A 3GM8A 2WFF3 3U11A 2A5ZA 3AJYA 1PO12 4I01A 4QPIA 5T5OA 1AX0A 5T55A 1U5ZA 1RUF3 1BMV2 3N7LA 2NYYA 1NA1C 1WBLA 1S0FA 3T1LA 2BW8A 2VZRA 3ZM8A 3T2OA 2BZDA 1Z7S3 2XBO2 1QY4A 4BIFA 3J7HA 2ZZQA 4PDWB 5CIRA 2JDAA 3IWZA 4DY3A 2HWE1 2YV8A 4XMAA 1HRI1 3X29B 1UZYA 1PX4A 3M2MA 1C8M2 4SBVA 1CZTA 2VQUA 3MBWA 3IIAA 2P3JA 3JBG3 2HWD3 3H7JA 2BGPA 4LE4A 3HMYA 2JD4A 4CEWC 2PTMA 3VBUA 3N7JA 1YLLA 2E6VA 2PHLA 4JAAA 3THPA 4AWDA 1GMMA 2Y6LA 1PO13 2GSYA 3LA2A 5BUVA 2WKKA 3UV9A 1TQ5A 3ZN4A 5JZGA 1KEXA 4HN1A 4O9EA 2BBVA 1RUI1 2Z5WA 1AL22 1BXHA 4N43C 4C0HA 5G04L 2CAVA 1EUTA 3ST7A 2XBO3 5HCFA 3DPRB 3UJQA 1QOSA 1PK6B 1RUJ1 3R4DB 3GXUA 5C9AA 5IJRA 4A7YA 1JXNA 1PIV2 4FOQA 4HVOA 1CZSA 2DDUA 3H1WA 1TE1B 2NZ9A 5DG1A 2W91A 3SH4A 1MVEA 1S0GA 4P9IA 1GQPA 3BTAA 3SH5A 3S30A 3I2JA 1S0IA 1T6GC 4ET7A 1UY3A 1QQP2 4GQ7A 4I3PA 1AR82 5IUQA 2AUYA 4RR3C 5JOWA 1AL23 5I8YA 1JYVA 1G9AA 4UW3A 2R063 3UKTA 1HRI3 2SBAA 3DUIA 4HPKA 2DYCA 1CESA 2K0GA 4DEVA 3LSEA 4RA0A 1QKQA 4XIOA 1ULOA 2QQNA 4FTSA 3MZHA 1I6XA 1N3OA 4XUTA 2I07B 1YFUA 2RE9A 4ES8A 4CUAA 1RUG1 5GZGA 5KBFA 4GWIA 3MIEA 1EAH3 2WZR3 4E2QA 4P08A 4IL7A 3AZZA 3POWA 3VZMA 1JYCA 2XHNA 4ZZ8A 4RS5B 1UY4A 4GWJA 1AF9A 3TOJA 4XQWA 1SEFA 3AYDA 3T08A 4XFAA 1POV0 3ZPYA 1X36A 2WYSA 3O5SA 4CU8A 5LA1A 1ZBA3 1ULPA 2HWE3 1HQLA 1ZZBA 3DN7A 3VBOA 1CAUB 2YB7A 4TTGA 2WIIB 4QGNA 3CF6E 2JXAA 3MV11 4A7ZA 4R9CA 5CBLA 4Q0PA 3W5NA 4LHNA 1ENSA 5GZCA 4M4RA 3I2DA 1GKBA 3BPZA 1DQ0A 1AVBA 5FREA 5KHGA 4P00B 3WDXA 1IHMA 3D5OA 3FMGA 3TNPB 1UU4A 4GH4C 1D4M1 4XUQA 3DPRC 1VBE1 3RNSA 2DU0A 2DU1A 4XFGA 3IIIA 4Q4X2 4LE3A 4CP0A 1AR91 3WVJA 4AEDA 2HWE2 4Q2FA 4JTOA 4N90A 1J83A 1NE6A 2W92A 3H9AA 1PVC2 3ZFEB 1RUOA 1HRV3 1AXKA 4YNIA 1UKGA 1VB4A 4Z82A 3ETQA 4XHBA 3U10A 4CP2A 4YZ5A 3FN9A 2ZGMA 3NQHA 5C8CC 1IKQA 1UW8A 2RV9A 4XUPA 4QB1A 4AQ6A 4UW4A 1RUF2 1HQWA 2DFBA 4OYUA 1O7FA 1G86A 1QJY1 1VBD2 1YHFA 4FXGB 4JVAA 4LR4A 5I0UA 4NPRA 4BQ1A 1OD3A 1NX9A 4LA2A 4XF3A 5DXDA 2YYOA 2R061 2XJUA 5E89A 2PYTA 4YGEA 4CDWB 3M3OA 1REEA 3WINE 3SKJE 2XKOA 4MGQA 1RUJ2 4TWTA 4FOYA 4QXKA 2W1UA 3ZX7A 1WW4A 4AQTA 2W94A 4FVVA 1S0JA 4AFMA 3VD3A 1YFXA 3AXEA 1LHVA 4GB32 4V1PA 3TN92 5KWRA 4IESA 4D7SA 4LBLA 4FBFA 1D4M3 1OKQA 5LK5A 4L11A 2QBXA 5CFDB 3AP5A 2ZMKA 5I8SA 3N7MA 4I0BA 4AI3A 2WFPA 5FFOC 1IS6A 1J1TA 4AXOA 4XW3A 4HL0A 1EPWA 1ZX5A 1K42A 3THDA 1D7PM 1MPXA 4EWEA 2PAEA 4CDQB 5IK8A 4ARYA 3EHKA 3WF1A 1RUD1 2P34A 1BQPA 1W39A 4D94A 4KWKA 3WXPA 1AR63 1TME3 3MEPA 1ULEA 3VBFC 1D4M2 4X6QB 1OT5A 3GHNA 4FI9A 5LCWL 4P9YA 2DCJA 1APNA 5KXCA 2R062 1O8PA