2DCKA

A tetragonal-lattice structure of alkaliphilic xynj from bacillus sp. 41m-1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
327
structure length
320
Chain Sequence
b'AITSNEIGTHDGYDYEFWKDSGGSGSMTLNSGGTFSAQWSNVNNILFRKGKKFDETQTHQQIGNMSINYGATYNPNGNSYLTVYGWTVDPLVEFYIVDSWGTWRPPGGTPKGTINVDGGTYQIYETTRYNQPSIKGTATFQQYWSVRTSKRTSGTISVSEHFRAWESLGMNMGNMYEVALTVEGYQSSGSANVYSNTLTIGATRVEAESMTKGGPYTSNITSPFNGVALYANGDNVSFNHSFTKANSSFSLRGASNNSNMARVDLRIGGQNRGTFYFGDQYPAVYTINNINHGIGNQLVELIVTADDGTWDAYLDYLEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase J
publication title A two-domain structure of alkaliphilic XynJ from Bacillus sp. 41M-1
rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 74
structure length 320
sequence length 327
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2006-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dckA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2dckA02
1CZVA 1WCQA 1JZ3A 3T0DA 2HYXA 1OA2A 1OD3A 3JXSA 4MOAA 1JYNA 1JYVA 3I2GA 4UOJA 3WQBA 3CZJA 3AMNA 1OA4A 3E1F1 1OH4A 3VHPA 4A44A 2WO2A 2JE8A 3NQHA 3MUY1 3OG2A 1XNCA 2C9KA 2W1SA 2QQOA 3WSOA 2Y6HA 5IFTA 3LEKA 2QZ3A 5DQ0A 2ZEZA 4ZXEA 4D0QA 2EIBA 5CZKA 4BK5A 4QB2A 2W95A 1UYXA 1BVVA 3FHQA 3FL7A 5IHRA 1US3A 2Y6JA 1JU3A 3VL9A 1JU4A 4JKKA 3K75B 2NQYA 4E8DA 1WKYA 2X10A 2Y64A 4MGQA 5DMYA 1XNDA 3AMMA 3HN3A 1UMHA 3VZMA 5B4NA 5LCWL 1K3IA 2W47A 2QQKA 2JICA 2C1FA 2J1EA 1YNAA 2VO5A 3EB7A 1UYYA 1AXKA 3K46A 5LA0A 1UWWA 5DPNA 2RV9A 1M4WA 2VZ1A 4CU9A 1QH6A 3P6BA 2VZTA 3HJRA 1TE1B 2HLEA 3K4DA 2WDBA 4KMQA 2W94A 3C7EA 1HIXA 4XQWA 4QX0A 2VMEA 3WNKA 3LPFA 4GZ9A 3VD7A 2BW8A 2CDPA 3B5LB 3VZNA 4JHZA 1W9SA 4QDSA 1XNTA 3AKRA 2B45X 4LPLA 1F5JA 2C26A 4P00B 4XURA 3CQOA 2EIEA 3WP3A 2R7EB 3UESA 2RVAA 3RI8A 3MBWA 1QH7A 2QQLA 2JDAA 1LNSA 4A3ZA 1ULPA 1UYZA 3MUZ1 3DYMA 4M4RA 3DYPA 5LA1A 2Y6LA 2VZUA 3VD3A 1O8SA 4OYUA 4S2DA 4P08A 3VD5A 2VCAA 3ZSEA 1XYNA 3B7MA 2DCKA 2E33A 3C8XA 3C7GA 2BGOA 2DFBA 1XXNA 2VUJA 1US2A 2VQTA 2CDOA 3I2JA 4LKSA 3I3EA 2NLRA 2V4VA 3MV01 1H6XA 3OGSA 3ECQA 3CIHA 3I3DA 1XNAA 2W1WA 3ACGA 3FHAA 4XVHA 3VD4A 1T2XA 2D98A 5EJ3A 1O8PA 3WNPA 2BWAA 2VJXA 4AAXA 1H6YA 3AKQA 3WNOA 4PT6A 4CUCA 4RYDA 1GOFA 4QAWA 2XONA 3OBAA 4W8JA 2BERA 3T2PA 1W8OA 3EXUA 4TTGA 2J7MA 2VZPA 3VGIA 3VL8A 1UU6A 3HEIA 1GMMA 5HPOA 1D7PM 3WF2A 2Y8KA 3PUHA 5C7GA 1JZ6A 2XHNA 3K4ZA 4TXWA 1W2UA 1UY0A 2DDUA 1ENXA 1DP0A 2WZEA 2VZQA 3WQ1A 1KEXA 5A1AA 1JI6A 3VZJA 1JZ4A 2W3JA 4OUEA 3AMQA 1P8JA 2C4XA 5FUIA 2Z4FA 1REEA 3GXUA 5EJ1B 3MFCA 2ORXA 2YG0A 3ETPA 2YB7A 4S2GA 4XUTA 2J1AA 1W99A 2WO3A 3WQ0A 4W50A 3WY6A 3SEEA 4AG4A 2F6BA 1J84A 3SKJE 3WR0A 3I3BA 2VGDA 1NUKA 2PQSA 1C5IA 4CU7A 4DUVA 4UAPA 1XNKA 1W0NA 5HXMA 1UKRA 3M4FA 1HN1A 3WP6A 2B46X 2V72A 3WX5A 2Y6GA 1PMHX 3VZOA 1IQDC 1GOHA 4XQ4A 2BGPA 2RJ2A 4P02B 5F7UA 3A7QA 2ZEYA 2B42B 1C5HA 1PMJX 1GOGA 1GQPA 1T6GC 4MGSA 3CZUA 5JXHA 2VZVA 3MO4A 4CUAA 1JZ8A 2KD7A 1XNBA 3WP4A 4XZUG 1BCXA 4QX1A 3OGVA 3LEGA 3WF0A 4QDQA 1JHJA 1JZ2A 2BZDA 4DXSA 1OT5A 5JXGA 3LQCA 3I2IA 1MPXA 3IB3A 1UY4A 2VMFA 3ZM8A 3ABZA 2QBXA 4XUPA 1RYYA 2VZOA 3T08A 2VMCA 3K77A 1XC6A 1REFA 1H4HA 3AKSA 4H7MA 4S2HA 4JX0A 3K4AA 2VR4A 2OKXA 5JXIA 2LS6A 3LPGA 4Z2AA 4HK8A 4YPJA 2Y6KA 2E32A 4HKWA 4OZOA 3MV11 1KS5A 2YFUA 5EIYB 5JXJA 4XUOA 3VLBB 4OMDA 5IYYA 5IJRA 1L7QA 2JKXA 2ZEXA 1H8VA 4DUWA 4CU8A 1F4AA 3AKTA 3OEBA 3OEAA 4UI9L 2QQIA 4LQRA 1NLRA 3OGRA 4DEVA 4A41A 1DYOA 3DECA 2EIDA 3THCA 3IDAA 4M4PA 1OLQA 4DUXA 2JENA 3SKVA 3VDAA 1H0BA 3D3AA 3LGRA 3IIIA 3WF1A 4HKLA 4CVUA 3WQ7A 3I2FA 3VDBA 2W5FA 3MF9A 1I5PA 2VTFA 4RN5A 1K12A 2WAOA 3C7HA 5K9YA 4HG6B 1OF4A 3WEZA 3LB9A 1BHGA 1KGYA 3WNLA 5G05L 1JYXA 3PUIA 2W46A 2W87A 1REDA 4D8MA 4HKOA 4DEQA 2V5DA 3F2ZA 2VZSA 1OA3A 4MADA 4XUNA 2QQNA 3MF6A 5I0DA 1W8NA 2J22A 1H1AA 3BGAA 5B4XA 1OLRA 4XPVA 2YC4A 4QX2A 2J1UA 4JKLA 1CZSA 2B4KA 3LE0A 1GUIA 1JZ7A 2WQ8A 2XQXA 3U37A 1JZ5A 1BK1A 4S2FA 4QDRA 4BJ0A 2WZ8A 1PX4A 1SDDB 1XYOA 4JKMA 3ACHA 5JMOA 3UNPA 1R64A 2L9LA 1UXZA 3WNMA 3BN6A 1W9WA 1XPWA 1SG3A 4A6OA 1EUUA 3VDCA 5HXVA 3CKHA 2WUHA 5JUVA 4BDVB 1YQ2A 3IAPA 3NRUA 1UX7A 2J1TA 4A4AA 3AMPA 4BK4A 1O59A 2W1QA 4KI5M 3IAQA 5LA2A 2J1VA 2BVVA 2X05A 2J1RA 4P5YA 2VZRA 3T0BA 3CMGA 1H4GA 2DCJA 1TVGA 4XQDA 4HK9A 1HV0A 2VL4A 3GM8A 1SHWB 2WN3A 3NJVA 4BXSV 4IXLA 2W91A 2QQJA 5C70A 3W5NA 3C7FA 3SEPA 3VHOA 1XYPA 2B9VA 1PX3A 2WN2A 3HD8B 3T2OA 2VCBA 2DFCA 3C7OA 1TG7A 3MFAA 4L0PA 2VG9A 2DCYA 2J1SA 2YFZA 2ZEWA 2WYSA 3AC0A 4KWUA 3I2HA 3VZLA 2BBAA 1J83A 4FI9A 1L7RA 1NAEA 4ZZ5A 2VOTA 4A42A 3HPNA 2YC2A 4ARYA 2WAAA 1UZ0A 3EYPA 4A45A 2ID4A 1F4HA 4E8CA 1UU4A 3HNBM 2VQUA 1EUTA 4OMCA 1CIYA 3CDZB 4ET7A 3WP5A 1HV1A 2W1UA 3GGLA 1NKGA 2ZXQA 1OF3A 3T09A 2WO1A 2X09A 1PVXA 2XOMA 4ZY9A 3THDA 3A21A 3I97A 5CYYA 1UXXX 3ACFA 5C71A 3NNGA 2D97A 3VZKA 4GWJA 1CX1A 3NJXA 4QB1A 3GDBA 2WABA 4MO3M 5JR2A 3WXPA 1W9TA 1NX9A 3O7OA 3LEIA 3AMHA 2Z79A 3AKPA 1UY3A 2EICA 3UETA 3VHNA 1UY2A 4GWIA 4DXTA 3RI9A 4QB6A 2VMDA 4CU6A 4ZZ8A 3P1IA 3J7HA 3ACIA 3VD9A 3FN9A 1GNYA 3WT3A 1DLCA 1K45A 3HOBA 3W5MA 2JD9A 3A22A 2QZ2A 1IGOA 2WBKA 1GU3A 3HNYM 2BWCA 4NPRA 4LHSA 2VCCA 4PQQA 2E31A 2JEMA 2ORZA 3A23A 4QPWA 3WNNA 4DXRA 1UMIA 4ARXA 1JYWA 4QX3A 1K42A 3OB8A 3HNMA 4W4ZA 2E26A 3WF3A 4IUGA 3WF4A 1UY1A 4XUQA 1UU5A 1CZTA 3T2QA 5EJZB 2VM9A 2W92A 3I2KA 5IFPA 2VULA 3DYOA 1KS4A 1ULOA 5J1XA 2VC9A 2QQMA 3T0AA 4CUBA 5K7PA 2LW8A 2VZ3A 5DN2A 4PF1A 2DCZA 2W9XA 5G04L
chains in the Genus database with same CATH superfamily
4XFIA 3AXEA 4OULA 4CUGA 2Q0AA 4Y1YA 2CY6A 5CFDB 1M06G 1NCQC 4MG2A 3ILRA 5FZ0A 4FBFA 1POV3 1Q8QA 5FLJA 3ZXLA 5IVBA 4MOAA 4CZSA 1LEDA 2H6CA 5T52A 1JYVA 1LHWA 2WJSA 3J8F1 4IL7A 3WG1A 1W6MA 3E1F1 4COWA 2VBBA 4BH9A 2Q4SA 5A7PA 1DHKB 1HXS1 2JE8A 2NYYA 2WO2A 3MUY1 4XW3A 4QM8A 1A8MA 4I30A 1WCSA 1YJKA 4KGGA 1SLIA 5FZ7A 1PO11 3J26N 2JG8A 1AYN2 4FXKB 5IFTA 4B29A 4M3CE 2VECA 4FPHA 4GH4A 4UYBA 3A0NA 4LO4B 4ZXEA 4D0QA 1LOEA 2KXLA 3P5BA 1KXGA 1AR92 5EP9A 5FO7B 4K8FA 3U10A 4QB2A 3VV1A 1ULEA 4Q29A 3FHQA 4OQ8A 1Z7S1 3WINE 4K6BA 1G8WA 5DG2A 5IHRA 5J09A 4TZDA 1US3A 4P9JA 1GQHA 4CYDA 2EAAA 3DL3A 4AK3A 5T3NA 2NQYA 5GM0A 1WKYA 2X10A 2LM3A 2GMPA 1Y9MA 5T5OA 1UMHA 4A6SA 2R49A 4CDUC 2D40A 4RQPA 1LKNA 5LB6A 4LE3A 2Q30A 3Q8CA 3SC7X 5JVVA 1DQ1A 4D6SA 1IPSA 1RUI1 5IAXA 1AXKA 1FI2A 5F5AA 1UWWA 4WM8B 1M4WA 4AFMA 3CU7A 3N7JA 3GCWA 5B2GB 4XJ9A 2G4IA 5HCFA 1S2KA 2XJUA 5GLZA 1XSRA 4PLOA 4JC1A 5FMDA 5FY5A 3O0WA 4NRPA 4B8EA 1KD7A 5AVAA 1V00A 3K48A 3PIGA 1W8FA 2PAEA 2RG4A 5A32B 4AQ2A 2Y34A 5LZ6A 2CWMA 2CDPA 3IIAA 5FYVA 4MGKE 3B5LB 4N7IA 2X53S 2QCSB 4YZ2A 4AEKA 1W9SA 4PIXA 3MZHA 2WRAA 5ANNA 3ZSJA 4UFJA 1XNTA 4MGYE 5L7OC 4Z2WA 4NHLA 4FFHA 1O3RA 2PLV2 4Q27A 4HVQA 2C26A 1R1A1 2KA3A 4ZS2A 5H9QA 4UW5A 1NXD1 5DXDA 4HVOA 3ZLIA 3WP3A 2R7EB 3UESA 5F3IA 1RVF3 4XFCA 1WD3A 2WYFA 5JR7B 5ABJC 1OPOA 3O0VA 1ND2B 1SLTA 2ADEA 4XF1A 1AR82 1CPMA 1N3OA 1NE4A 1U5IA 3RZLA 1CD3G 4M4RA 2EXIA 2RDNA 3HMYA 4NWWA 4M3CA 1J1TA 1W0OA 4RS5A 5JZGB 2BNNA 4P08A 3ZFFB 3H50A 4ISRA 1VBA1 2VCAA 3AVSA 4LEJA 3RYPA 3USUA 3ZSEA 5HV4A 1C1FA 3C8XA 1BYHA 2TEPA 1G9FA 2DFBA 3GZUC 3SCFA 4LKSA 3PHMA 1ZZ8A 2RR12 1PO23 2JX9A 5HBAA 1H6XA 4NIDA 2ZKLA 3H8OA 1LESA 3M70A 2K9ZA 2W1WA 4PIYA 5BNOC 3POWA 3VD4A 5C33A 5EJ3A 2I2SA 5DUUA 1F35A 1RMU3 4MGIE 4XCAA 3LA3A 3PVOA 4J6GA 1GKBA 4MYEA 2GP3A 4YZ4A 2ZMNA 4PT6A 4CUCA 1NCQA 1W6PB 2DBIA 3W59A 4GKXA 4QAWA 4KBBA 1SCRA 5DDJ3 3J8F2 3AK0A 1E5IA 3VKMA 2GNBA 4OUMA 2VZPA 3VGIA 1NOVA 2RS33 3O5SA 3ZXFA 1HXS2 3WF2A 1MQTC 2D3RA 2DU1A 3U0ZA 5C7GA 4R9AA 4EJRA 1LEMA 1NCRC 1PO12 1Q43A 2RE9A 3VKFC 3C3VA 4LUKA 3VBHC 4AI1A 4CDQB 2BBVA 4FFIA 1DQ2A 1ENXA 2PTMA 3JD73 1GWLA 4XF3A 1O5UA 4HSJA 4OI4A 4Y26A 1FT9A 1H8TB 2Y33A 5FTTC 5FFOC 3VZJA 3ZXGA 3LOBA 1TNFA 4CP2A 1GZWB 1LGBA 1PNFA 1Z7S2 3LA7A 3SCGA 1SACA 1OKQA 1RUD1 4YG6A 2OYZA 3RWKX 1BBT3 1REEA 1JN2P 4FQZA 1XE0A 3GXUA 1DFQA 1LHNA 5EJ1B 3D0JA 3ZDSA 2HWD3 4CSWA 4IEYA 4S2GA 3VBSC 5D8AC 3OTFA 3ZYIB 2WINB 1RUH2 1VB2A 2HEWF 1SFPA 2IZWA 3IMMA 3N9NA 3WR0A 3KCCA 2VGDA 5FZOB 5K0UB 4XF0A 1C5IA 3ON7A 4DUVA 2RS12 1XNKA 3POJA 3OSDA 3HQRA 4Z82A 5D21A 1G86A 1S2BA 3TEXA 4EWEA 1W28A 1PMHX 2A1XA 3WUCA 2IXCA 1IQDC 1GOHA 1SLBA 2RJ2A 1DGRN 1ZX5A 4P02B 2GC3A 5F7UA 3ZIXA 4HETA 4QGMA 2FDJA 1VALA 4AGRA 4JZRA 4OI2A 4YGCA 2DYCA 3MW3A 1T6GC 5FYZA 4DZGA 1SLCA 4HZFA 1HRV1 4LBOA 4AHYA 3UL2A 1E5HA 2VZVA 3O12A 4HPKB 1S2EA 2C6SA 3PU3A 3H0OA 5FO9B 2FCUA 3V0AA 4G3YC 1R1A2 1XE7A 1TEIA 3LEGA 1OOPB 3OGVA 1Q5OA 4QDQA 5GZFA 3BI3A 1S0EA 1FMD2 5LBFA 3QCWA 1NG0A 2XJTA 4DXSA 1OT5A 3LQCA 1XOYA 3ABZA 2YGLA 5FBZA 5FP3A 4LT5A 1VR3A 5ABJA 1F2NA 1CPNA 3JZVA 2PHTA 2VMCA 3SH5A 4KWJA 4XEZA 2ZS6B 1H4HA 4S2HA 4L8QA 4CCEA 5JXIA 2LS6A 1AR93 3LPGA 3NNFA 4IV3B 2E32A 3DV8A 4OHWA 1WMXA 5JSPA 1H2LA 2YFUA 2FDHA 3LD8A 4E4DX 3IN9A 4R4ZA 5JXJA 3VLBB 5FYSA 1UQXA 3N3HA 4ASMB 1FV2A 4IV1C 3V0BB 3ZN4A 2JKXA 2VY0A 1A3KA 3FLPA 5DAPA 2XKOA 3LKJA 2BGCA 2BDRA 3BU7A 3RZGA 2WWSA 1H8VA 1R091 2ZEXA 1LOCA 4TLGA 3VBSB 4DUWA 1F4AA 3WDTA 3AKTA 2W52A 2AZ5A 4UI9L 4LQRA 1QJFA 2W68A 2DU0A 3H1YA 5T55A 3SLIA 3POSA 4LKDA 1A78A 2OXBA 4BQ4A 3KSCA 3DECA 3BTYA 1RINA 1ZA7A 3RMXA 1QJX2 1R081 4M4PA 2D6OX 1OLQA 3VHRA 1MQTA 4V2WA 2VMIA 1YIPA 3HQXA 3IIIA 3AP5A 1OUSA 1NCRA 4AI8A 1H9PA 1ODMA 1YQCA 4CVUA 3I2FA 1J3PA 4FPJA 3VBHA 2YYOA 2W5FA 3MF9A 1HW5A 1CWPA 1XJAA 4CPBA 2PELA 4EYUA 2PLV3 1GLHA 4OHVA 3SHRA 1RUD2 2OW4A 2VOWA 3N9QA 4GWNA 2VOXA 2VW2A 4YVWC 3SCHA 4LBLA 3LB9A 4FTSA 1KGYA 3INAA 5G05L 3PUIA 2W87A 5D8AA 1HJFA 2ZX0A 3NVCA 3Q9OA 5IVFA 3FZ3A 2RDSA 3J7NA 2O8OA 5FPLA 3RPQA 4CEWB 5IVJA 4JQRA 3F2ZA 2ZBJA 5FZ6A 1OA3A 4HANA 4MADA 5A7WB 4AXOA 3KQ4B 4HMZA 2HEVF 3MF6A 1GWMA 1PZ9A 1C4RA 3GZTB 5BNNC 1W8NA 5JPMB 3BGAA 1ZRDA 1MVQA 5LATA 4GQ7A 1NT0A 1G6NA 3R4SA 2YC4A 4XPVA 4QX2A 4OQ9A 4PLMA 1CZSA 2P3JA 1GUIA 3NL1A 4EQVA 4WVWA 3NKTA 2ZHNA 3O1SA 2RR13 4LXLA 3CBNA 5EPAA 1JZ5A 2Y6FA 3BB6A 3R4DB 4Q1RA 4Q2FA 5IVEA 3O1PA 1XYOA 2CV6A 4EWAA 3ILFA 4EV0A 2XG3A 5JMOA 3ZYBA 4UW6A 4RR3A 4JGYB 3BN6A 5A80A 1W9WA 2PN5A 5CFCB 1AX1A 4FFFA 4LA2A 1SG3A 2XB6C 5HXVA 2DURA 1YI9A 4Q4X2 5C8CA 4YW6A 1UIKA 3M1HA 3OYWA 3ROUA 3J8F3 1ZRCA 3B94A 3MIDA 3E6BA 5T50A 4IETA 5L19A 5C8WA 1KDKA 1CAXA 3AFKA 5DABA 3ZXKA 1HXS3 5LA2A 4C0HA 2D6KA 3GF6A 3BIWE 3ZFEC 5FY7A 2X05A 2VTXJ 3I59B 1PO13 4IEPA 4P5YA 2GN3A 2RMU1 2OZ6A 3CMGA 2XJSA 1H4GA 1F15A 1QHDA 1LJ7A 1MACA 2E7TA 4HK9A 5LASA 1HV0A 3DXUA 1KJRA 2VL4A 3GM8A 4WVMA 4WM7B 1B35C 3JU9A 2VUDA 1Z7S3 5L9VA 1ZRFA 2ARBA 1X50A 3NAPB 3T1MA 3O1TA 1A34A 1RJ8A 4G4FA 4HVRA 1I1EA 1QNYA 2PMWB 2VCBA 2O1QA 2DFCA 3N9PA 2VQ0A 4IDZA 2VG9A 5FQ0B 2ZEWA 1UD1A 2VUCA 4FOQA 2CU5A 4CP0A 2HWF1 1WLWA 2Q1ZB 1I9RA 3VZLA 3M3QA 1S0CA 4Y1ZA 4CDXC 1RUI3 2PHRA 4IV1A 4YW2A 3M2MA 3OJBA 3MICA 4E2SA 4I01A 4LO5B 2G1MA 2XLGA 2YC2A 5BPXA 4ARYA 4Q0VA 4IEOA 4FVVA 1CAVB 4Y5SA 2ADDA 4KH9A 5IK7A 1VRBA 2PHDA 3Q8EA 3AL5A 1UU4A 1V9U1 2R041 3RYRA 3OGGA 5FZ4A 3KVBA 2OT7A 1R082 3WP5A 4Y20B 1NKGA 5FOBB 1OF3A 1OVPA 3T09A 1PM4A 3WHTA 2XOMA 2OS2A 3S0MA 1H9WA 1GWKA 2JJ6A 4HT1T 1BMV1 1YQ6A 3AP7A 2DV9A 3VBRB 4D3WA 2DVGA 5C71A 4YGEA 5CISA 3IDBB 5IUQA 3BODA 1CN1A 1R1A3 1W0PA 2P4EA 3ZR5A 4QB1A 5HV0A 4PF5A 4E4ZA 1ZYBA 3PDQA 1NX9A 2QDNA 1PVC1 1RXGA 2Y0OA 3AMHA 4YVWA 5TSWA 3ZPOA 4D94A 3WCRA 4GALA 1VE0A 1NE6A 1LOAA 5FMCA 4BHPA 4DXTA 5F5CA 3RI9A 2BUKA 4CU6A 1ZBA1 3D6EA 3JQXA 3J7HA 4LBNA 5D1IA 1AL21 3AP9A 5F2SA 5BNNA 1VBA3 3LDRA 3WDVA 3PVBB 2DUOA 4R52A 4W6WA 1EPZA 1O6UA 1IKQA 3HOBA 3VKOA 4Y4RA 5A6YA 2QZ2A 4F8AA 3AZVA 1IGOA 2JDNA 4PLNA 4XDPA 3HNYM 1JHNA 4NIGA 4JTOA 3N4MA 2XGXA 5A33A 2ZHKA 1E5SA 2JEMA 2ORZA 2W0XA 5FXWA 2F17A 5IVCA 4YGBA 3FUQA 1JYWA 2DCTA 2ET1A 2JXAA 2P2KA 3HNMA 4W4ZA 2AREA 2YBSA 1FPN2 5ANQA 1YUDA 3WF3A 4Q8KA 5F1RA 2X5IC 1CZTA 3T2QA 5EJZB 2FZ1A 1N3QA 5DUVA 4AEDB 5LEKA 1ZZ6A 1LGNA 2VULA 4PDWA 4Y5TA 1BBT1 3DYOA 3FC0A 5FXXA 1JXNA 5LK7B 2PQQA 2ZABA 1PMIA 5J1XA 2VC9A 5T5JA 3RS6A 1F8VA 1VBD2 1VLNA 3GJBA 5H9SA 3T0AA 2GC0A 2VZ3A 5BNPC 2QNKA 1GP5A 1KQRA 3S5QA 1RHI1 5DAXA 4LBQD 1XSQA 3HR9A 4LHLA 4N43B 1I3HA 3PU8A 2ENRA 3ZFEA 3T0DA 3BYWA 1AYM1 4BLJA 5CKNA 2EXHA 4IEQA 5A7SA 2XHKA 2IXJA 2QJVA 1BVP1 4R9CA 3D5OA 1S0IA 4FQ4A 3WD5A 5JLVA 1RUD3 1B35A 1N1SA 3APBA 3UGGA 4AI2A 5C4WC 2GNMA 5KXEA 5E8AA 1OA4A 4QKFA 4FTEA 3ZFGB 3NV1A 1FXZA 3M3CA 5FZGA 2R061 5A3WA 4ZPIA 5L9BA 2QQOA 5FO8B 3PNAA 1XU1A 4XACA 3LA2A 2QZ3A 5K4LA 2PAKA 1TQ5A 4CDXA 3LFIA 1H2KA 3WVJA 2XJVA 3CL1A 4HONA 3AXDA 1LGCA 2W95A 3AFGA 4COYA 3WW4A 2F4LA 4LJHA 5ISLA 3J7MA 5A70A 4BA6A 1ULFA 2OQ7A 3FL7A 1UO9A 1UX6A 5FP8A 2Y6JA 5GALA 2R042 5FPXA 3LSDA 1CVNA 1W6OB 5FY4A 2BP6A 1ND3A 2Y64A 4MUVA 5FY1A 1Z78A 3VZMA 1PZ7A 1K3IA 2YXSA 4YARA 4XJ8A 4AQ6A 4NHXA 1HRV3 1YNAA 2ES3A 2JG9B 2HWC2 4GXLA 1AYN1 4NAOA 3VBUB 5LA0A 5IATA 1BMV2 3UK9A 4CU9A 1Y9QA 5H9RA 3I3MA 2YDEA 3RJRA 2VZTA 4GULA 1BZWA 3KGLA 3IMNA 5GJ6A 1TE1B 2W94A 1KITA 2UY8A 4XQWA 1ST8A 4YGDA 4CP1A 3NW4A 3LPFA 4XAAA 1GNZA 4GZ9A 4P9LA 1ZNPA 1C8M1 1YIFA 4Y22A 2JB8A 3MIGA 3VZNA 4JRLA 2J42A 4IE4A 1GZ9A 4XF9A 2G9GA 4UT5A 3M8LA 3H42B 3O14A 1ZBA2 4GMP0 2E7QA 2FDKA 1AF9A 3KV6A 1AL22 4FPFA 4Y3OA 4A2UA 1UL9A 2BEOA 4RHV1 4XURA 3EHKA 2GALA 3V65A 2WFF2 1DCSA 5FY9A 2WO7A 4HXCA 3TYJA 5FBJA 3OOXA 3CO2A 1RUE2 2WQ4A 3D0SA 3KQRA 2RVAA 2XJQA 4KL1A 5LA9A 4ZU5A 2JIGA 3IPVB 3MBWA 1QH7A 4FP3A 4QPGB 4H55A 2JDAA 1U5XA 1ZRIA 1ULPA 3QACA 2CAUA 1UYZA 1U12A 1U5ZA 5LRSA 4UFLA 1EP0A 1W9YA 1YXWA 2Y6LA 3FX3A 4D7SA 5D2AA 1I5ZA 1R093 2PLV1 4BQ2A 4LA3A 3O1OA 1HKDA 5J3UA 1UIJA 3KT1A 3PUSA 4Y1XA 4AHWA 2CDOA 4LO8A 3I2JA 5APAA 5FPVA 3I3EA 5GLWA 5A3OA 5C9AB 2E53A 3MV01 5C3QA 3ECQA 4YRDA 2WS92 2AEZA 3ACGA 4ZHNA 1R083 2OPKA 1LULA 1AR81 1ENSA 1RHI2 1T2XA 2WZR1 1QEXA 3FHAA 4FPEA 1O8PA 5BNPA 4OI0A 2NZ9A 1JYCA 5JMCA 1W6MB 2Q1MA 3GBWA 5JOWA 4Q0PA 1H6YA 3AKQA 1AYM2 1OFSA 2BPA2 3G6JB 2OA2A 4AE2A 4QHBA 3OBAA 3RGBA 2FDGA 2JG8B 2E63A 3EQEA 4AEMA 2W08A 5H9PA 3TB0A 4GH4B 5C5TA 5C4WA 3HEIA 3POYA 1R1ZA 1GMMA 2LROA 2XLAA 3MLLA 5HPOA 4FAGA 5BYNA 3ILNA 2R062 2WNEA 1WCKA 3PUHA 3E6DA 4FP2A 2XHNA 5DAQA 5FJHA 3WG2A 5E1RA 1W2UA 1ACCA 1WLTA 5FKBA 1LR5A 5EFUA 1Q8OA 3K3NA 4R9DA 4MHRA 1VB4A 2GNDA 5FMOS 1DYKA 5A1AA 1CX4A 1JW6A 2D3SA 4RQPB 4UFKA 1WA6X 4D6RA 4RSUA 5FP9A 2AACA 2ZGOA 4XTMA 2BYVE 4N9HA 4AGVA 2UYAA 5FZIA 3IZOA 2YG0A 5EYXA 5FZ1A 4D69A 1PIV2 2J1AA 1I6XA 1QWRA 5C3OA 1JBCA 4XC9A 1O91A 2F6BA 4QQPA 1OBNA 5FY0A 2CAVA 2WNUC 3EJKA 4QGNA 4CU7A 4FPCA 2BTVC 5T5LA 4UAPA 1IG0A 4FPGA 4AFAA 1POQA 1POV0 5HXMA 1UKRA 1UMZA 3ZPYA 3M3EA 2B46X 1WMEA 2V72A 3U4SA 2Y6GA 2OUHA 3B00A 4NN0A 3VZOA 4KWKA 4UFIA 4LK6A 2OUJA 2BGPA 3A7QA 4XJWA 2B42B 5FK8A 1PMJX 5FZEA 1FX5A 1VBD3 2C9AA 3HT2A 1C8M2 1GQPA 2YHJA 4MGSA 1QKQA 2FQPA 5J7MA 1O3QA 5JXHA 2MNGA 1RUH1 3MO4A 4HLTA 3JB8A 1HLCA 2RMU3 4IEWA 2RS11 3P3NA 5FZLA 1BCXA 1XE8A 2Z42A 1CJDA 4F7ZA 4ATFA 2ZGSA 5CB7A 4RHV2 3USSA 1QMJA 4BQ1A 1JZ2A 2BZDA 3CJIC 1NA1A 2BOJA 4ZU4A 1YYNA 5KHIA 4X6RB 3DKQA 3I2IA 4M3CB 3V64A 3IB3A 4NE9A 1UY4A 2IVIB 2K2SA 4RS5B 3ZM8A 1HB1A 2YPJA 4EN0A 2QBXA 3USUB 3ZYGA 3URFA 3J9SA 2R1BA 4NHKA 3O1RA 4M0NA 2WT0A 4ZU7A 4P9XA 3TEZA 4FOWA 1KDMA 1QOOA 1MS8A 1OVSA 1TMF1 3CHXA 3RJ2X 5AC91 4QGLA 2HWF3 2YU2A 2YMZA 4L99A 1XC6A 4YM3A 1IOAA 1REFA 1V6NA 3NJZA 2GH2A 4QT6A 3BCWA 4JX0A 2VNVA 3AB0A 3NNMA 3J4UH 4MVTA 3ST7A 1VMHA 2C24A 3ES1A 5FYCA 3R4UA 1G9BA 1FMD1 1DIWA 2BFUS 5CIRA 5CNAA 4YM1A 2XXZA 3HT1A 5KR7A 3MV11 4JGZC 2DUQA 3KS7A 1O5LA 1V9U3 2R043 4N53C 1NCQB 4L97A 4Z1VA 2HYKA 1V6IA 3GYDA 5DZGA 2E6VA 2WC2A 2WZR2 4L92A 2B9UA 1JYTA 1A6CA 4OMDA 5IJRA 3JB4C 1V6LA 4Q1PA 1Y3TA 1L7LA 2PHFA 4LLOA 5FPBA 4BISA 4W6XA 5FPAA 5EV7A 5FYBA 3VDDC 2K46A 4QKNA 1RUOA 1AL0G 2DUPA 2QQIA 3W9AA 4ES8A 1NLRA 3OGRA 2VBDA 1YFWA 3MHZA 4NWVA 2YC0A 2HEYF 1E57A 2MHFA 2EIDA 3THCA 3LAGA 1PVC3 3IDAA 4DB5A 1X82A 3ZYFA 4DUXA 3J7LA 2P34A 3SKVA 4KBZA 2GP5A 4W65A 3PLQA 1Y9GA 4B7EA 1OUXA 4FPLA 3PMEA 2CSGA 4AVBA 3HQUA 4CDUB 2GN7A 1ZBA3 3M7AA 1IG3A 5A32A 1AL23 1W06A 3T30A 5GZEA 1GBGA 2DTWA 5AVPA 1V70A 2V5YA 5KHGA 1EV12 1OF4A 1WBFA 1GICA 1BHGA 2ZX4A 1JYXA 4CDWC 1IHMA 2W46A 1QJX1 4D8MA 3PVEA 4HKOA 1OQ1A 4DEQA 3I49A 3WW2A 2LUWA 2VZSA 2JWPA 1CAUA 1WWYA 2WNUA 5FRAA 1IPJA 5I0DA 2WLPA 2J22A 1ND2A 3KT7A 1DGRA 3H8UA 1MZ6A 1HDKA 5IT6A 4K8RB 3POGA 3THTA 4XAEA 2J1UA 3ZXEA 5JCTA 3GBGA 4CCOA 1W04A 1JZ7A 5L7OB 3HIFA 5IVVA 2XQXA 3T1LA 3U37A 5JZGA 3V0AB 1YCIA 1HJGA 2PA7A 1QJY2 4S2FA 2DF7A 4BJ0A 4D6QA 1MZFA 4XBLA 1SDDB 4JKMA 1RHI3 4A3XA 1MEC2 2UWBA 2L9LA 4WZCA 3PJYA 4LKFA 4I0AA 5ABJB 1AYM3 4ONUA 4GD4A 4A6OA 2RHPA 3CKHA 2AEYA 2A6XA 1RITA 3CJIA 2NMNA 1UX7A 5M0TA 2EAKA 4PQ9A 5CAZA 2W1QA 2QFEA 5LBCA 3RWNA 4URAA 1RXFA 4B4QA 5JPNB 3IAQA 3SNMA 1ENRA 2XDVA 2R063 2WWJA 3DGTA 1TMF2 3OPWA 1SQ4A 3WZ1A 1WMDA 5AC92 3GBFA 3BIEA 4JRAA 4BCUA 4XTPA 1FATA 4RR3C 3UKTA 3HN1A 3MW2A 2ZGTA 4UF0B 5FZCA 1SCSA 5A3MA 1SFYA 4UFHA 2AC1A 1RUF2 5C8CC 3KMHA 1YWKA 5BNOB 2Q1FA 4H7LA 1SBDA 4GIQA 1DQ5A 4Q4X1 1X8MA 1O4YA 1WW5A 2YY1A 5C70A 3IDCB 3C7FA 2ETEA 4R9BA 4YG0A 3SEPA 2Y38A 4CCCA 1AJOA 1VAVA 4JGZA 4YFWA 1PX3A 4N53A 2JE7A 5DAWA 3CNAA 4GAZA 5A3LA 5LWBA 1LCLA 1G9AA 1DQ0A 1W2OA 2J1SA 1AVBA 1D4VB 1YQ5A 2WYSA 5FMBA 3MYXA 4WVZA 2BBAA 1T6BX 4OLLA 3HVDA 2E51A 1AYN3 4BE3A 1L7RA 1NAEA 5CEHA 4ZZ5A 3BUCA 4B3NA 5F6KA 3T4VA 1QJEA 2ZGNA 3AZWA 1MQTB 1LB2A 3VDDA 4A45A 3KD4A 2D43A 4DRRA 4F83A 3WCSA 1NCRB 1F4HA 1GSLA 2UYBA 4NROA 4FT8A 4UBHA 3VBHB 4CCMA 5FZOA 1HB2A 4K9SA 1QDCA 1EAH1 3OD0A 4OMCA 2WNVC 3CDZB 4ET7A 1JTZX 1PGL2 2IC1A 2BVBA 5FWEA 4ATEA 5FZFA 2PFWA 3FWEA 3DUIA 2EVXA 5I0SA 1HV1A 4YM0A 2FZ2A 1C8M3 1QQP2 4TWTA 1NYWA 4AVCA 4CCKA 1WLCA 4KG8A 3THDA 2YGMA 2ZCWA 1JS9A 4KQ7A 4NUBA 1PGW1 5D8AB 5F9TA 4CXYA 2D97A 3B9CA 3N9MA 4GWJA 3VZKA 3RZKA 5EWSA 1GYKA 4RHV3 4QX8A 1CX1A 4DXZA 1VAKA 5CKMA 3I8TA 5F39A 2JECA 4XE9A 3GALA 3WXPA 5CG8A 1QU0A 3AL6A 3O7OA 3LEIA 4P9WA 5E16A 5F5IA 3RZZA 2VXRA 2YPDA 5FZ9A 4XABA 1X36A 2Z79A 3ZDVA 3AKPA 1UY3A 4DO0A 4CDWA 3UETA 3VHNA 1K5JA 2ZKNA 2WSVA 2ZGLA 1IS6A 2D6PA 3OUIA 4RA0A 4GWIA 1GP6A 4LKEA 1W8HA 3WG3A 2VUAA 4PI2A 3HBZA 4AHZA 1JOBA 4BM8A 1COV2 3ACIA 4LBMA 1GNYA 1DLCA 4J1WA 1AXYA 3POBA 4UBGA 1TZOA 3TBDA 3WT3A 3W5MA 4AFBA 4BMBA 4RR3B 3DF0A 2VVEA 2BWCA 1UOGA 2ZX2A 4IE7A 4LOTA 2VW0A 4KGQA 4Z07A 3ZMNA 1ZZCA 1D2SA 2SBAA 5A7OA 1CAWA 2NM1A 2RDQA 3A23A 2ZOEB 1W90A 3WNNA 4AI9A 4LNVA 1UMIA 4ARXA 2WZR3 1AR83 1JODA 4QX3A 3OYWB 4K7JA 3V56A 3OB8A 4KU7A 1RUNA 3K3OA 1K5MC 2Q5TA 2A71A 1PHMA 1UN1A 1SDWA 1UY1A 3OBRA 4LIVA 4XUQA 4O9GA 3WF4A 4AL9A 1ZBE1 1CAXB 4ASKA 1PK6C 2VM9A 4LE4A 2W92A 4QX5A 5IFPA 5F5QA 4H2AA 4QPIC 5L73A 4AVAA 1KRIA 2B8MA 3GNEA 4PIZA 4Y1UA 4L2NA 4Q26A 2XH6A 2RM21 3ZMOA 1WLDA 2QQMA 1DQ6A 4M3CF 3SH3A 4CUBA 5LRRA 1W2NA 1YRZA 3E5QA 4WVMB 5DN2A 1ALYA 2DCZA 2ZHLA 2RS52 4AZZA 3WW3A 2W9XA 3DPRC 1W6NB 2HH9A 1WCQA 5GLUA 2BV4A 3MIEA 4MXWA 1FPN1 4LIUA 3TN92 1JZ3A 2HYXA 1OD3A 5A7QA 3W20A 5KBFA 3E6CC 3T3YA 5A3PA 1IS5A 4PDWC 4YLZA 1LOGA 1V6KA 1JYNA 1KFXL 2A6WA 4FPYA 4YZ5A 3TEYA 3NSTA 4CEYC 2A6YA 2EA7A 2EALA 2WSUA 4IV1B 3CZJA 4DINB 1VBD1 4BOWA 2GU9A 3ZKYA 1J3QA 3NQHA 4UW4A 1STMA 1XNCA 2Q8CA 3JUUA 2D93A 4HN1A 2R6QA 5DAVA 1AXZA 1ULDA 3ZO0B 5JSRA 4CP9B 2EIBA 2B39A 5CZKA 1FNZA 3IBMA 1BVVA 3LDBA 4QXKA 2W2IA 4ZKTB 4YZ1A 2DVFA 3TEWA 2XJPA 4PBOA 4O61A 5FKCA 5I0TA 2XL7A 3B69A 5L9RA 1OKOA 4JKKA 3VL9A 5IK4A 3K75B 1EAH2 4E8DA 1XNDA 3AMMA 3HN3A 2V73A 4AFCA 3QH7A 2ZGMA 5B4NA 1JYIA 2WNVA 1JOPA 2XJRA 4IW3A 4K20A 1U5YA 2JICA 1V6MA 1YLLA 1SEFA 2J1EA 3EB7A 4JAAA 5F3EA 1UYYA 1RUH3 4XMAA 2WZPP 5DPNA 4YVSA 2RV9A 1QH6A 4YVWB 3P6BA 1PGW2 2KM2A 2P6CA 2RS13 4HFSA 4WZFA 2ZGQA 1YFUA 3ASIA 2GNTA 3BPZA 3RYKA 1TME1 4HBNA 1W3VA 3C7EA 1HIXA 3N7KA 2ZZQA 1ND3C 4UWDA 3WDYA 1VMJA 2YBPA 4IQPA 1SPPB 4NR1A 4QU2A 3WNKA 5C3PA 1W2TA 3IM0A 3VD7A 5BNNB 4Q5OA 5CFCA 4OI1A 3NV4A 5JIUA 4URTA 2CNAA 1BEV1 4FFGA 1QOSA 3UT0A 5AC93 1TMF3 5FUPA 2HWC1 1W6QA 4QDSA 3AKRA 5E6HA 4YWAA 5JOYA 3OBZA 5A33B 3R0RA 4MZUA 4B4RA 2E9QA 4P00B 5I8SA 2VH9A 5CADA 3K51A 3DKWA 3OUJA 2ZHMA 1FMD3 5GZDA 2R0HA 3RI8A 2AGSA 4FPKA 1XBFA 1WA4A 2Z69A 3MUZ1 3DYMA 1EYBA 3TWIA 3H1WA 3IWZA 3DYPA 1K5MA 2VZUA 4JDOA 4Y33A 1ZBE2 4C90A 2R32A 4YW7A 4FTBA 1UZYA 4S2DA 4UFMA 2LRPA 4AQSA 1PK6A 4AVTA 1XYNA 2E33A 2DCKA 3B7MA 1IPKA 2BGOA 5FQ0A 4QQLA 1XXNA 2WT1A 4XIKA 4QPIA 2WFF1 3ZFEB 3OPZA 2VQTA 3E5UA 2XVKA 1GANA 2VE1A 1KFUL 2RM22 3DN7A 1FAYA 2XVGA 3KF3A 3AJYA 2WR9A 3H3ZA 4QXCA 1RUE1 1W3XA 2FBEA 4XDOA 3CIHA 3I3DA 1XNAA 4GB32 4IERA 5FP4A 4LR4A 2D98A 2GSYA 1CAVA 1B35B 2VJXA 3DPRA 1QQP3 4F3JA 4AAXA 1OI6A 2OZJA 2SLIA 3WNOA 4CRQA 1MS1A 1PNGA 4PHZA 4P14A 1JOJA 4U36A 3E97A 3QBQA 2BERA 3EXUA 2J7MA 1UOBA 1RUJ1 5JWPA 4CDXB 4CEYA 1UU6A 4NRMA 1RJ7A 4OUSA 4FAHA 4WV8A 3VBRA 2WS91 2VAUA 4XHBA 1QJX3 1JZ6A 1RC6A 2K0GA 1UY0A 2HKXA 4Y24A 3WHUA 2WA4A 2BRTA 3RZMA 1RUC1 4FXGB 1O7FA 2H6BA 3WQ1A 1KEXA 1QXPA 4YW1A 1JI6A 4DFSA 1ASJ1 1F5FA 4N8MA 1D4M1 1ZZ9A 3RNSA 5FUIA 2Z4FA 4OHZA 4B1MA 1W8UA 1VBE1 1JMUB 4XUTA 3VBOC 1YEWA 1JUHA 2HWB1 4RD7A 2D6MA 1J59A 3POFA 3WQ0A 4XJZA 2P37A 4AG4A 1S0JA 1J84A 2R072 3SKJE 2IVJA 3BTZA 4NOTA 4QHZA 3MEPA 5FZAA 1NUKA 1G9CA 1OPMA 4ZS3A 4NPLA 3OY8A 1W0NA 4RGAA 4Y22B 3ZOIA 1TME2 3M4FA 3VBFC 1ZZ7A 1W8WA 1LHVA 1N1VA 4BQ3A 1AR71 3UKVA 3H7YA 1BQPA 1OH3A 5BNQA 1VBB1 1OFNA 2ZEYA 3M3OA 1C5HA 4R8HA 4XHXA 1UYPA 3TNQA 4B1LA 2VD7A 4IEXA 5KC6A 1PIV1 4DOUA 4IESA 5GKAC 2R1DA 1BEV2 1W05A 4BLIA 2O8QA 4CUAA 3A0KA 4JCKA 1JZ8A 1LENA 3RZJA 1NQJA 2ZA9A 5JAXA 3TN93 3QLQA 4QX1A 2Y0IA 2QE3A 1JHJA 1VIWB 4Q4X3 1ZA4A 4E27A 1RVF2 1MPXA 1HRI1 4IGPA 2JDKA 4I3PA 3ZN5A 1WBLA 2WT2A 2X5IB 3BOWA 2Z5WA 1EY2A 3BVCA 3ORJA 4FPOB 3LSEA 1VJ2A 1RYYA 2VZOA 4XOGA 1D2QA 4FOVA 4Q0QA 1MS4A 2N7GA 4RL7A 4CXWA 2I45A 3K77A 5GZGA 5LBEA 1O4TA 2LTNA 3OCPA 4XMIA 4AAPA 5I93A 3AKSA 4H7MA 4Q4Y1 3MFCA 4XFHA 3U75A 2JD4A 2VR4A 3K4AA 3ZFGA 5BNPB 3POIA 1OQDA 1NA1C 1Q3EA 2H0VA 4B7KA 5HCAA 1G9DA 2QVSB 3L9JT 2VQAA 5CFDC 2GZWA 4OZOA 1X9TA 1PO22 3N36A 1GZTA 4QM9A 1SMVA 2G9ZA 4M0HA 1EAH3 1VRH1 4QXHA 5EIYB 2FCTA 3RRDA 5IYYA 3ENRA 1S0GA 2GH8A 2B5HA 2WFPA 4WBBA 4XJAA 1UOFA 4NO4A 5CKQA 4YG3A 2A3YA 5C4WB 4CXXA 4AI0A 3AVRA 4I3GA 4CU8A 4AFDA 4FSJA 5IW0A 2V09A 5I8YA 4CCDA 1H1IA 2GMEA 2IXIA 1LHUA 2VXJA 5FUNA 3WOGA 3FUOA 1RTVA 4DEVA 1RUJ2 2VU9A 4Q8LA 1ZM1A 1DYOA 4L9BA 1U0AA 5FV3A 3ACLA 4NRQA 2A5ZA 2AENA 3MIHA 3VDAA 1SFNA 1LTEA 2E7AA 3IDEA 1OLME 4IEZA 5ACA2 5HCHA 4QHOA 1Q56A 3ZN6A 5KWRA 1RUC2 2TNFA 1S0DA 3VDBA 2P5BA 1I5PA 1MZEA 2VTFA 3S57A 2WAOA 4XFBA 3THPA 4DRVA 1QXRA 3AP6A 1ASJ2 2EIGA 1D4M2 4JV4A 4M00A 5IK5A 1MS9A 3UV9A 2WNOA 1CQ9A 4WM8C 2AUYA 2HWD2 2VMGA 2YZ4A 3D82A 4X8NA 1VBE2 4QQOA 4XBQA 3LF7A 2HWB2 4LK7A 4LULA 3VBOA 2QDRA 2WQZC 2QUOA 5GLVA 3VUOA 3O1VA 3CF6E 1J58A 2EXKA 4DNYA 3WUDA 2YUEA 1Q8SA 2LALA 5A3UA 4QQ2A 2V5DA 1XQNA 2VPVA 3TNPB 5LW9A 4XUNA 4WVVA 4EZ4A 1DZRA 2QQNA 3W21A 4HSLA 4LBQA 3H9AA 4V1PA 3AZZA 4BIOA 2O0OA 3BU0A 3B02A 1ZBE3 5SV5A 1MZ5A 3IPVA 1H1AA 4MH0E 4QPGA 5B4XA 4COUA 3BKZA 4DMIA 3MPBA 1OLRA 3WV6A 4DQAA 3VBFA 4NIAA 4YNIA 1AR72 1QJU1 1EV11 1VBB2 2RM23 4BXFA 2WQ8A 3AYEA 4Q4V1 5FXVA 4BYYA 4EN8B 5FMOL 1J1LA 1N47A 4QDRA 5FPZA 4BQYA 3ACHA 3H1MA 3UNPA 5DUXA 1R64A 3KM5A 3UJOA 1UXZA 3B93A 3WNMA 1FPN3 4EZHA 4Q4W1 2O14A 3F95A 1ND2C 4K3UA 5C9AA 2GMMA 1XPWA 3KV4A 1AZDA 5JUVA 2MPFA 3VDCA 3GHNA 2WUHA 3HBKA 3RFRA 4BDVB 1YQ2A 3IAPA 2ZTNA 3NRUA 2MEV1 5I0UA 1YC61 1HRI2 1ZZBA 2J1TA 2P3YA 4CCNA 4A4AA 1D0GA 3AMPA 4BK4A 4QMAA 5JZGC 2IXLA 2FMDA 3FFQA 2R30A 3GHMA 3ZFFC 5I91A 1QJY1 1AHSA 4KNCA 2J1RA 3PUQA 4EN9B 1OLMA 1QGLA 1MEC1 4Y4YA 5KXBA 2Q8OA 2X29A 3OBTA 4Q4Y2 3OF1A 4COVA 4YSFA 5DZEA 4DIQA 3NWKA 3UGFA 1ONAA 2WN3A 3NJVA 4AI3A 4MGZE 1CESA 1GNHA 2QQJA 2W91A 3NNLA 5CFDA 4YZ3A 1XYPA 1RIRA 1VRH2 5KXDA 2B9VA 2W39A 3HD8B 5T5PA 3C7OA 1TG7A 4DS0A 2DCYA 4KWUA 1UZWA 5FR3A 3I2HA 3K2OA 2WWUA 2VTXA 2R073 3U4XA 4FI9A 3AYDA 3NMBA 2QQWA 4TYSA 5F3CA 4NIIA 2VVDA 2WAAA 1V6OA 1RUF1 3EYPA 1LECA 2ID4A 3PVNA 1UW8A 1TME3 3KCXA 2XPJA 4Y1VA 3UGHA 4CDQC 4E8CA 5FOJB 5A1LA 3U11A 2VQUA 1EUTA 3POEA 4RFRB 4BB3A 2ZPXA 3IKWA 1CIYA 4DPNA 5FWJA 1H8TC 5KC5A 2A75A 4LUMA 2BNMA 5JOZA 4PI0A 3VN4A 2X09A 1BEV3 5A3TA 3A21A 1HB4A 2BFUL 5FDBA 2HWC3 2CHHA 4ES9A 1AX2A 2D5FA 1FOD1 4COZA 4NJ4A 1NLSA 3NJXA 2P3IA 1CAUB 2PHLA 3GDBA 4GKYA 5K0UC 2WNUB 3AZXA 4MO3M 5JR2A 5BY5A 3AJZA 4WM8A 4ZXKA 4XBNA 1UAIA 4P9IA 1PGL1 2JDMA 2BNOA 3RDIA 4AWDA 2CWSA 5EXOA 2JE9A 4OZXA 1QQP1 5FZHA 2WA3A 1C28A 1VBC1 1DF0A 4QD2A 4HL0A 3ITQA 4CCLA 1HX6A 4K1ZA 3WW1A 2VMDA 3MLJA 3ZXDA 3OUHA 4ZZ8A 3C2UA 1OC1A 4H14A 2YV8A 1VMFA 2OPWA 3LCPA 1HQNA 1K45A 3KV9A 4R4XA 1UZVA 5FLHA 1WZXA 3TOJA 3A22A 4OHYA 4YM2A 1IZ3A 1QJU2 2WFF3 2WBKA 4PJYA 4LHSA 3TAYA 3MW4A 3ZYHA 3N9LA 5C3RA 2HWE1 2YU1A 3ZYPA 3KT4A 4MLOA 1RUE3 4PQQA 4Q4V2 1V0AA 3SISA 1OOPC 4QPWA 1YQ8A 4DXRA 4GJYA 1K42A 2OX0A 3CJIB 4XFGA 4CPBD 3FBYA 3Q8AA 4ISQA 3WDUA 3DXTA 4Q4W2 4O65A 1UU5A 1WUVA 2VBPA 3E5XA 2NN8A 5EZWA 1COV1 1OQEA 2IXHA 4XETA 3I7DA 4B4PA 2MEV2 4IE0A 1KS4A 1NQDA 3N7MA 1ULOA 1QIQA 2PHUA 2A73B 1RUJ3 2VOVA 1N1YA 2Y60A 3PJQA 2LW8A 2XBO1 4MV2A 2ET7A 3WNXA 3ZFFA 1E5RA 4IV3C 3ME2A 2WS93 5C5UA 4QKDA 1W9FA 2JDZA 2ZMKA 2NP0A 1CZVA 4H3WA 1CIWA 5ACA3 4JGZB 4N53B 1RUC3 1OA2A 3JXSA 4G9SB 1CONA 3KHCA 1CGPA 4XYXA 5FJKA 3PTYA 3N7LA 2VCMA 3FHIB 3I2GA 1ASJ3 1D4M3 4UOJA 4YW3A 3WQBA 1AUYA 5C3SA 3AMNA 1LOFC 3MIFA 4Z8BA 3FBMA 4Z92B 1CR7A 1OH4A 1GR3A 1VBE3 3JCIA 3PMSA 2HWB3 4L11A 3VHPA 4A44A 3VDDB 1W6PA 3OG2A 4MX3A 1GP4A 4CDUA 2C9KA 2W1SA 2RS51 5SV8A 3H3UA 3OPTA 3WSOA 2Y6HA 1RUI2 2QTWB 3LEKA 3UJQA 2Q8DA 1FNYA 3X29B 2ATFA 5DQ0A 2ZEZA 1BJQA 4A7YA 2C0ZA 3TN91 4EN6B 4PBPA 3VB9A 2FD8A 4LLFA 1N1TA 1QF3A 3LWCA 5FXZA 1RGSA 4BK5A 1UYXA 3NO8A 4FCAA 3ALQA 1IS4A 2VNRA 5HI0A 3B01A 1XB9A 1ODNA 3ZSKA 1JU3A 1AX0A 1JU4A 1Y4WA 4IGOA 1AR73 4CDQA 3Q8FA 2PHWA 4MGQA 2ZACA 1VBB3 5FYMA 5DMYA 5LCWL 3S5AA 4LBJA 4C91A 2W47A 4GJZA 1H8TA 1PIV3 2QQKA 1GZWA 1WW4A 2C1FA 2OQ6A 4BQ5A 2VO5A 5IWFA 2RJLA 3K46A 5JIAA 3H8RA 5EQUA 4GMP1 2VZ1A 1JH5A 5L7OA 1FOD2 4NHMA 3U78A 1UPSA 3HJRA 2EF6A 3S7EA 3FLTA 5CG9A 4I0WB 4CDWB 1UZZA 2IWGB 4E4HA 1OSGA 4CEWC 2HLEA 4AGGA 1DZQA 2WDBA 3GZEA 3K4DA 3R05A 2XL9A 2XUEA 2QKDA 4KMQA 1UOJA 4QX0A 4CCJA 1OMIA 4K40A 4NMIA 4GA9A 5CVRA 5F32A 2VMEA 5GZCA 5K0UA 5FY8A 1HRI3 4JVAA 3JBG1 2ZJCA 5F6LB 5K8SA 4ORFA 3DEMA 5DZFA 2BW8A 5FYTA 5J48A 1C57A 5IAVA 1Q8PA 1LRHA 2G9FA 4LBKA 4JHZA 4XJUA 4AVVA 2F4PA 1VBC2 4YVSC 1YFYA 2B45X 4A7ZA 1QNWA 1CAWB 1VBA2 2Z2SB 4LPLA 4Q4Y3 1F5JA 1OXCA 2CGOA 1FYUA 2VNOA 3B3QE 4DY3A 1DDLA 3ZR6A 3CQOA 1A8DA 2EIEA 3ETQA 1GFF2 3T2TA 2BQPA 5LY2A 4JGYC 2HWE2 3WLUA 2JB4A 1L3JA 4HPKA 5CFCC 4JQTA 4UF0A 2HJIA 1Y43B 1VRH3 5FZ3A 2QQLA 1UKGA 1LNSA 1OOPA 4A3ZA 5BNOA 5HCBA 2VVFA 4XXAA 1VPHA 1MS3A 2CYFA 1RUG1 5LA1A 3VD3A 4BU2A 5J37A 1O8SA 2DVBA 4RGGA 4NPMA 3RZHA 4CE8A 2VNGA 4OYUA 1FV3A 4XFFA 3I2DA 4KWLA 3VD5A 1X7NA 1APNA 3BOPA 5I0RA 1X9PA 1RL3A 2A3XA 5JI7A 3LFMA 3C7GA 2VUJA 1D0HA 1N3PA 1US2A 3PIJA 4MXWB 1AR61 4LO6B 4AEJA 1QOTA 2FHRA 2NLRA 2R0FA 2ARCA 5FK7A 3KLSA 1O3SA 1SZBA 2V4VA 2XBO2 3H3LA 3OGSA 2CGPA 3U1XA 5EYYA 3UYJA 5A6QA 1CJPA 4XVHA 5FZMA 4WM7C 5C8CB 3PURA 3ELNA 5LY1A 4IV3A 3WNPA 2BWAA 3AM2A 4A7KA 3NAPC 1G7YA 1V6JA 5FYHA 4D7YA 1WCUA 2ARAA 4AOCA 4RYDA 2A7AA 1GOFA 1H30A 2A6VA 2XONA 4BZ4A 2P6HA 5A6ZA 5BUVA 3P3PA 4W8JA 3N35A 4BMEA 2PYTA 3T2PA 1W8OA 4TN7A 5FIXA 4TTGA 3V0BA 1OHFA 1WGPA 4E9KA 3VL8A 3LZZA 1GZCA 1GQGA 5KHKA 4FOYA 3BALA 1BKZA 1D7PM 1LOFA 3G7DA 4OHXA 3VBSA 2Y8KA 4GB31 3EO6A 5FZ8A 4D7TA 1LU2A 2IFWA 1MR5A 3K4ZA 4I0BA 4TXWA 3O1MA 1S1AA 2PHXA 3KZ4C 2QQUA 1DLLA 2DDUA 4JDMA 2FDIA 4XZPA 3Q8BA 1LHOA 1DP0A 2GC1A 2WZEA 5A6XA 2VZQA 1POV1 2D7FA 3MDPA 3MIBA 3QD6A 1SBEA 5BV6A 1SLAA 1TNRA 2WNVB 4U2AA 4AHXA 1Z0HA 1DGLA 2D6NA 1OURA 4EN7B 2W3JA 4OUEA 1NY71 1JZ4A 2CTVA 1P8JA 2C4XA 3AMQA 2JDHA 1PGSA 1LOBA 1DGWA 3WDWA 4YVSB 3SITA 3MGUA 1HQWA 1QJU3 2D3PA 1EV13 2ORXA 2P17A 2YB7A 2ZX1A 3D8CA 2IXKA 3ETPA 3LIHA 1W99A 4P9YA 2WO3A 4PCRA 3VBRC 3OD4A 2TBVA 4Q4V3 4W50A 3WY6A 1HRV2 1BK0A 5F2WA 3SEEA 3OGJA 4QU1A 5I8TA 3VKLA 3CEWA 4SBVA 3PUAA 3I3BA 4XILA 1O4ZA 1J3RA 4AQTA 2PQSA 3GCXA 5C6CA 2ZGUA 2BOIA 3HAGA 1C8NA 3MPPG 4Q4W3 1RB8G 4FO9A 3IT8A 2A70A 1HN1A 5FREA 2JDYA 3WP6A 5CU1A 1EPWA 2YROA 2ZGKA 3WX5A 4CEWA 1BLZA 4XFAA 5A3NA 1W6QB 5FLIA 2MEV3 1W03A 4XQ4A 2DBNA 5A7WA 1NLQA 3JBG2 4QX7A 1GOGA 3ZSLA 2ZX3A 3LIGA 4O7XA 3VKNA 1S0BA 2C5DA 3CZUA 3NKGA 1QJY3 4IEUA 1DBNA 1C3HA 2JKBA 2R071 4J25A 4K21A 3RG0A 1YO8A 2KD7A 1DG6A 1MEC3 1XNBA 2QQVA 3AZYA 4LORA 4XZUG 3WP4A 2IFRA 2UURA 1OD5A 1VAMA 1WMFA 2D44A 3W58A 3WF0A 1QXJA 5JDBA 3RSJA 2CL2A 1W6NA 5JXGA 1K5MB 1UNBA 2VMFA 4JTNA 1AJKA 3KHBA 4JHTA 4JGYA 5FP7A 4V2VA 4XUPA 4RGKA 1PK6B 2GC2A 2PXJA 4AEDC 3T08A 2ARXA 4X6QB 4NIHA 4UXAA 4M01A 3L2HA 4QPIB 1JUIA 3EBRA 2WLQA 3SMHA 1RUG2 1QY4A 3QH6A 3QOPA 1R092 1LAJA 3SQOA 3M3IA 1VP6A 2OKXA 3CLPA 3NV3A 4Z2AA 4HK8A 4YPJA 3GJAA 2Y6KA 1RUF3 4IE6A 4QWNA 4AR2A 3DPRB 4N43C 4K1YA 4HKWA 1AR62 3I59A 3H7JA 4BQWA 2P3KA 5FYIA 1RVF1 4IE5A 3ZX7A 1KS5A 4N90A 4O9EA 4CP9A 3HWJA 4J1XA 2AH2A 3MI8A 3NNJA 4XUOA 1X8EA 4PDWB 5T54A 2PAMA 4WM7A 1L7QA 3ZKUA 2JDUA 2RDRA 4XDQA 3TRSB 4CEYB 1XRUA 3ZXAC 2D6LX 3NAPA 3ZFGC 2IUWA 4BPZA 1H1MA 1HQLA 1FOD3 4XCBA 3OEBA 3OEAA 2ZMLA 3WDXA 5A7NA 4YFZA 5F37A 2Q8EA 4P5HA 5JI9A 4OCTA 5IK8A 1PO21 4LOSA 4A41A 2G19A 3GZAA 2FMYA 2VMHA 2I74A 1ULGA 4BWOA 3FFZA 3H8XA 3L2YA 2ZGRA 1QJZA 2JENA 3UKNA 1H0BA 3D3AA 1RMU1 2UWCA 4Y5Z0 3LGRA 4C0BA 5EHDA 2VOKA 4HKLA 3WF1A 1B09A 1VBC3 3WQ7A 3CJXA 4CTEA 4LTAA 1DYPA 4UW3A 1H2MA 1SPPA 1NZCA 5JSOA 4RN5A 2XR4A 1K12A 5FAXA 1C1LA 3R6SA 1NY72 3C7HA 5DDJ1 5K9YA 2EXJA 4Y20A 5CA6A 4TLFA 2JG9C 4EWDA 3VBUC 1HB3A 1WW6A 2HBUA 3FE5A 4HG6B 3RMYA 2RS31 3OY8B 1IKPA 5GLTA 3WEZA 4C8DA 1KJLA 3KCYA 1S0FA 4C1WA 3WG4A 2HWE3 2UWAA 4QQHA 3WNLA 1S55A 3FMGA 1REDA 2WL1A 4LHKA 3A4UA 1W8TA 2V4AA 1MS5A 2XVLA 3MLKA 4LHNA 3S6PA 5ACA1 3BTXA 2XQRA 1ND3B 4GWMA 3JD71 5FZBA 4QXBA 2ZGPA 5J98B 2GAUA 3B9IA 1IS3A 3NJYA 5AFBA 1COV3 4ITCA 4XIOA 4NAMA 3FJSA 4JKLA 1PM7A 2B4KA 2FCVA 3LE0A 4Q0UA 2HWD1 2XWJB 2NMOA 4MXVA 3ZIWA 5A1FA 2JDPA 2XBO3 1DQ4A 1BK1A 3ZXJA 4HOOA 3FLRA 2WZ8A 1PX4A 3T4HB 5CBLA 2AYHA 2RMU2 3LDKA 4N7UA 5F3GA 1URXA 3I4IA 5L36A 4QPGC 1LU1A 4LO7A 2ZAHA 1EUUA 5KHHA 5E89A 3ZVXA 2A6ZA 3AX4A 4MHUA 2AR6A 4META 1UF2C 2H0BA 3N9OA 1O59A 2CGNA 2GDFA 3S30A 3EMRA 2OIIA 4KI5M 4QKBA 2J1VA 4NHYA 4AEDA 5KHJA 1W2AX 2BVVA 2HWF2 1BXHA 1NZIA 1UPIA 2RS53 3LEMA 4XF4A 1ZREA 1NXMA 2VZRA 3ES4A 4TSVA 3T0BA 3KGZA 1ZRRA 2DCJA 3BPSA 5FYYA 5C9AC 1TVGA 2YBKA 3KF5A 4XQDA 1HN0A 2HBTA 2XWBB 4I02A 2ZZJA 1SHWB 3KV5A 4BXSV 4IXLA 4MSVA 2DWRA 1SBFA 2XKPA 1V9U2 4N43A 3W5NA 3VHOA 3D4KA 1DGWX 1F31A 3O1UA 3T2OA 2WN2A 2ILMA 3NV2A 3AP4A 1W39A 4E2QA 2DVAA 3MFAA 4L0PA 3AC0A 2JG8C 2YFZA 2KR2A 1DZTA 4W6YA 3PTRB 1J83A 4GH4C 3O0XA 5LK5A 4GMP3 2VOTA 1WD4A 4Q0SA 4ZONA 2VW1A 3ZSMA 4IGQA 1AR91 1X33A 3HPNA 1UCXA 2JIJA 3LOIA 4A42A 4XXPA 1UZ0A 3KB5A 2WKKA 4NVPA 4AYUA 1WW7A 5FCCA 2X8KA 3ZN6B 1H2NA 3HNBM 4X8PA 1PVC2 1WCDJ 4INDA 5F8PA 2NPIA 3JBG3 2A3WA 4RQPC 1W8ZA 1ZVFA 5E88A 2ERFA 2W1UA 1RMU2 3GGLA 4BQXA 4AW7A 2ZXQA 4IEVA 2WO1A 1PVXA 4KU8A 4N9IA 4ZY9A 2B7YA 3I97A 3RQ0A 3KWVA 5CYYA 1UXXX 1W6OA 2Y26A 3ACFA 3VBOB 3DCQA 4OVEA 5FPUA 5DDJ2 3NNGA 4SLIA 3AYCA 1MS0A 4CA9A 3ATGA 2WABA 2RS32 2JG9A 1ENQA 3VBUA 4LBQB 4LITA 5ERLA 1W9TA 4YW4A 1F9KA 2DVDA 4E4SA 2BJSA 4EE2A 4YW5A 5DG1A 5JOXA 4BIFA 2EICA 3VBFB 1YHFA 1UY2A 4I2OA 3PL0A 1LODA 3BTAA 3JD72 2I07B 2XMLA 1RUG3 4QB6A 3SXWA 2XLFA 3P1IA 2X5IA 3U07A 3ZYJB 4C1XA 2XUMA 4YYOA 3S7IA 3VD9A 3FN9A 3I54A 3I2OA 1O3TA 1BBT2 2RJKA 1XU2A 1PZ8A 2JD9A 2TUNA 3I3QA 4EROA 1GU3A 1AR63 4NPRA 4AVSA 4RFT0 1IQAA 4ASLA 1ULCA 2VCCA 1QDOA 5FYUA 3RVHA 3SH4A 1DU3D 2E31A 3JQWA 2ZAAA 5KXCA 2BU9A 2UY9A 5FZDA 2E26A 2WIIB 1S4CA 1SLLA 4RS5C 2P1BA 4HN0A 4IUGA 1Q8VA 5J96B 2R16A 3AYAA 5AFEA 4KG0A 5LBBA 1YFXA 4I09A 5FZKA 4AF9A 3I2KA 2DTYA 5IVYA 2D5HA 3ZYRA 1YJLA 1Y7BA 1GV9A 2UU8A 4LMFA 4JDNA 4OFGA 5LEJA 4E2GA 4QPYA 4MGTA 2RR11 5K7PA 4DY5A 1YI7A 2FDFA 3U14A 2OVUA 1MVEA 4PF1A 4P9GA 5J36A 5DUWA 4GB33 5BXXA 1NA1B 2QQPA 3KVAA 5G04L
chains in the Genus database with same CATH topology
4XFIA 3AXEA 4OULA 5CFDB 2Q0AA 4Y1YA 2CY6A 1M06G 1NCQC 3ILRA 4FBFA 1POV3 1Q8QA 5FLJA 3ZXLA 4MOAA 4CZSA 1LEDA 2H6CA 5T52A 1JYVA 1LHWA 2WJSA 3J8F1 4IL7A 3WG1A 1W6MA 4COWA 3E1F1 4BH9A 2Q4SA 1DHKB 1HXS1 2NYYA 2JE8A 2WO2A 3MUY1 4XW3A 4QM8A 1A8MA 4I30A 1WCSA 1YJKA 4KGGA 1SLIA 1PO11 3J26N 2JG8A 1AYN2 4FXKB 5IFTA 4B29A 4M3CE 2VECA 4FPHA 4GH4A 4ZXEA 3A0NA 4LO4B 4D0QA 1LOEA 2KXLA 5FO7B 1KXGA 1AR92 3U10A 4TZDA 4K8FA 3VV1A 4QB2A 1ULEA 4Q29A 3FHQA 1Z7S1 3WINE 4K6BA 1G8WA 5DG2A 5J09A 5IHRA 4P9JA 1US3A 1GQHA 4CYDA 2EAAA 3DL3A 4AK3A 5T3NA 2NQYA 5GM0A 1WKYA 2X10A 2LM3A 2GMPA 5T5OA 4CDUC 1UMHA 2R49A 2D40A 4RQPA 1LKNA 4LE3A 2Q30A 5JVVA 1DQ1A 1RUI1 1AXKA 1FI2A 4WM8B 1UWWA 1M4WA 4AFMA 3CU7A 3N7JA 5B2GB 4XJ9A 2G4IA 5HCFA 1S2KA 2XJUA 5GLZA 4PLOA 4JC1A 3O0WA 4B8EA 1KD7A 5AVAA 1V00A 3K48A 2PAEA 5A32B 4AQ2A 2CWMA 3IIAA 2CDPA 4MGKE 3B5LB 4N7IA 2X53S 2QCSB 4YZ2A 4AEKA 1W9SA 4PIXA 3MZHA 3ZSJA 5L7OC 4MGYE 1XNTA 4Z2WA 4NHLA 1O3RA 2PLV2 4Q27A 4HVQA 2C26A 1R1A1 2KA3A 5H9QA 4UW5A 1NXD1 5DXDA 4HVOA 3WP3A 2R7EB 3UESA 1RVF3 4XFCA 1WD3A 5JR7B 5ABJC 1OPOA 3O0VA 1ND2B 1SLTA 4XF1A 1AR82 1CPMA 1N3OA 1NE4A 1U5IA 1CD3G 4M4RA 2EXIA 3HMYA 4NWWA 4M3CA 1J1TA 1W0OA 4RS5A 5JZGB 2BNNA 4P08A 3ZFFB 3H50A 4ISRA 1VBA1 3USUA 4LEJA 3RYPA 3ZSEA 2VCAA 1C1FA 3C8XA 1BYHA 2TEPA 1G9FA 2DFBA 3GZUC 3SCFA 4LKSA 3PHMA 1ZZ8A 2RR12 1PO23 2JX9A 5HBAA 1H6XA 2ZKLA 1LESA 3M70A 2K9ZA 4PIYA 5BNOC 2W1WA 3POWA 3VD4A 5C33A 5EJ3A 2I2SA 5DUUA 1RMU3 4MGIE 3LA3A 3PVOA 4J6GA 1GKBA 4MYEA 4YZ4A 2ZMNA 4PT6A 4CUCA 1NCQA 1W6PB 3W59A 4GKXA 4QAWA 4KBBA 1SCRA 5DDJ3 3J8F2 3AK0A 3VKMA 2GNBA 4OUMA 2VZPA 3VGIA 1NOVA 2RS33 3O5SA 3ZXFA 1HXS2 3WF2A 1MQTC 2D3RA 2DU1A 3U0ZA 5C7GA 4R9AA 4EJRA 1LEMA 1NCRC 1PO12 1Q43A 2RE9A 3VKFC 3C3VA 4LUKA 3VBHC 4AI1A 4CDQB 2BBVA 1DQ2A 1ENXA 2PTMA 3JD73 4XF3A 1O5UA 4HSJA 4OI4A 4Y26A 1FT9A 1H8TB 5FTTC 3ZXGA 5FFOC 3VZJA 3LOBA 1TNFA 4CP2A 1GZWB 1LGBA 1PNFA 1Z7S2 3LA7A 3SCGA 1SACA 1OKQA 1RUD1 4YG6A 2OYZA 1BBT3 1REEA 1JN2P 4FQZA 3GXUA 1DFQA 1LHNA 3ZDSA 3D0JA 5EJ1B 2HWD3 4IEYA 4S2GA 3VBSC 5D8AC 3OTFA 3ZYIB 2WINB 1RUH2 1VB2A 2HEWF 2IZWA 3WR0A 3KCCA 2VGDA 5K0UB 4XF0A 1C5IA 4DUVA 2RS12 1XNKA 4Z82A 1G86A 1S2BA 4EWEA 1PMHX 3WUCA 2IXCA 1SLBA 1IQDC 1GOHA 2RJ2A 1DGRN 1ZX5A 4P02B 2GC3A 5F7UA 3ZIXA 4HETA 4QGMA 4AGRA 1VALA 4OI2A 4YGCA 2DYCA 3MW3A 1T6GC 4DZGA 1SLCA 4HZFA 1HRV1 4LBOA 4AHYA 3UL2A 2VZVA 3O12A 4HPKB 3H0OA 5FO9B 3V0AA 4G3YC 1R1A2 1XE7A 1TEIA 5GZFA 1OOPB 3LEGA 1Q5OA 3OGVA 4QDQA 1S0EA 1FMD2 3QCWA 1NG0A 2XJTA 4DXSA 1OT5A 3LQCA 3ABZA 2YGLA 5FBZA 4LT5A 1VR3A 5ABJA 1F2NA 1CPNA 3JZVA 2PHTA 2VMCA 3SH5A 4KWJA 4XEZA 2ZS6B 1H4HA 4S2HA 4L8QA 5JXIA 2LS6A 1AR93 3LPGA 4IV3B 2E32A 3DV8A 4OHWA 5JSPA 1H2LA 2YFUA 4E4DX 3IN9A 4R4ZA 5JXJA 3VLBB 3N3HA 4ASMB 1FV2A 4IV1C 3V0BB 3ZN4A 2VY0A 2JKXA 1A3KA 3FLPA 2XKOA 3LKJA 2BGCA 3BU7A 2WWSA 1H8VA 1R091 3VBSB 1LOCA 2ZEXA 4DUWA 1F4AA 3WDTA 3AKTA 2W52A 2AZ5A 4UI9L 4LQRA 2W68A 2DU0A 3H1YA 5T55A 3SLIA 3POSA 1A78A 3KSCA 3DECA 1RINA 3RMXA 1QJX2 1R081 4M4PA 2D6OX 1OLQA 3VHRA 1MQTA 2VMIA 1YIPA 3HQXA 3IIIA 3AP5A 4AI8A 1NCRA 1H9PA 4CVUA 4FPJA 1J3PA 3I2FA 3VBHA 2YYOA 2W5FA 3MF9A 1HW5A 2PELA 2PLV3 1GLHA 4OHVA 3SHRA 1RUD2 2OW4A 2VOWA 4GWNA 2VOXA 2VW2A 4YVWC 3SCHA 4LBLA 3LB9A 4FTSA 1KGYA 3INAA 5G05L 3PUIA 5D8AA 2W87A 2ZX0A 3NVCA 3Q9OA 4I2OA 3FZ3A 3RPQA 4CEWB 2O8OA 4JQRA 3F2ZA 2ZBJA 1OA3A 4HANA 4MADA 4AXOA 4HMZA 2HEVF 3MF6A 1PZ9A 3GZTB 1C4RA 5BNNC 5JPMB 1W8NA 3BGAA 1MVQA 4GQ7A 1G6NA 3R4SA 2YC4A 4XPVA 4QX2A 4PLMA 1CZSA 2P3JA 1GUIA 3NL1A 4WVWA 3NKTA 2ZHNA 2RR13 1JZ5A 3BB6A 3R4DB 4Q1RA 4Q2FA 1XYOA 2CV6A 4EWAA 3ILFA 4EV0A 2XG3A 5JMOA 4UW6A 4RR3A 4JGYB 3BN6A 5CFCB 2PN5A 1W9WA 1AX1A 4LA2A 1SG3A 2XB6C 5HXVA 2DURA 1YI9A 4Q4X2 5C8CA 1UIKA 3M1HA 3OYWA 3ROUA 3J8F3 1ZRCA 3B94A 3MIDA 3E6BA 5T50A 4IETA 5L19A 5C8WA 1KDKA 1CAXA 3AFKA 3ZXKA 1HXS3 5LA2A 4C0HA 2D6KA 3GF6A 3BIWE 3ZFEC 2X05A 3I59B 1PO13 4IEPA 4P5YA 2GN3A 2RMU1 2OZ6A 3CMGA 2XJSA 1H4GA 1QHDA 1LJ7A 1MACA 2E7TA 4HK9A 1HV0A 1KJRA 4WVMA 2VL4A 3GM8A 4WM7B 1B35C 3JU9A 1Z7S3 1ZRFA 2ARBA 1X50A 3NAPB 3T1MA 1RJ8A 4G4FA 4HVRA 1I1EA 1QNYA 2VCBA 2O1QA 2DFCA 2VQ0A 2VG9A 5FQ0B 4CP0A 1UD1A 4FOQA 2ZEWA 2HWF1 1WLWA 2Q1ZB 1I9RA 3VZLA 3M3QA 1S0CA 4Y1ZA 4CDXC 1RUI3 2PHRA 4IV1A 4YW2A 3M2MA 3OJBA 3MICA 4E2SA 4I01A 4LO5B 2XLGA 2YC2A 5BPXA 4ARYA 4Q0VA 4IEOA 4FVVA 1CAVB 5IK7A 4KH9A 2PHDA 1UU4A 1V9U1 2R041 3RYRA 3OGGA 1R082 3WP5A 4Y20B 5FOBB 1NKGA 1OF3A 3T09A 3WHTA 2XOMA 3S0MA 1H9WA 1BMV1 2JJ6A 4HT1T 3AP7A 2DV9A 3VBRB 4D3WA 2DVGA 5C71A 4YGEA 3IDBB 5IUQA 3BODA 1CN1A 1R1A3 1W0PA 4QB1A 4PF5A 4E4ZA 1ZYBA 1NX9A 2QDNA 1PVC1 2Y0OA 3AMHA 4YVWA 5TSWA 4D94A 3WCRA 4GALA 1NE6A 1LOAA 4BHPA 4DXTA 3RI9A 2BUKA 4CU6A 1ZBA1 3D6EA 3JQXA 5D1IA 4LBNA 3J7HA 1AL21 3AP9A 5BNNA 1VBA3 3WDVA 3PVBB 2DUOA 4R52A 4W6WA 1EPZA 3VKOA 1IKQA 3HOBA 2QZ2A 4F8AA 3AZVA 1IGOA 4PLNA 3HNYM 1JHNA 4JTOA 3N4MA 2XGXA 5A33A 2ZHKA 2JEMA 2W0XA 2ORZA 4YGBA 3FUQA 1JYWA 2DCTA 2ET1A 2JXAA 2P2KA 3HNMA 4Q8KA 2AREA 4W4ZA 1FPN2 1YUDA 3WF3A 5F1RA 2X5IC 1CZTA 3T2QA 5EJZB 2FZ1A 1N3QA 5DUVA 4AEDB 5LEKA 1ZZ6A 1LGNA 2VULA 4PDWA 1BBT1 3FC0A 3DYOA 1JXNA 5LK7B 2PQQA 2ZABA 1PMIA 5J1XA 2VC9A 5T5JA 3RS6A 1F8VA 1VBD2 1VLNA 3T0AA 5H9SA 2GC0A 2VZ3A 5BNPC 2QNKA 1KQRA 1RHI1 4LBQD 4LHLA 3HR9A 4N43B 1I3HA 3ZFEA 2ENRA 3T0DA 1AYM1 4BLJA 2EXHA 4IEQA 2XHKA 2IXJA 2QJVA 1BVP1 4R9CA 3D5OA 1S0IA 4FQ4A 3WD5A 5JLVA 1RUD3 1B35A 1N1SA 3APBA 5C4WC 2GNMA 5KXEA 5E8AA 1OA4A 4FTEA 3ZFGB 3NV1A 1FXZA 3M3CA 2R061 5FO8B 2QQOA 3PNAA 1XU1A 3LA2A 2QZ3A 2PAKA 1TQ5A 4CDXA 1H2KA 3WVJA 2XJVA 3CL1A 3AXDA 1LGCA 3AFGA 2W95A 4COYA 3WW4A 4BA6A 1ULFA 3FL7A 1UX6A 5GALA 2Y6JA 2R042 5FPXA 3LSDA 1CVNA 1W6OB 1ND3A 4MUVA 2Y64A 1Z78A 3VZMA 1PZ7A 2YXSA 1K3IA 4YARA 4XJ8A 4AQ6A 1HRV3 1YNAA 2ES3A 2JG9B 2HWC2 4GXLA 1AYN1 3VBUB 5LA0A 1BMV2 3UK9A 4CU9A 1Y9QA 5H9RA 2YDEA 3RJRA 2VZTA 4GULA 1BZWA 3KGLA 3IMNA 5GJ6A 1TE1B 2W94A 1KITA 2UY8A 4XQWA 4YGDA 4CP1A 3NW4A 3LPFA 1GNZA 4GZ9A 4P9LA 1ZNPA 1C8M1 1YIFA 4Y22A 3MIGA 3VZNA 4JRLA 1GZ9A 4XF9A 2G9GA 3M8LA 3O14A 1ZBA2 4GMP0 2E7QA 1AF9A 1AL22 4FPFA 4A2UA 1UL9A 2BEOA 4RHV1 4XURA 3EHKA 2GALA 3V65A 2WFF2 3TYJA 3CO2A 1RUE2 2WQ4A 3D0SA 3KQRA 2XJQA 4KL1A 2RVAA 4ZU5A 4QPGB 3IPVB 4FP3A 1QH7A 3MBWA 4H55A 2JDAA 1U5XA 3QACA 1ULPA 2CAUA 1UYZA 1U12A 1U5ZA 5LRSA 1EP0A 1YXWA 2Y6LA 3FX3A 4D7SA 1I5ZA 1R093 2PLV1 4LA3A 1HKDA 5J3UA 1UIJA 3KT1A 4AHWA 4Y1XA 4LO8A 2CDOA 3I2JA 3I3EA 5GLWA 5C9AB 2E53A 3MV01 3ECQA 4YRDA 2WS92 3ACGA 1R083 2OPKA 1LULA 1AR81 1ENSA 1RHI2 2WZR1 4FPEA 5BNPA 4OI0A 1T2XA 1O8PA 2NZ9A 1JYCA 5JMCA 1W6MB 2Q1MA 3GBWA 5JOWA 4Q0PA 1H6YA 3AKQA 1AYM2 1OFSA 2BPA2 3G6JB 2OA2A 4AE2A 4QHBA 3OBAA 2JG8B 2E63A 3EQEA 4AEMA 2W08A 5H9PA 3TB0A 4GH4B 5C4WA 3HEIA 3POYA 1R1ZA 1GMMA 2XLAA 3MLLA 5HPOA 4FAGA 5BYNA 3ILNA 2R062 2WNEA 1WCKA 3PUHA 3E6DA 4FP2A 2XHNA 3WG2A 5E1RA 1W2UA 1WLTA 1LR5A 5EFUA 1Q8OA 4R9DA 1VB4A 2GNDA 5FMOS 1DYKA 5A1AA 1CX4A 1JW6A 2D3SA 4RQPB 4RSUA 2ZGOA 4XTMA 2BYVE 4N9HA 4AGVA 2UYAA 2YG0A 5EYXA 4D69A 1PIV2 2J1AA 1I6XA 1QWRA 1JBCA 1O91A 2F6BA 4QQPA 2CAVA 2WNUC 3EJKA 4QGNA 4CU7A 4FPCA 2BTVC 5T5LA 4UAPA 4FPGA 4AFAA 1POV0 5HXMA 1UKRA 1UMZA 3ZPYA 3M3EA 2B46X 1WMEA 2V72A 2Y6GA 2OUHA 3B00A 4NN0A 3VZOA 4KWKA 2OUJA 2BGPA 4XJWA 3A7QA 2B42B 1PMJX 1FX5A 1VBD3 2C9AA 3HT2A 1C8M2 2YHJA 1GQPA 5J7MA 1QKQA 2FQPA 1O3QA 4MGSA 5JXHA 2MNGA 1RUH1 3MO4A 4HLTA 3JB8A 1HLCA 2RMU3 4IEWA 2RS11 3P3NA 1BCXA 1XE8A 2Z42A 1CJDA 4F7ZA 2ZGSA 5CB7A 4RHV2 3USSA 1QMJA 4BQ1A 1JZ2A 2BZDA 3CJIC 1NA1A 4ZU4A 1YYNA 5KHIA 4X6RB 4M3CB 3V64A 4ATFA 4F83A 4RS5B 4EN0A 2K2SA 1UY4A 3I2IA 3IB3A 3ZM8A 2YPJA 2QBXA 3USUB 3ZYGA 3URFA 3J9SA 2R1BA 4NHKA 4M0NA 2WT0A 4ZU7A 4P9XA 4FOWA 1KDMA 1QOOA 1MS8A 3RJ2X 1TMF1 5AC91 4QGLA 2HWF3 2YMZA 4L99A 1XC6A 4YM3A 1IOAA 1REFA 1V6NA 3NJZA 2GH2A 4QT6A 3BCWA 4JX0A 3AB0A 3J4UH 4MVTA 3ST7A 3ES1A 3R4UA 1G9BA 1FMD1 1DIWA 2BFUS 5CIRA 5CNAA 4YM1A 3HT1A 3MV11 4JGZC 2DUQA 3KS7A 1O5LA 1V9U3 2R043 4N53C 1NCQB 4L97A 4Z1VA 2HYKA 1V6IA 3GYDA 5DZGA 2E6VA 2WC2A 2WZR2 4L92A 2B9UA 1A6CA 4OMDA 5IJRA 3JB4C 1V6LA 4Q1PA 1Y3TA 2PHFA 4LLOA 4W6XA 5EV7A 3VDDC 1RUOA 1AL0G 2DUPA 3W9AA 2QQIA 4ES8A 1NLRA 3OGRA 1YFWA 4NWVA 2YC0A 2HEYF 1E57A 2MHFA 2EIDA 3THCA 3LAGA 1PVC3 3IDAA 4DB5A 1X82A 4DUXA 3SKVA 2P34A 4W65A 3PLQA 4B7EA 4FPLA 3PMEA 4AVBA 4CDUB 2GN7A 1ZBA3 3M7AA 5A32A 1AL23 5GZEA 1GBGA 2DTWA 5AVPA 1V70A 2V5YA 5KHGA 1EV12 1OF4A 1WBFA 1GICA 2ZX4A 1BHGA 1JYXA 4CDWC 1IHMA 2W46A 1QJX1 4D8MA 3PVEA 4HKOA 1OQ1A 4DEQA 3WW2A 2LUWA 2VZSA 1CAUA 2WNUA 5FRAA 1IPJA 5I0DA 2WLPA 2J22A 1ND2A 3KT7A 1DGRA 3H8UA 1MZ6A 1HDKA 5IT6A 3THTA 3ZXEA 2J1UA 5JCTA 3GBGA 1JZ7A 5L7OB 3HIFA 3V0AB 3T1LA 5JZGA 2XQXA 3U37A 1YCIA 2PA7A 1QJY2 4S2FA 2DF7A 4BJ0A 1MZFA 4XBLA 1SDDB 4JKMA 1RHI3 4A3XA 1MEC2 2UWBA 2L9LA 4WZCA 3PJYA 4I0AA 5ABJB 1AYM3 4ONUA 4A6OA 2RHPA 3CKHA 2A6XA 1RITA 3CJIA 2NMNA 1UX7A 2EAKA 4PQ9A 5CAZA 2W1QA 2QFEA 3RWNA 4B4QA 5JPNB 3IAQA 3SNMA 1ENRA 2R063 3DGTA 5AC92 1TMF2 1SQ4A 3WZ1A 1WMDA 3GBFA 4JRAA 4BCUA 4XTPA 1FATA 4RR3C 3UKTA 3HN1A 3MW2A 2ZGTA 1SCSA 5A3MA 1SFYA 1RUF2 5C8CC 3KMHA 1YWKA 5BNOB 4H7LA 1SBDA 4GIQA 1DQ5A 4Q4X1 1X8MA 1O4YA 1WW5A 2YY1A 5C70A 3IDCB 3C7FA 2ETEA 4R9BA 4YG0A 3SEPA 2Y38A 1AJOA 1VAVA 4JGZA 4YFWA 1PX3A 4N53A 2JE7A 5A3LA 3CNAA 1LCLA 1G9AA 1DQ0A 2J1SA 1AVBA 1D4VB 2WYSA 3MYXA 4WVZA 2BBAA 4OLLA 2E51A 1AYN3 4BE3A 1L7RA 1NAEA 4ZZ5A 4B3NA 5F6KA 3AZWA 2ZGNA 1MQTB 1LB2A 3VDDA 4A45A 3KD4A 2D43A 4DRRA 3WCSA 1NCRB 1F4HA 1GSLA 2UYBA 4FT8A 4UBHA 3VBHB