2DD5A

Thiocyanate hydrolase (scnase) from thiobacillus thioparus native holo-enzyme
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'PVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase alpha subunit
molecule tags Hydrolase
publication title Structure of thiocyanate hydrolase: a new nitrile hydratase family protein with a novel five-coordinate cobalt(III) center.
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dd5A00
3HHTB 2O01E 4OB0B 1PSEA 2QDYB 2ZPBB 2CZ6B 2D0QB 2ZZDA 1QP2A 3A8GB 2WSFE 4RKUE 2AHJB 3QYGB 3QZ9B 4OB3B 4OB2B 2ZCFB 1JB0E 2DXCA 2WSCE 2DXBA 2DPPB 3A8OB 3X20B 2CZ1B 3A8HB 1AHJB 4Y28E 1UGQB 3X28B 3VYHB 4XK8E 3X25B 3WVEB 2DD5A 2PUOB 3A8MB 2ZPHB 4FM4B 1GXIE 3QYHB 4ZGDB 1UGRB 2ZPEB 1UGSB 2PUKB 1UGPB 2PVDB 3A8LB 2ZPFB 4L6V5 2ZPGB 4KT0E 2DD4A 1IREB 2PU9B 2CYZB 2PVGB 3QXEB 3QZ5B 4OB1B 3X26B 4ZGEB 3VYGA 2ZPIB 1QP3A 1V29B 1PSFA 2CZ0B 3X24B 3WVDB 2WSEE 2PVOB 5L8RE 3LW5E 2CZ7B 1DJ7B 4ZGJB
chains in the Genus database with same CATH superfamily
1FXXA 5LJ3f 4FT2A 1HXDA 3HPWA 3P8HA 1MUZA 5GAMf 5I2MA 1WIEA 1LPLA 3I35A 2K6DA 4M77A 3CD6A 1T0HA 2YRCA 1RABB 4RCCA 1UG1A 2LQ8A 2FHDA 3CC7Q 3KBGA 3QJ6A 4E2FB 5J3BA 2PVOB 3ZFJA 4QVDA 4PJMA 3EH2A 2D0NA 1T3LA 3RBBB 1QVGS 1BKBA 3SWNC 4C0ZA 3L2QA 1C1AA 1NJIR 4PFOA 3ULRB 2ATCB 4AT1B 2FYKA 3PIOA 2L3SA 5GAMd 3OW2S 2JMAA 3L2WA 3CMEQ 2LX7A 1KC8C 2ZPEB 4Y92A 2MWOA 2JS2A 2QA4A 3CCET 2RHYA 2MF2A 3FB9A 2F69A 2RI3A 1KHIA 2WSFE 3OS1A 5D6WA 3CCLA 4IKFA 2E64A 2EQJA 1YN8A 3EGUA 1ARKA 4C8QB 3FJ5A 1U8RA 5I21A 3NPFA 4J9HA 3L2ZA 2MWPA 4DA4A 2CP3A 5GAN7 2LCCA 2R5AA 1PWTA 2I2LA 1CSKA 2LP5A 2KSSA 3BFMA 3WVDB 4C5EA 1YITQ 2K2MA 4ELYC 1WHMA 2RN8A 4BI8B 4XTYA 3M4YA 5CCAA 3OYEA 2OAUA 5FW9A 3M4GA 3INZA 2L5QA 2LC4A 2X4YA 3AHUA 1BYMA 3CC2A 3ASKA 2Y4XA 3QUIA 1QCNA 1A0NB 5GAOq 5FU6B 3G6ET 3CCEA 2QA4T 1OULA 2FB7A 2O9SA 1ZSGA 4LDWA 4RTTA 5GAN4 1M2VB 5IT9E 3EAEA 4N4HA 2YHTA 2H3JA 2YRDA 2K7AA 1S72T 1BCOA 2XDDA 2YSQA 2PVGB 1K0XA 3PVQA 2ZAEA 3MKDA 1UHFA 2IG0A 2RHUA 1VQOA 1H3ZA 3HTRA 1KG1A 4JLGA 2DNUA 2C0OA 2CS7A 2F2XA 3NTKA 1WJSA 4JJBA 4KUDK 4RG2A 2RHZA 1M8VA 2DEUA 1G83A 2D8HA 5FRNA 2EQKA 5IN1A 3L2VA 3E9FA 4JUVA 4E7IA 4LNPA 1RAEB 5A0LA 2DZCA 1ZA2B 2V1RA 2L8DA 1MNEA 2DL3A 3BDLA 3LH5A 1PSFA 1TUCA 4MMLA 1M1FA 1MMAA 1FMVA 2QA4Q 8ATCB 4FYXB 1U3OA 4DBHA 4PJOF 1Y96B 4M78C 2MCNA 4CC4B 4EPCA 3V8LA 1BIBA 4X9DA 2YT6A 3OSVA 4M7DA 1Q81R 4E47A 4JRPA 3Q1JA 2M16A 4RTWA 1U06A 4A4GA 5GANf 3VJPA 4Z8AA 5GJWB 4EDUA 4E7LA 2LQKA 1ABQA 3JCMd 1X27A 5FU7B 1RLPC 2E4HA 4M77F 3CPWA 4EMHA 2K5IA 2P0KA 4JLIA 1Q7YC 1SRMA 2CGHA 5IXBA 4HT9A 4PJOB 2W0ZA 3SWNA 5KE3A 4XK8E 2K57A 2KBTA 1D1AA 4J8OA 1M27C 3AT1B 1MMNA 1BI3A 2J05A 5LJ3h 4AFQC 1QP3A 1YP5A 3CXCP 2FVUA 5CKBA 3QG1A 4HA8A 3EGDA 4KRTA 2A28A 3OY9A 4YTLA 4C8QC 2DTOA 4JRIA 4Y28E 1RAFB 1RI9A 4XAXB 1PNJA 4LDYA 2BZ8A 2DD4A 4B9XA 1Q86R 2HBWA 3VYGA 2RJDA 4M75A 1ZX6A 2PZ1A 3JCMQ 1TS9A 1DJ7B 1VA7A 2DIQA 1HYOA 2EGEA 1B34A 1YHQQ 1QP2A 1HSQA 5KCHA 2EQMA 2QEXA 1KD1R 3R6OA 4M75G 4FIBA 1AWXA 2F2VA 1O9SA 2EVRA 1QLYA 3G6EQ 5DY9A 4E7JA 1IHWA 2FZCB 4JJDA 4II1A 2HQEA 2A08A 5GAOl 4XU1A 2X3WD 4M7DC 4OMNA 5L23A 1GCQA 4J5YA 3X20B 4RMOA 2QEXT 4BUGA 4M7DB 1EFNA 4DBRA 1C0MA 2FRYA 3A8LB 1JJ2P 4N4IA 2DRKA 2ZPIB 3VU3C 3CCLT 4FT4A 3JCMV 4ZGJB 3OB9A 3CC7A 1G3SA 1SG5A 3QYGB 2DXUA 4J6WA 2DXCA 4BACA 1VIEA 3CXCS 3I5RA 2NLUA 4BY6C 2YWWA 2QQAA 4PJOG 1CKAA 3QWYA 3CC2T 2P4RA 2BZYA 1IXDA 5GMKh 5CQYA 1FYNA 3ZEHA 4XQ3A 5LL6S 2YLBA 3V8JA 2XKOC 2K5FA 1RAGB 2I0NA 2LZ6B 2MI6A 2D0QB 1SSFA 2CDTA 3OS5A 4V2SA 3H0HA 3CMAQ 2X51A 3CD6T 3G71T 5FU6C 5GAMj 1N9RA 2XIDA 4M75B 1KQ2A 3G6EA 2A7YA 1X2KA 2EYXA 2VASA 1QCFA 1VQOT 4DBFA 1Q82U 2QAZA 2JTFA 2YUOA 2HZYA 4HVWA 3SWNB 1VQMT 2O31A 2MIOA 3CCEQ 1K9AA 4QVCA 4MZTA 5LJ5d 2JOYA 4HVUA 4A4EA 4A4KA 3REBB 2JMCA 4FSXA 3A1PA 5GAN2 1YBYA 2ZPBB 4A63B 1YI2A 3CC2Q 1KC8U 3CC4A 2KYBA 3ZL7C 1QKWA 1FMKA 2LQWA 1T3SA 2K9GA 2NUZA 3I55A 4UC4A 1RI0A 2P0QA 1W2BA 3LX7A 1NEBA 3CBPA 2ROTA 2VC8A 2DM1A 1PM3A 2KQWA 4LD9K 1WZOA 2DBKA 2EWNA 4F7UE 2L3RA 4PJLA 1O75A 2JVVA 5FRMA 3FLGA 4B6MA 2EFIA 4OF1A 3JCMW 1KQSS 2OAWA 3JB9J 1JEGA 1Y07A 2ESWA 4IURA 1NJIU 3QDFA 1YJNT 1MV3A 3QJYA 2DBMA 3QKJA 4X1VA 1TH7A 4ZNXA 4F7UG 5EC7A 4A53A 2QDYB 3OMGA 3FEOA 2M1HA 1JJ2S 2XMFA 2MMPA 4DQ2A 2OI3A 4GY5A 3CCST 2QTVA 2PQWA 3J7AF 1PRLC 3HP9A 1SHGA 2K79A 3PNWC 3T9NA 2EJFA 1F1BB 4PK4A 3NGPA 4GBQA 2DFUA 1JQQA 3VS6A 2E3HA 1X75C 2JW4A 2KT8A 4AG2C 2CUDA 3CC4T 1W6XA 1Y0MA 2PNIA 1UJYA 2DTHA 5GMKi 1M90R 5GAMg 2EW3A 3VS3A 1VQ4A 2ABLA 5KYNA 1VQNT 4KBMB 3HSBA 1UECA 4C92F 3OYGA 2O9VA 4GLKA 2MYSA 3FDRA 2KK4A 4N0AC 2E70A 2RK1A 2BIVA 1I8FA 2KGTA 2JN0A 2O88A 4ZN1A 1K0SA 1WHLA 3HKSA 2PTKA 1QVFA 3H41A 4M78A 4N4GA 1XJWB 1I0CA 1K1ZA 1X6GA 4L6V5 2FPDA 4C0FA 2CT3A 1Z9QA 3PT9A 1V1CA 4F14A 5GANd 3RKWA 1QVFS 3QZ9B 3EFSA 3CMEA 2VGMA 3I9QA 1G3YA 2KAFA 2DL5A 1YI2Q 3TQ7P 2QEXQ 4AFUC 3TSWA 5LJ3d 2E41A 5FU7C 4EMGA 4IIMA 1Q7YR 3CCMT 4IUUA 2JXBA 4QQDA 3X24B 4J83A 3VV0A 4BY6B 2SEMA 3EHRA 4XU0A 2HQHA 5FLXE 1VQ4T 1QVGA 2BZXA 1M9SA 3MPUB 1U1SA 1YNZA 4BI3A 1IGQA 2F5KA 5HK3A 3NFCA 2HCKA 4MZMA 4J9CA 4NOYA 2DF6A 4J9FA 2H3EB 1ZHIA 2DILA 4OGEA 1TUDA 2EAYA 2LNVA 4C8QG 4JS4A 4C8QE 5GMKe 3HHTB 2CZ6B 2K3XA 1S72Q 2L3PA 1JXMA 1JO8A 2RNAA 1PG5B 2VYTA 3OSSC 4BD3A 5GMKl 1PKSA 1UFFA 2LCSA 1X2QA 1AT1B 4ANJA 2QYZA 4FW1A 1G3WA 1I5OB 5C6SA 2X35A 3GNFB 1FMWA 5FWCA 4KULA 1HK9A 1LJOA 1W70A 1RADB 4HCKA 3C95A 4M4ZA 4BE1A 1YI2T 1QKXA 1AWWA 2E6NA 1TSFA 3CCVT 2YRVA 2XDBA 2CP0A 3JB9I 1KD1U 3S3OA 2ZPGB 5GAN8 3OBYA 2R57A 4XU3A 3M0QA 2LMJA 2CUBA 5LJ3e 2CP2A 1UEBA 3PVLA 2NUPA 1YCSB 5I2SA 5KH6A 3OYNA 1I5LA 2RQVA 2C0TA 5LJ5h 3H0FA 3EG9B 4M75F 2LJ0A 1I81A 3LLRA 1H92A 1NE8A 3FIFA 4P5NA 1YCYA 1BBZA 2EKHA 3I55Q 4IUQA 2XHCA 2K3YA 1E6GA 4M78F 2RQRA 3UDCA 3HFNA 3JCMJ 1MNDA 2MAMA 4RUGA 3A8HB 4ZN3A 1UGQB 1GFDA 4FL6A 2OTLT 2GQIA 3EG2A 3QIIA 1LOJA 1NM7A 2QQSA 3LGFA 2DTIA 2GFUA 3JCMc 3DLLA 3BDUA 1KHCA 2IVWA 3M0SA 5FROA 3L1AA 3UATA 1ZUYA 4C5HA 3OYDA 1X6BA 4RTYA 1PHTA 1RAHB 3LWHA 2EBPA 3EG1A 5KE2A 4QQGA 3GOXA 1KSWA 3OYJA 3JB9H 1UE9A 2DVJA 3M55A 4EMKB 5AT1B 3JAME 2CZ1B 2DKGA 3EGXA 2HDAA 3OA6A 2LX9A 1TG0A 2PUOB 3QYHB 1YIJA 1GCQC 1UGPB 1QCOA 3G4SQ 3KUFA 2EQUA 4PJNA 2L2PA 3HRTA 2KE9A 3J80E 1YITT 3SEMA 4C92G 3H6ZA 2D6FA 2DZ9A 1G5VA 2E10A 2NUPB 1ZQ1A 2LT4A 2KEAA 4OMOA 1JBMA 2K5LA 2LCLA 3CPFA 4O5VA 1X6OA 5CK9A 2RI2A 3JCMP 4XTXA 2BKDN 2AIRB 3PFSA 1X43A 4F7UA 5GAOr 1KQSA 2EJ9A 3CPWS 3M0UA 1XQHA 3VS2A 4M7AA 4M7AC 1HJDA 4RTZA 3VS0A 1YJ9T 3WVEB 2GF7A 4Y91A 4J6XA 4ZGDB 1SF9A 1VQOQ 4C92E 1VQPT 2ED1A 2PU9B 2DMOA 3MP1A 5KYYB 2DYIA 2WACA 2L3QA 4XU2A 4L59A 3CD6Q 1OYXA 2KYMA 4JJCA 1JJ2A 4NL2A 4J7FA 3MHXA 3CCRQ 1UDLA 1YITA 4CC7A 1YWOA 1N8RU 1UGRB 1UGSB 2C0IA 2B8AA 2RK2A 4HKEA 3JCMe 5GAN3 1WQWA 2LRQA 4X9CA 2OTJA 4JDSA 1XNIA 2RO0A 4IUTA 4HCBA 2LNHB 1G2BA 2VVKA 3M57A 2A36A 5GAOp 4ATOA 3CPWP 3UPUA 2JT4A 2XI9A 4JPBW 1GCPA 2ECZA 4PJOA 1IB8A 2AZVA 3VS5A 3O8VA 1AZGB 3RDVA 4LXCA 3I56Q 1I4K1 7AT1B 3S3MA 6AT1B 3MEAA 1D0XA 3GNGA 4HCCA 2KXCA 3BW1A 2X4XA 1YIJQ 1V76A 3G71Q 2DX1A 4OMPA 4AFZC 3ZBDA 3CCJT 2J6OA 2COYA 2KI7A 5GANe 1JB0E 2JUFA 4PJOE 2AZSA 1VQ7Q 2O2OA 1K8AC 3LGLA 3S3NA 4M75C 3SFMA 1OV3A 4C8QF 2G3RA 1KJWA 2ROLA 4CRIA 1WHJA 4C0DC 3EG0A 2DO3A 1M1KR 1QVFP 4PJJA 1M1KC 1X01A 2GTOA 2WSCE 3VYHB 4AG1C 4LN2A 1K9MC 3L2UA 1KQ1A 1R0BG 2P4TA 2CKKA 3L2RA 1Q86U 4OMLA 1G3TA 1N6AA 1UHCA 1WHHA 2E12A 4JRKA 1NLOC 1GBRA 4RCBA 2KROA 4DOVA 1WFWA 2HMAA 4M77B 3CCQT 5KCOA 3KXTA 1N27A 4LUDA 2EYYA 1HD3A 2B86A 1N5ZA 5IHNA 5GANj 2OTLQ 1SEMA 3CCJA 5J26A 1W4SA 2CH4W 8AT1B 1UGVA 3ME9A 1WHKA 4PJOC 3TREA 5IH2A 4M7AB 4KGXB 3OYFA 1OX8A 4FYVB 4QT7A 4M75E 2AT1B 2VWFA 2XU8A 4RTXA 1IO6A 1WXBA 4BI4A 3RR6A 2EPDA 3UF4A 5CQXA 3RERA 1U5SA 1ZUUA 1M90C 4M78D 1VQ8Q 4E7KA 3EFOB 1YJ9A 3JCMh 5GANg 3D7SB 2OX7A 1VQ9T 2A37A 3OYCA 3DLMA 1N9SA 4PFPA 2V8IA 3RKXA 3M59A 4L5GA 1GXIE 2QGGA 3M5AA 4OMFB 2DL4A 1WI7A 3E1SA 2DA9A 2KRSA 3RIRA 3C12A 2C06A 5GJVB 1VQNA 3CMAA 2KXDA 2E5KA 2EJGA 1ZSZB 3X25B 1RAAB 5LJ5e 1JRIA 1ZLMA 1WDXA 2EQIA 4M75D 3CCQQ 2V26A 1OI1A 4M7DE 1NG2A 1WJQA 4JS5A 1H3HA 3G4SA 2O4XA 1MMGA 3E9GA 4TVRA 1VQ9A 1RLQC 3E2UA 2DETA 3QDRB 1WQ7A 2DERA 4ESRA 1K73U 3THKA 3JCMb 1M3BA 1OZ2A 3CCSA 5KYWB 2BE7D 2EGCA 3VS4A 3V7RA 2YUPA 3FRNA 1H8KA 2CZ0B 1YHQA 3CCUT 2DK3A 1QWFA 1RUWA 2FZGB 4A4FA 3DB4A 1PD1A 3TCJA 1D3BB 3A5ZB 4PKCC 1WYXA 4LDXA 3A8OB 4QW2A 5ECAA 4IUPA 1WXUA 3JV3A 2EIFA 1KC8R 1J3TA 4F16A 1BI1A 4ZGEB 3JRZA 1MV0B 3LW5E 3C4SA 2OJ2A 3EFOA 2X9HA 1Y96A 2EKOA 1KK7A 2FEIA 4FU6A 4C92A 1YIJT 4J9DA 1VQ4Q 2DL8A 1VQLT 2ZGWA 1B7TA 3H8ZA 3NMZC 1KFZA 4J7IA 1QVPA 3RESA 4M7AE 2L89A 3X26B 3LWIA 2KT1A 1EZZB 2DL7A 4M7AD 2AHJB 2W10A 4QQ6A 2ZCFB 2J6FA 4MDWA 3C0CA 3QWXX 4OMQA 2KRMA 1VQNQ 4A4HA 1LCKA 1TU0B 1VQ6Q 3G7ZA 2CYZB 5KYUB 2DIGA 2D9TA 1FWZA 2KDSA 2HEQA 3WXMB 4M7AG 5CKHA 1VIFA 2CZ7B 3CCVA 1FX7A 3EGDB 1PC0A 3CQTA 5IHKA 1QW1A 1VQPA 4C0GA 1Q81C 2K3BA 4LDUA 3EFRA 3PE0A 3M54A 3OBWA 4PL6A 2X4WA 5KYWA 3JB9D 4ZTJA 1D1BA 4MMKA 2M0YA 1QWEA 5GMKm 4XTZA 5IHIA 5LJ3j 1M2OA 3OYBA 2M9UA 1Q82R 2DXTA 4J9EA 1B34B 1K76A 5CO7A 3V7SA 4J9BA 3RNJA 1K9MU 1VOMA 1ZSZA 2CP6A 1E7OA 3E19A 3HRUA 1OPKA 1B3QA 2DLPA 3F70A 4R56A 3OS0A 2RA2A 1KIKA 4C8QD 1VQ9Q 1VQ7T 1NLPC 1ZSZC 3QPHA 4OGCA 3GP8A 3ER0A 3CXCA 2H8HA 4PLLA 4M77D 1S72A 3CC7T 2X4JA 1MHNA 4J9IA 2OTLA 4NS5A 1K8AU 1K4US 2GGRA 4C92B 4OB3B 1KD1C 1IHVA 4RTUA 3OYAA 3M56A 4Z89A 5GAOm 3EG3A 1R77A 1I07A 3C94A 2EGAA 4HVVA 2HKQB 2R5MA 4X34A 2HBPA 3PMTA 1IZ6A 5HCKA 4F17A 4KT0E 1W2BS 1NYFA 3P8BB 1AVZC 2JZ2A 2QGFB 3HFOA 2RJFA 5GMKj 1SPKA 4AFSC 2XK0A 1K73C 3QHSA 1K8AR 1D3BA 4RKUE 5CVIA 1C6VX 3OYHA 2NUTB 3OW2A 1GBQA 1M4ZA 1NYGA 1M1GA 5DLQE 2KRNA 5KYUA 3CCRT 1IREB 4OB1B 2RQWA 4LUEA 1VQMQ 2HKNA 1BIAA 1Y57A 2V8JA 3G4ST 1YJWT 1SSHA 4D8DA 2DAQA 2RMOA 1OOTA 1BI0A 1M3AA 2CH4A 2J7IA 1M2VA 2XDPA 4BB7A 2DXBA 3GPLA 2GCXA 2K4YA 1VQPQ 1X69A 2DRMA 5LJ5f 3CCQA 1ABOA 2QQ9A 5CKFA 2D1XA 4OP0A 2L0AA 4DBQA 1VQ5T 2BTTA 3M0PA 1AWJA 1M90U 5KYXA 2ED0A 2YDLA 1P92A 1OX9A 1YHQT 5I11A 3META 3M53A 2Y4YA 1Y71A 3SHWA 1CKBA 3QO3A 1W2BP 1VQLQ 5GAMh 2F5TX 1M8MA 4C5IA 1JU5C 1XOVA 1OU9A 3M9QA 2LT1A 1K9MR 4KH1B 2QG9B 2CREA 3QSUA 1SRLA 4LDVA 4K11A 2FG0A 2RB6A 2A3LA 2RHIA 5HK0A 2EYZA 1YJNA 5LJ5j 1GRIA 2CSQA 1PCXA 4M77C 5J39A 1WLPB 2JTEA 3DB3A 2VB6A 2NUTA 1AHJB 3OQ5A 1VYUA 2ZPHB 2D8JA 3S6WA 2PUKB 4Z02A 3HL8A 4M7DD 3G1JA 1YJWQ 2JNGA 2R58A 1TUGB 3SD4A 1AEYA 1Q7YU 1BB9A 2BE9B 3TSZA 2LQNA 3MJXA 4C5GA 2FL7A 4WCIA 4JZ3A 2KY9A 2ZZDA 4D8KA 4XTUA 2IPOB 2E6ZA 3VRYA 1MMDA 2QDLA 4C92C 4QVZA 3JCMX 1AOJA 4M78B 3EGXB 2RH2A 4M78E 2HL5C 3V7CA 3OYYA 4QKUA 1QQJA 1BI2A 2RQTA 1EX4A 2RPNA 2M51A 2WSEE 4ME7A 1TXQA 4ZTFA 2RI5A 1N8RC 3FJPA 2KR3A 1N8RR 3SB2A 5A0DA 3CEYA 2QQBA 5KYXB 2ENMA 2DJZA 1PKTA 2P0PA 5DLOA 3UA6A 2RQUA 4WF2A 1VQ6T 3VUZA 4XTVA 4GLMA 3JB9G 1ZBXA 4N0AA 2XICA 4VUBA 3OS2A 4C92D 4RG8A 2OTJT 1B07A 1IRXA 4OB2B 4CI0C 2J6KA 4XTWA 3L42A 1R8OB 1PD0A 3NTIA 1TTHB 3VRZA 2VXFA 1ZBJA 1UB4A 2QK0A 3QZ5B 4FW2A 4M7DG 3CCMQ 2HAXA 1OPLA 4CC3A 2JM8A 1YJWA 5I22A 2MPXC 1W1FA 5GAMe 1H641 2QI2A 5A2QE 1VQKQ 2QASA 1RAIB 2K2VA 4CC2A 1TOVA 2FPFA 2CSIA 1EIFA 3N5BB 4C0DB 2GBQA 1QMCA 1M5Q1 4OMMA 3JCMf 3GF5A 1M1KU 1VQ8A 1IGUA 4E6RA 1WPYA 2VGNA 1AZEA 1VYTA 3PIPA 4J6YA 4R0KA 1YWPA 2DJQA 5CKEA 3UA7A 2JJ9A 3MP6A 1VQ5A 4IUVA 1WHGA 2CP7A 2AKLA 5CAIA 1G8XA 3VS7A 2DD5A 4DEXA 1E6HA 3BY7A 1VQKT 1RACB 2DYBA 3TVTA 1UUEA 4F7UF 1WA7A 5HY6A 2IIMA 2DVEA 5GAN6 1Z9ZA 1VQMA 4LD6A 1GL5A 2DE0X 1BU1A 3CC4Q 2FPEA 4BE2A 3OYMA 1ACMB 4BE0A 3IQLA 1WGSA 2FRWA 2M02A 2DEQA 2JS0A 5DM7R 2PVDB 2LJ3A 5D7UA 2XD0A 4D6WA 3SDZA 3JCMg 2M0OA 1ZUKA 2LVMA 4E7ZA 3M0TA 4OB0B 1PSEA 1SHFA 1WNLA 1OU8A 3NHNA 3M58A 3RUXA 4ELZC 4JJNK 5IXFA 4PNOA 2RJCA 3I55T 1D0YA 4NL3A 1VQKA 2KVQG 2FO0A 4FM4B 5HKCA 1BK2A 4FYWB 4AMCA 5FWBA 2JM9A 3VS1A 3LYIA 5CIUA 3OMCA 3EHQA 3MEWA 5A0GA 3CCUQ 2AKKA 5GAN5 2E65A 2CP5A 3GBQA 1YJNQ 2SRCA 3A8GB 2HL3A 2V1QA 1VQLA 1GFCA 4J9GA 4B9WA 5IAYA 5GAOn 3HRSA 1VQ8T 2EYQA 5GANh 2RJEA 3QBYA 3EG9A 3OYKA 2LDMA 5M9OA 3OYLA 2OTJQ 3U23A 3GLXA 2HSPA 2AK5A 4JRQA 1D1CA 1V29B 4PJOD 1UJ0A 1OEBA 1NZ9A 3FC3A 2GTJA 4M7DF 1D0ZA 3OW2P 4EMKA 3CCMA 2HNIA 3RMSA 3CCRA 4Z88A 2V8KA 3I56A 1WJRA 2F2WA 1QVGP 2VV5A 5C0MA 4M78G 1NPRA 4ORZA 2KMTA 5LJ3g 1VYVA 3QXEB 3LH0A 2A0FB 3J81E 1M30A 3JB9F 4R55A 3CBMA 1MGQA 1YFNA 1KQSP 3NTHA 4HXJA 4WTOB 3M0RA 2HQXA 5AYFA 1Q86C 2YLCA 3RKYA 3BE3A 3MCAB 1WX6A 3PMIA 1M3CA 3MP8A 3REAB 2XG8D 1RL2A 3V8KA 4E7SA 4F7UB 2BUDA 3CCUA 3I56T 4E7HA 4MZPA 3CMAT 2MK5A 2FZKB 2VUBA 1SKUB 4FSSA 1WXTA 3VKIA 5CR2A 2RHXA 1VQ7A 3H0IA 1Q95G 2GFAA 2GQVA 2QQRA 2QXFA 3URGA 3G71A 4IIOA 2COZA 1UTIA 1NBEB 1PRMC 2HSEB 1OQKA 2O01E 3R6NA 5EG2A 1S1NA 2O4XB 2P84A 2X3XD 4A54A 4Q5WA 4KUIA 2DPPB 2VXEA 1VUBA 4F04B 2KNBB 1XTDA 1LNXA 2LJ1A 3A8MB 4BDZA 4C8QA 4M77G 3A98A 1AD5A 1Q81U 1OZ3A 3CCLQ 1LVKA 1BCMA 9ATCB 3MEVA 3TEEA 3I5SA 3CBOA 4JZ4A 4HCZA 4OVAA 4MDXA 4BDYA 3PGGA 4DOWA 3TU4K 2EYWA 2E1HA 3CCSQ 2QTXA 3VUBA 1I1JA 4M77E 1VQ5Q 4PFZA 4FCYA 1Q82C 4RTVA 1NEGA 4KGVB 1K73R 5LJ5g 2G6FX 4PLIA 2HD0A 1T0JA 2Z0WA 3EH1A 1JXOA 1NPPA 3CMET 5KYYA 2COWA 3H9NA 3P8DA 4KGZB 2NWMA 5CKDA 3RMQA 3DKMA 2F1LA 2RM4A 3UWNA 1U1TA 2Y90A 2E5QA 5D6XA 3X28B 2NYSA 1ZA1B 3CCJQ 2ZPFB 4KH0B 4HT8A 3GIBA 2RF0A 1YJ9Q 1TWBA 2MOXA 4O6JA 3JSCA 4DEYA 2CT4A 4FYYB 4LE9A 4EIKA 3KFVA 2VKNA 1NJIC 5D6YA 2J06A 1VQ6A 2YUQA 2GNCA 2LTOA 3MEUA 2YXYA 2YUNA 4EMKC 1D09B 3OYIA 3PTAA 1AWOA 3MO8A 2RD1A 3CCVQ 2JTMA 2E3IA 4M7AF 3UT1A 3O5ZA 1R0CB 5L8RE 1Y7XA
chains in the Genus database with same CATH topology
2DO3A 1FXXA 2QDYB 4M77C 5J39A 3OMGA 5LJ3f 3DB3A 4FT2A 1M1KC 1X01A 3FEOA 1HXDA 2M1HA 3HPWA 1JJ2S 2WSCE 3P8HA 5GAMf 2MMPA 4DQ2A 5I2MA 4GY5A 1AHJB 3CCST 3VYHB 3OQ5A 4M77A 3CD6A 2ZPHB 3S6WA 2PQWA 1K9MC 2PUKB 4RCCA 4Z02A 3J7AF 3L2UA 1KQ1A 3HL8A 3HP9A 2LQ8A 4M7DD 2P4TA 2JNGA 2R58A 2FHDA 2CKKA 3KBGA 3QJ6A 3SD4A 3L2RA 1Q86U 3PNWC 3T9NA 5J3BA 2EJFA 2PVOB 3ZFJA 4QVDA 1Q7YU 1G3TA 4C5GA 1N6AA 2FL7A 2KY9A 1QVGS 2E12A 2ZZDA 4JRKA 1BKBA 4XTUA 3SWNC 4C0ZA 2E6ZA 4RCBA 1X75C 3L2QA 4DOVA 4C92C 3CC4T 2FYKA 4QVZA 4M77B 3JCMX 5GAMd 3PIOA 4M78B 2DTHA 3CCQT 2RH2A 4M78E 5KCOA 5GMKi 3KXTA 5GAMg 3L2WA 3OW2S 1N27A 3V7CA 1KC8C 2ZPEB 1VQ4A 5GANj 3OYYA 2MWOA 1VQNT 2QA4A 3CCET 2RHYA 1BI2A 4KBMB 3HSBA 4C92F 3CCJA 5J26A 1W4SA 2MF2A 2WSEE 4ME7A 3FB9A 2F69A 3OYGA 4ZTFA 3ME9A 2RI5A 2RI3A 1KHIA 2KK4A 2E70A 2RK1A 3FDRA 4GLKA 2BIVA 3TREA 4PJOC 1I8FA 2WSFE 4M7AB 3OS1A 5D6WA 1N8RC 3CCLA 3FJPA 3OYFA 4IKFA 2JN0A 2E64A 4ZN1A 3SB2A 3HKSA 5A0DA 3CEYA 4M75E 2EQJA 2QQBA 2DJZA 1QVFA 4N4GA 2P0PA 4M78A 2XU8A 5DLOA 4C8QB 1U8RA 5I21A 4WF2A 3L2ZA 1VQ6T 2MWPA 3VUZA 5GAN7 4L6V5 4XTVA 2LCCA 2R5AA 4BI4A 2I2LA 4DA4A 4C0FA 5CQXA 3RERA 3JB9G 1ZBXA 2KSSA 3BFMA 3WVDB 4C5EA 3PT9A 4N0AA 1M90C 2XICA 4M78D 4ELYC 4E7KA 5GANd 3RKWA 4VUBA 3OS2A 4C92D 4RG8A 1YJ9A 3JCMh 5GANg 2OTJT 1QVFS 4BI8B 3QZ9B 4OB2B 4CI0C 4XTYA 3EFSA 1VQ9T 3M4YA 3OYCA 3CMEA 5CCAA 2VGMA 3DLMA 4XTWA 3OYEA 3L42A 1N9SA 1R8OB 2OAUA 1G3YA 2KAFA 2V8IA 3NTIA 3M4GA 3INZA 3RKXA 3M59A 4L5GA 1GXIE 5LJ3d 2VXFA 2L5QA 2E41A 2LC4A 3M5AA 4OMFB 2X4YA 1UB4A 5FU7C 4EMGA 3QZ5B 3AHUA 1BYMA 4M7DG 3CC2A 3ASKA 2HAXA 2Y4XA 3QUIA 3CCMT 4IUUA 1YJWA 3E1SA 4QQDA 3X24B 3RIRA 4J83A 3C12A 5FU6B 3VV0A 5GAOq 2C06A 5GAMe 4BY6B 3G6ET 1H641 3CCEA 2QA4T 2QI2A 2FB7A 1VQNA 5A2QE 4LDWA 3CMAA 4XU0A 5FLXE 1VQ4T 1QVGA 5GAN4 5IT9E 1M9SA 2K2VA 1U1SA 3EAEA 2EJGA 3X25B 4N4HA 4BI3A 2F5KA 2YHTA 3NFCA 5HK3A 1EIFA 5LJ5e 4MZMA 4NOYA 1JRIA 2H3JA 3N5BB 4C0DB 1S72T 4M75D 1M5Q1 2XDDA 2PVGB 3GF5A 3JCMf 1M1KU 1ZHIA 1VQ8A 1OI1A 4M7DE 4OGEA 2IG0A 2RHUA 1VQOA 1H3ZA 2EAYA 1WPYA 2VGNA 2LNVA 4C8QG 1WJQA 4C8QE 5GMKe 4JS5A 4JS4A 1KG1A 4JLGA 3G4SA 2O4XA 3HHTB 3PIPA 4J6YA 2CS7A 2CZ6B 2K3XA 3E9GA 3NTKA 1WJSA 4KUDK 4RG2A 2RHZA 4TVRA 1VQ9A 1M8VA 5CKEA 3MP6A 1VQ5A 2VYTA 3QDRB 4IUVA 1WQ7A 5CAIA 5FRNA 2EQKA 5IN1A 3L2VA 3E9FA 3OSSC 4BD3A 5GMKl 2DD5A 1K73U 3BY7A 1VQKT 3JCMb 1OZ2A 3CCSA 4JUVA 4E7IA 5A0LA 2DZCA 2L8DA 4F7UF 3BDLA 3V7RA 1YHQA 3FRNA 1PSFA 2CZ0B 4MMLA 5HY6A 1M1FA 1G3WA 2DK3A 3CCUT 5C6SA 2X35A 2DVEA 3GNFB 4PJOF 5GAN6 4A4FA 1Y96B 4M78C 1VQMA 4KULA 4LD6A 1HK9A 4EPCA 3DB4A 1LJOA 3TCJA 3V8LA 1D3BB 3A5ZB 4PKCC 4LDXA 1BIBA 3A8OB 3C95A 4QW2A 4BE1A 1YI2T 4X9DA 3OSVA 4BE2A 4M7DA 3OYMA 4E47A 2E6NA 3Q1JA 3CCVT 4JRPA 4BE0A 2M16A 2YRVA 4IUPA 2XDBA 1WGSA 5DM7R 2DEQA 2EIFA 3JB9I 2PVDB 1KD1U 4A4GA 2XD0A 4D6WA 2ZPGB 5GAN8 5GANf 3S3OA 1BI1A 3OBYA 2R57A 3SDZA 3VJPA 4ZGEB 4XU3A 3JRZA 3JCMg 4EDUA 2LQKA 2M0OA 3LW5E 4E7LA 3C4SA 3JCMd 2LVMA 4OB0B 1PSEA 1Y96A 5LJ3e 5FU7B 2EKOA 1UEBA 1WNLA 4M77F 4EMHA 3CPWA 2K5IA 5I2SA 2P0KA 4FU6A 5KH6A 4JLIA 3M58A 3RUXA 4C92A 4ELZC 3OYNA 1I5LA 1Q7YC 4JJNK 1YIJT 2CGHA 4PNOA 4HT9A 2RJCA 3I55T 1VQLT 2ZGWA 4PJOB 3SWNA 5LJ5h 5KE3A 3H8ZA 4XK8E 2K57A 4M75F 1I81A 4NL3A 1VQKA 3LLRA 2KVQG 4FM4B 1NE8A 3FIFA 4J7IA 4P5NA 1QVPA 5HKCA 3RESA 4J8OA 4M7AE 3LYIA 5CIUA 1YCYA 2L89A 1BI3A 3OMCA 3X26B 5LJ3h 3MEWA 5A0GA 1QP3A 3LWIA 5GAN5 2E65A 4IUQA 2XHCA 2FVUA 2K3YA 3A8GB 3QG1A 5CKBA 4HA8A 4M7AD 1VQLA 4M78F 2AHJB 3UDCA 4QQ6A 3HFNA 4B9WA 2ZCFB 5IAYA 3JCMJ 3OY9A 4MDWA 5GAOn 4YTLA 4C8QC 3HRSA 1VQ8T 2DTOA 2MAMA 2EYQA 5GANh 2RJEA 3A8HB 4JRIA 4ZN3A 3QBYA 4Y28E 1UGQB 4FL6A 4A4HA 2OTLT 3OYKA 2LDMA 3QIIA 1LOJA 5M9OA 3OYLA 3GLXA 2QQSA 3LGFA 4XAXB 2DTIA 2GFUA 3G7ZA 4LDYA 2DD4A 3JCMc 4B9XA 2CYZB 2DIGA 2D9TA 1FWZA 2KDSA 3VYGA 1V29B 2RJDA 3DLLA 4M75A 4JRQA 4PJOD 3BDUA 3WXMB 4M7AG 1KHCA 3JCMQ 5CKHA 1VIFA 2CZ7B 1DJ7B 2IVWA 1NZ9A 3FC3A 4M7DF 3CCVA 1FX7A 2DIQA 5FROA 1B34A 1QP2A 3L1AA 4EMKA 4C5HA 3CCMA 5KCHA 2EQMA 2HNIA 3RMSA 3R6OA 1QW1A 3OYDA 4C0GA 2QEXA 3CCRA 1VQPA 3I56A 2V8KA 4FIBA 4LDUA 4M75G 1Q81C 1WJRA 3EFRA 3M54A 1O9SA 2VV5A 3OBWA 4PL6A 5C0MA 4M78G 2X4WA 1NPRA 3LWHA 3JB9D 2KMTA 4ZTJA 5LJ3g 5KE2A 3QXEB 4MMKA 3LH0A 4QQGA 5DY9A 5GMKm 3GOXA 4XTZA 5LJ3j 4E7JA 3J81E 3OYJA 3JB9H 3JB9F 4R55A 3OYBA 3CBMA 2M9UA 1MGQA 3M55A 2DXTA 4II1A 2HQEA 1B34B 4EMKB 5GAOl 4XU1A 5CO7A 4M7DC 3NTHA 3V7SA 1K9MU 3JAME 4J5YA 3X20B 2HQXA 4RMOA 2CZ1B 2DKGA 5AYFA 4BUGA 2QEXT 3OA6A 1Q86C 4M7DB 2LX9A 2YLCA 3E19A 3HRUA 2PUOB 3MCAB 3F70A 3RKYA 3OS0A 4R56A 2RA2A 4C8QD 3QYHB 1VQ7T 3PMIA 3QPHA 4OGCA 3GP8A 1UGPB 3ER0A 3A8LB 3CXCA 1YIJA 3MP8A 3KUFA 2EQUA 4PLLA 3HRTA 4N4IA 2XG8D 2ZPIB 4M77D 3J80E 1S72A 3VU3C 1YITT 3CC7T 1RL2A 2X4JA 3V8KA 1MHNA 4FT4A 4C92G 3CCLT 3H6ZA 3JCMV 4ZGJB 2OTLA 4NS5A 1K8AU 3OB9A 2D6FA 2DZ9A 1G5VA 4F7UB 2BUDA 2E10A 3CC7A 3I56T 3CCUA 1G3SA 4E7HA 3QYGB 4C92B 4OB3B 1ZQ1A 2DXUA 4MZPA 1KD1C 3CMAT 2VUBA 4J6WA 2LT4A 2DXCA 4BACA 1VIEA 3VKIA 3OYAA 1JBMA 2K5LA 5CR2A 2LCLA 2RHXA 3M56A 5GAOm 1VQ7A 3CPFA 3CXCS 2NLUA 3C94A 4O5VA 2GFAA 4BY6C 2GQVA 2QQRA 2QQAA 2R5MA 4X34A 2HBPA 3PMTA 4PJOG 1IZ6A 2QXFA 3CC2T 1X6OA 4KT0E 1W2BS 3URGA 3P8BB 3G71A 5CK9A 2RI2A 5GMKh 5CQYA 2JZ2A 3ZEHA 3HFOA 4XQ3A 4XTXA 2YLBA 2RJFA 5LL6S 3V8JA 2BKDN 3JCMP 2XKOC 5GMKj 2K5FA 3PFSA 2XK0A 2O01E 4F7UA 3QHSA 1K73C 2MI6A 1D3BA 2D0QB 4RKUE 5EG2A 5GAOr 1KQSA 1SSFA 2O4XB 5CVIA 3OS5A 2EJ9A 4Q5WA 4A54A 3CPWS 4V2SA 4KUIA 1XQHA 4M7AA 3OYHA 2DPPB 4M7AC 2VXEA 1VUBA 3OW2A 1YJ9T 1M4ZA 1XTDA 1LNXA 3WVEB 2GF7A 3A8MB 1M1GA 4BDZA 3CD6T 4Y91A 4C8QA 4J6XA 4ZGDB 5DLQE 3G71T 4M77G 4C92E 3CCRT 1IREB 2PU9B 1VQPT 4OB1B 1Q81U 1OZ3A 5FU6C 1N9RA 5GAMj 2XIDA 4M75B 1KQ2A 3MP1A 3G6EA 3MEVA 1BIAA 2A7YA 2V8JA 3G4ST 3TEEA 1YJWT 2WACA 1VQOT 4XU2A 1Q82U 2DAQA 3CBOA 1BI0A 2JTFA 4HCZA 4L59A 4OVAA 4MDXA 2XDPA 4BDYA 1OYXA 2DXBA 3PGGA 3SWNB 4BB7A 3GPLA 2GCXA 4DOWA 1JJ2A 3TU4K 1VQMT 2E1HA 4NL2A 2QTXA 4J7FA 3VUBA 2K4YA 3MHXA 4M77E 1Q82C 1YITA 1N8RU 1UGRB 1UGSB 5LJ5g 4QVCA 2B8AA 4MZTA 4PLIA 2RK2A 2HD0A 4HKEA 5LJ5d 2JOYA 1NPPA 3JCMe 3CMET 4A4EA 4A4KA 5GAN3 3P8DA 1WQWA 2LRQA 4X9CA 2OTJA 5LJ5f 4FSXA 4JDSA 1XNIA 5CKDA 3CCQA 2RO0A 4IUTA 5GAN2 2QQ9A 3RMQA 1YBYA 2ZPBB 1YI2A 4HCBA 3DKMA 5CKFA 1KC8U 4OP0A 3M57A 3CC4A 2RM4A 1VQ5T 5GAOp 3UWNA 4ATOA 3UPUA 2XI9A 1U1TA 1M90U 2Y90A 2E5QA 5D6XA 4N0AC 3X28B 4PJOA 1P92A 1YHQT 3I55A 3O8VA 4UC4A 1RI0A 2P0QA 1W2BA 3META 3M53A 1I4K1 2ZPFB 3CBPA 3LX7A 3S3MA 4HT8A 2Y4YA 3MEAA 1Y71A 3GIBA 3GNGA 4HCCA 2VC8A 3QO3A 3BW1A 2X4XA 5GAMh 4O6JA 2KQWA 4LD9K 3JSCA 2F5TX 4C5IA 3ZBDA 2EWNA 1XOVA 4F7UE 2L3RA 1O75A 3M9QA 2JVVA 2LT1A 3CCJT 5FRMA 1NJIC 5D6YA 5GANe 3FLGA 1JB0E 2EFIA 2JUFA 1VQ6A 2LTOA 3MEUA 4OF1A 3JCMW 4PJOE 1KQSS 4EMKC 3QSUA 3OYIA 3JB9J 1Y07A 3PTAA 4IURA 3MO8A 4LDVA 1NJIU 2RD1A 1K8AC 1YJNT 3LGLA 3QJYA 3S3NA 3QKJA 4M75C 2JTMA 3SFMA 2RB6A 1TH7A 4C8QF 2A3LA 2RHIA 5HK0A 4M7AF 3UT1A 2G3RA 4CRIA 1YJNA 4F7UG 5L8RE 1Y7XA 4C0DC 5LJ5j 4A53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHT B;  2O01 E;  4OB0 B;  1PSE A;  2QDY B;  2ZPB B;  2CZ6 B;  2D0Q B;  2ZZD A;  1QP2 A;  3A8G B;  2WSF E;  4RKU E;  2AHJ B;  3QYG B;  3QZ9 B;  4OB3 B;  4OB2 B;  2ZCF B;  1JB0 E;  2DXC A;  2WSC E;  2DXB A;  2DPP B;  3A8O B;  3X20 B;  2CZ1 B;  3A8H B;  1AHJ B;  4Y28 E;  1UGQ B;  3X28 B;  3VYH B;  4XK8 E;  3X25 B;  3WVE B;  2DD5 A;  2PUO B;  3A8M B;  2ZPH B;  4FM4 B;  1GXI E;  3QYH B;  4ZGD B;  1UGR B;  2ZPE B;  1UGS B;  2PUK B;  1UGP B;  2PVD B;  3A8L B;  2ZPF B;  4L6V 5;  2ZPG B;  4KT0 E;  2DD4 A;  1IRE B;  2PU9 B;  2CYZ B;  2PVG B;  3QXE B;  3QZ5 B;  4OB1 B;  3X26 B;  4ZGE B;  3VYG A;  2ZPI B;  1QP3 A;  1V29 B;  1PSF A;  2CZ0 B;  3X24 B;  3WVD B;  2WSE E;  2PVO B;  5L8R E;  3LW5 E;  2CZ7 B;  1DJ7 B;  4ZGJ B; 
#chains in the Genus database with same CATH topology
 1FXX A;  5LJ3 f;  4FT2 A;  1HXD A;  3HPW A;  3P8H A;  1MUZ A;  5GAM f;  5I2M A;  1WIE A;  1LPL A;  3I35 A;  2K6D A;  4M77 A;  3CD6 A;  1T0H A;  2YRC A;  1RAB B;  4RCC A;  1UG1 A;  2LQ8 A;  2FHD A;  3CC7 Q;  3KBG A;  3QJ6 A;  4E2F B;  5J3B A;  2PVO B;  3ZFJ A;  4QVD A;  4PJM A;  3EH2 A;  2D0N A;  1T3L A;  3RBB B;  1QVG S;  1BKB A;  3SWN C;  4C0Z A;  3L2Q A;  1C1A A;  1NJI R;  4PFO A;  3ULR B;  2ATC B;  4AT1 B;  2FYK A;  3PIO A;  2L3S A;  5GAM d;  3OW2 S;  2JMA A;  3L2W A;  3CME Q;  2LX7 A;  1KC8 C;  2ZPE B;  4Y92 A;  2MWO A;  2JS2 A;  2QA4 A;  3CCE T;  2RHY A;  2MF2 A;  3FB9 A;  2F69 A;  2RI3 A;  1KHI A;  2WSF E;  3OS1 A;  5D6W A;  3CCL A;  4IKF A;  2E64 A;  2EQJ A;  1YN8 A;  3EGU A;  1ARK A;  4C8Q B;  3FJ5 A;  1U8R A;  5I21 A;  3NPF A;  4J9H A;  3L2Z A;  2MWP A;  4DA4 A;  2CP3 A;  5GAN 7;  2LCC A;  2R5A A;  1PWT A;  2I2L A;  1CSK A;  2LP5 A;  2KSS A;  3BFM A;  3WVD B;  4C5E A;  1YIT Q;  2K2M A;  4ELY C;  1WHM A;  2RN8 A;  4BI8 B;  4XTY A;  3M4Y A;  5CCA A;  3OYE A;  2OAU A;  5FW9 A;  3M4G A;  3INZ A;  2L5Q A;  2LC4 A;  2X4Y A;  3AHU A;  1BYM A;  3CC2 A;  3ASK A;  2Y4X A;  3QUI A;  1QCN A;  1A0N B;  5GAO q;  5FU6 B;  3G6E T;  3CCE A;  2QA4 T;  1OUL A;  2FB7 A;  2O9S A;  1ZSG A;  4LDW A;  4RTT A;  5GAN 4;  1M2V B;  5IT9 E;  3EAE A;  4N4H A;  2YHT A;  2H3J A;  2YRD A;  2K7A A;  1S72 T;  1BCO A;  2XDD A;  2YSQ A;  2PVG B;  1K0X A;  3PVQ A;  2ZAE A;  3MKD A;  1UHF A;  2IG0 A;  2RHU A;  1VQO A;  1H3Z A;  3HTR A;  1KG1 A;  4JLG A;  2DNU A;  2C0O A;  2CS7 A;  2F2X A;  3NTK A;  1WJS A;  4JJB A;  4KUD K;  4RG2 A;  2RHZ A;  1M8V A;  2DEU A;  1G83 A;  2D8H A;  5FRN A;  2EQK A;  5IN1 A;  3L2V A;  3E9F A;  4JUV A;  4E7I A;  4LNP A;  1RAE B;  5A0L A;  2DZC A;  1ZA2 B;  2V1R A;  2L8D A;  1MNE A;  2DL3 A;  3BDL A;  3LH5 A;  1PSF A;  1TUC A;  4MML A;  1M1F A;  1MMA A;  1FMV A;  2QA4 Q;  8ATC B;  4FYX B;  1U3O A;  4DBH A;  4PJO F;  1Y96 B;  4M78 C;  2MCN A;  4CC4 B;  4EPC A;  3V8L A;  1BIB A;  4X9D A;  2YT6 A;  3OSV A;  4M7D A;  1Q81 R;  4E47 A;  4JRP A;  3Q1J A;  2M16 A;  4RTW A;  1U06 A;  4A4G A;  5GAN f;  3VJP A;  4Z8A A;  5GJW B;  4EDU A;  4E7L A;  2LQK A;  1ABQ A;  3JCM d;  1X27 A;  5FU7 B;  1RLP C;  2E4H A;  4M77 F;  3CPW A;  4EMH A;  2K5I A;  2P0K A;  4JLI A;  1Q7Y C;  1SRM A;  2CGH A;  5IXB A;  4HT9 A;  4PJO B;  2W0Z A;  3SWN A;  5KE3 A;  4XK8 E;  2K57 A;  2KBT A;  1D1A A;  4J8O A;  1M27 C;  3AT1 B;  1MMN A;  1BI3 A;  2J05 A;  5LJ3 h;  4AFQ C;  1QP3 A;  1YP5 A;  3CXC P;  2FVU A;  5CKB A;  3QG1 A;  4HA8 A;  3EGD A;  4KRT A;  2A28 A;  3OY9 A;  4YTL A;  4C8Q C;  2DTO A;  4JRI A;  4Y28 E;  1RAF B;  1RI9 A;  4XAX B;  1PNJ A;  4LDY A;  2BZ8 A;  2DD4 A;  4B9X A;  1Q86 R;  2HBW A;  3VYG A;  2RJD A;  4M75 A;  1ZX6 A;  2PZ1 A;  3JCM Q;  1TS9 A;  1DJ7 B;  1VA7 A;  2DIQ A;  1HYO A;  2EGE A;  1B34 A;  1YHQ Q;  1QP2 A;  1HSQ A;  5KCH A;  2EQM A;  2QEX A;  1KD1 R;  3R6O A;  4M75 G;  4FIB A;  1AWX A;  2F2V A;  1O9S A;  2EVR A;  1QLY A;  3G6E Q;  5DY9 A;  4E7J A;  1IHW A;  2FZC B;  4JJD A;  4II1 A;  2HQE A;  2A08 A;  5GAO l;  4XU1 A;  2X3W D;  4M7D C;  4OMN A;  5L23 A;  1GCQ A;  4J5Y A;  3X20 B;  4RMO A;  2QEX T;  4BUG A;  4M7D B;  1EFN A;  4DBR A;  1C0M A;  2FRY A;  3A8L B;  1JJ2 P;  4N4I A;  2DRK A;  2ZPI B;  3VU3 C;  3CCL T;  4FT4 A;  3JCM V;  4ZGJ B;  3OB9 A;  3CC7 A;  1G3S A;  1SG5 A;  3QYG B;  2DXU A;  4J6W A;  2DXC A;  4BAC A;  1VIE A;  3CXC S;  3I5R A;  2NLU A;  4BY6 C;  2YWW A;  2QQA A;  4PJO G;  1CKA A;  3QWY A;  3CC2 T;  2P4R A;  2BZY A;  1IXD A;  5GMK h;  5CQY A;  1FYN A;  3ZEH A;  4XQ3 A;  5LL6 S;  2YLB A;  3V8J A;  2XKO C;  2K5F A;  1RAG B;  2I0N A;  2LZ6 B;  2MI6 A;  2D0Q B;  1SSF A;  2CDT A;  3OS5 A;  4V2S A;  3H0H A;  3CMA Q;  2X51 A;  3CD6 T;  3G71 T;  5FU6 C;  5GAM j;  1N9R A;  2XID A;  4M75 B;  1KQ2 A;  3G6E A;  2A7Y A;  1X2K A;  2EYX A;  2VAS A;  1QCF A;  1VQO T;  4DBF A;  1Q82 U;  2QAZ A;  2JTF A;  2YUO A;  2HZY A;  4HVW A;  3SWN B;  1VQM T;  2O31 A;  2MIO A;  3CCE Q;  1K9A A;  4QVC A;  4MZT A;  5LJ5 d;  2JOY A;  4HVU A;  4A4E A;  4A4K A;  3REB B;  2JMC A;  4FSX A;  3A1P A;  5GAN 2;  1YBY A;  2ZPB B;  4A63 B;  1YI2 A;  3CC2 Q;  1KC8 U;  3CC4 A;  2KYB A;  3ZL7 C;  1QKW A;  1FMK A;  2LQW A;  1T3S A;  2K9G A;  2NUZ A;  3I55 A;  4UC4 A;  1RI0 A;  2P0Q A;  1W2B A;  3LX7 A;  1NEB A;  3CBP A;  2ROT A;  2VC8 A;  2DM1 A;  1PM3 A;  2KQW A;  4LD9 K;  1WZO A;  2DBK A;  2EWN A;  4F7U E;  2L3R A;  4PJL A;  1O75 A;  2JVV A;  5FRM A;  3FLG A;  4B6M A;  2EFI A;  4OF1 A;  3JCM W;  1KQS S;  2OAW A;  3JB9 J;  1JEG A;  1Y07 A;  2ESW A;  4IUR A;  1NJI U;  3QDF A;  1YJN T;  1MV3 A;  3QJY A;  2DBM A;  3QKJ A;  4X1V A;  1TH7 A;  4ZNX A;  4F7U G;  5EC7 A;  4A53 A;  2QDY B;  3OMG A;  3FEO A;  2M1H A;  1JJ2 S;  2XMF A;  2MMP A;  4DQ2 A;  2OI3 A;  4GY5 A;  3CCS T;  2QTV A;  2PQW A;  3J7A F;  1PRL C;  3HP9 A;  1SHG A;  2K79 A;  3PNW C;  3T9N A;  2EJF A;  1F1B B;  4PK4 A;  3NGP A;  4GBQ A;  2DFU A;  1JQQ A;  3VS6 A;  2E3H A;  1X75 C;  2JW4 A;  2KT8 A;  4AG2 C;  2CUD A;  3CC4 T;  1W6X A;  1Y0M A;  2PNI A;  1UJY A;  2DTH A;  5GMK i;  1M90 R;  5GAM g;  2EW3 A;  3VS3 A;  1VQ4 A;  2ABL A;  5KYN A;  1VQN T;  4KBM B;  3HSB A;  1UEC A;  4C92 F;  3OYG A;  2O9V A;  4GLK A;  2MYS A;  3FDR A;  2KK4 A;  4N0A C;  2E70 A;  2RK1 A;  2BIV A;  1I8F A;  2KGT A;  2JN0 A;  2O88 A;  4ZN1 A;  1K0S A;  1WHL A;  3HKS A;  2PTK A;  1QVF A;  3H41 A;  4M78 A;  4N4G A;  1XJW B;  1I0C A;  1K1Z A;  1X6G A;  4L6V 5;  2FPD A;  4C0F A;  2CT3 A;  1Z9Q A;  3PT9 A;  1V1C A;  4F14 A;  5GAN d;  3RKW A;  1QVF S;  3QZ9 B;  3EFS A;  3CME A;  2VGM A;  3I9Q A;  1G3Y A;  2KAF A;  2DL5 A;  1YI2 Q;  3TQ7 P;  2QEX Q;  4AFU C;  3TSW A;  5LJ3 d;  2E41 A;  5FU7 C;  4EMG A;  4IIM A;  1Q7Y R;  3CCM T;  4IUU A;  2JXB A;  4QQD A;  3X24 B;  4J83 A;  3VV0 A;  4BY6 B;  2SEM A;  3EHR A;  4XU0 A;  2HQH A;  5FLX E;  1VQ4 T;  1QVG A;  2BZX A;  1M9S A;  3MPU B;  1U1S A;  1YNZ A;  4BI3 A;  1IGQ A;  2F5K A;  5HK3 A;  3NFC A;  2HCK A;  4MZM A;  4J9C A;  4NOY A;  2DF6 A;  4J9F A;  2H3E B;  1ZHI A;  2DIL A;  4OGE A;  1TUD A;  2EAY A;  2LNV A;  4C8Q G;  4JS4 A;  4C8Q E;  5GMK e;  3HHT B;  2CZ6 B;  2K3X A;  1S72 Q;  2L3P A;  1JXM A;  1JO8 A;  2RNA A;  1PG5 B;  2VYT A;  3OSS C;  4BD3 A;  5GMK l;  1PKS A;  1UFF A;  2LCS A;  1X2Q A;  1AT1 B;  4ANJ A;  2QYZ A;  4FW1 A;  1G3W A;  1I5O B;  5C6S A;  2X35 A;  3GNF B;  1FMW A;  5FWC A;  4KUL A;  1HK9 A;  1LJO A;  1W70 A;  1RAD B;  4HCK A;  3C95 A;  4M4Z A;  4BE1 A;  1YI2 T;  1QKX A;  1AWW A;  2E6N A;  1TSF A;  3CCV T;  2YRV A;  2XDB A;  2CP0 A;  3JB9 I;  1KD1 U;  3S3O A;  2ZPG B;  5GAN 8;  3OBY A;  2R57 A;  4XU3 A;  3M0Q A;  2LMJ A;  2CUB A;  5LJ3 e;  2CP2 A;  1UEB A;  3PVL A;  2NUP A;  1YCS B;  5I2S A;  5KH6 A;  3OYN A;  1I5L A;  2RQV A;  2C0T A;  5LJ5 h;  3H0F A;  3EG9 B;  4M75 F;  2LJ0 A;  1I81 A;  3LLR A;  1H92 A;  1NE8 A;  3FIF A;  4P5N A;  1YCY A;  1BBZ A;  2EKH A;  3I55 Q;  4IUQ A;  2XHC A;  2K3Y A;  1E6G A;  4M78 F;  2RQR A;  3UDC A;  3HFN A;  3JCM J;  1MND A;  2MAM A;  4RUG A;  3A8H B;  4ZN3 A;  1UGQ B;  1GFD A;  4FL6 A;  2OTL T;  2GQI A;  3EG2 A;  3QII A;  1LOJ A;  1NM7 A;  2QQS A;  3LGF A;  2DTI A;  2GFU A;  3JCM c;  3DLL A;  3BDU A;  1KHC A;  2IVW A;  3M0S A;  5FRO A;  3L1A A;  3UAT A;  1ZUY A;  4C5H A;  3OYD A;  1X6B A;  4RTY A;  1PHT A;  1RAH B;  3LWH A;  2EBP A;  3EG1 A;  5KE2 A;  4QQG A;  3GOX A;  1KSW A;  3OYJ A;  3JB9 H;  1UE9 A;  2DVJ A;  3M55 A;  4EMK B;  5AT1 B;  3JAM E;  2CZ1 B;  2DKG A;  3EGX A;  2HDA A;  3OA6 A;  2LX9 A;  1TG0 A;  2PUO B;  3QYH B;  1YIJ A;  1GCQ C;  1UGP B;  1QCO A;  3G4S Q;  3KUF A;  2EQU A;  4PJN A;  2L2P A;  3HRT A;  2KE9 A;  3J80 E;  1YIT T;  3SEM A;  4C92 G;  3H6Z A;  2D6F A;  2DZ9 A;  1G5V A;  2E10 A;  2NUP B;  1ZQ1 A;  2LT4 A;  2KEA A;  4OMO A;  1JBM A;  2K5L A;  2LCL A;  3CPF A;  4O5V A;  1X6O A;  5CK9 A;  2RI2 A;  3JCM P;  4XTX A;  2BKD N;  2AIR B;  3PFS A;  1X43 A;  4F7U A;  5GAO r;  1KQS A;  2EJ9 A;  3CPW S;  3M0U A;  1XQH A;  3VS2 A;  4M7A A;  4M7A C;  1HJD A;  4RTZ A;  3VS0 A;  1YJ9 T;  3WVE B;  2GF7 A;  4Y91 A;  4J6X A;  4ZGD B;  1SF9 A;  1VQO Q;  4C92 E;  1VQP T;  2ED1 A;  2PU9 B;  2DMO A;  3MP1 A;  5KYY B;  2DYI A;  2WAC A;  2L3Q A;  4XU2 A;  4L59 A;  3CD6 Q;  1OYX A;  2KYM A;  4JJC A;  1JJ2 A;  4NL2 A;  4J7F A;  3MHX A;  3CCR Q;  1UDL A;  1YIT A;  4CC7 A;  1YWO A;  1N8R U;  1UGR B;  1UGS B;  2C0I A;  2B8A A;  2RK2 A;  4HKE A;  3JCM e;  5GAN 3;  1WQW A;  2LRQ A;  4X9C A;  2OTJ A;  4JDS A;  1XNI A;  2RO0 A;  4IUT A;  4HCB A;  2LNH B;  1G2B A;  2VVK A;  3M57 A;  2A36 A;  5GAO p;  4ATO A;  3CPW P;  3UPU A;  2JT4 A;  2XI9 A;  4JPB W;  1GCP A;  2ECZ A;  4PJO A;  1IB8 A;  2AZV A;  3VS5 A;  3O8V A;  1AZG B;  3RDV A;  4LXC A;  3I56 Q;  1I4K 1;  7AT1 B;  3S3M A;  6AT1 B;  3MEA A;  1D0X A;  3GNG A;  4HCC A;  2KXC A;  3BW1 A;  2X4X A;  1YIJ Q;  1V76 A;  3G71 Q;  2DX1 A;  4OMP A;  4AFZ C;  3ZBD A;  3CCJ T;  2J6O A;  2COY A;  2KI7 A;  5GAN e;  1JB0 E;  2JUF A;  4PJO E;  2AZS A;  1VQ7 Q;  2O2O A;  1K8A C;  3LGL A;  3S3N A;  4M75 C;  3SFM A;  1OV3 A;  4C8Q F;  2G3R A;  1KJW A;  2ROL A;  4CRI A;  1WHJ A;  4C0D C;  3EG0 A;  2DO3 A;  1M1K R;  1QVF P;  4PJJ A;  1M1K C;  1X01 A;  2GTO A;  2WSC E;  3VYH B;  4AG1 C;  4LN2 A;  1K9M C;  3L2U A;  1KQ1 A;  1R0B G;  2P4T A;  2CKK A;  3L2R A;  1Q86 U;  4OML A;  1G3T A;  1N6A A;  1UHC A;  1WHH A;  2E12 A;  4JRK A;  1NLO C;  1GBR A;  4RCB A;  2KRO A;  4DOV A;  1WFW A;  2HMA A;  4M77 B;  3CCQ T;  5KCO A;  3KXT A;  1N27 A;  4LUD A;  2EYY A;  1HD3 A;  2B86 A;  1N5Z A;  5IHN A;  5GAN j;  2OTL Q;  1SEM A;  3CCJ A;  5J26 A;  1W4S A;  2CH4 W;  8AT1 B;  1UGV A;  3ME9 A;  1WHK A;  4PJO C;  3TRE A;  5IH2 A;  4M7A B;  4KGX B;  3OYF A;  1OX8 A;  4FYV B;  4QT7 A;  4M75 E;  2AT1 B;  2VWF A;  2XU8 A;  4RTX A;  1IO6 A;  1WXB A;  4BI4 A;  3RR6 A;  2EPD A;  3UF4 A;  5CQX A;  3RER A;  1U5S A;  1ZUU A;  1M90 C;  4M78 D;  1VQ8 Q;  4E7K A;  3EFO B;  1YJ9 A;  3JCM h;  5GAN g;  3D7S B;  2OX7 A;  1VQ9 T;  2A37 A;  3OYC A;  3DLM A;  1N9S A;  4PFP A;  2V8I A;  3RKX A;  3M59 A;  4L5G A;  1GXI E;  2QGG A;  3M5A A;  4OMF B;  2DL4 A;  1WI7 A;  3E1S A;  2DA9 A;  2KRS A;  3RIR A;  3C12 A;  2C06 A;  5GJV B;  1VQN A;  3CMA A;  2KXD A;  2E5K A;  2EJG A;  1ZSZ B;  3X25 B;  1RAA B;  5LJ5 e;  1JRI A;  1ZLM A;  1WDX A;  2EQI A;  4M75 D;  3CCQ Q;  2V26 A;  1OI1 A;  4M7D E;  1NG2 A;  1WJQ A;  4JS5 A;  1H3H A;  3G4S A;  2O4X A;  1MMG A;  3E9G A;  4TVR A;  1VQ9 A;  1RLQ C;  3E2U A;  2DET A;  3QDR B;  1WQ7 A;  2DER A;  4ESR A;  1K73 U;  3THK A;  3JCM b;  1M3B A;  1OZ2 A;  3CCS A;  5KYW B;  2BE7 D;  2EGC A;  3VS4 A;  3V7R A;  2YUP A;  3FRN A;  1H8K A;  2CZ0 B;  1YHQ A;  3CCU T;  2DK3 A;  1QWF A;  1RUW A;  2FZG B;  4A4F A;  3DB4 A;  1PD1 A;  3TCJ A;  1D3B B;  3A5Z B;  4PKC C;  1WYX A;  4LDX A;  3A8O B;  4QW2 A;  5ECA A;  4IUP A;  1WXU A;  3JV3 A;  2EIF A;  1KC8 R;  1J3T A;  4F16 A;  1BI1 A;  4ZGE B;  3JRZ A;  1MV0 B;  3LW5 E;  3C4S A;  2OJ2 A;  3EFO A;  2X9H A;  1Y96 A;  2EKO A;  1KK7 A;  2FEI A;  4FU6 A;  4C92 A;  1YIJ T;  4J9D A;  1VQ4 Q;  2DL8 A;  1VQL T;  2ZGW A;  1B7T A;  3H8Z A;  3NMZ C;  1KFZ A;  4J7I A;  1QVP A;  3RES A;  4M7A E;  2L89 A;  3X26 B;  3LWI A;  2KT1 A;  1EZZ B;  2DL7 A;  4M7A D;  2AHJ B;  2W10 A;  4QQ6 A;  2ZCF B;  2J6F A;  4MDW A;  3C0C A;  3QWX X;  4OMQ A;  2KRM A;  1VQN Q;  4A4H A;  1LCK A;  1TU0 B;  1VQ6 Q;  3G7Z A;  2CYZ B;  5KYU B;  2DIG A;  2D9T A;  1FWZ A;  2KDS A;  2HEQ A;  3WXM B;  4M7A G;  5CKH A;  1VIF A;  2CZ7 B;  3CCV A;  1FX7 A;  3EGD B;  1PC0 A;  3CQT A;  5IHK A;  1QW1 A;  1VQP A;  4C0G A;  1Q81 C;  2K3B A;  4LDU A;  3EFR A;  3PE0 A;  3M54 A;  3OBW A;  4PL6 A;  2X4W A;  5KYW A;  3JB9 D;  4ZTJ A;  1D1B A;  4MMK A;  2M0Y A;  1QWE A;  5GMK m;  4XTZ A;  5IHI A;  5LJ3 j;  1M2O A;  3OYB A;  2M9U A;  1Q82 R;  2DXT A;  4J9E A;  1B34 B;  1K76 A;  5CO7 A;  3V7S A;  4J9B A;  3RNJ A;  1K9M U;  1VOM A;  1ZSZ A;  2CP6 A;  1E7O A;  3E19 A;  3HRU A;  1OPK A;  1B3Q A;  2DLP A;  3F70 A;  4R56 A;  3OS0 A;  2RA2 A;  1KIK A;  4C8Q D;  1VQ9 Q;  1VQ7 T;  1NLP C;  1ZSZ C;  3QPH A;  4OGC A;  3GP8 A;  3ER0 A;  3CXC A;  2H8H A;  4PLL A;  4M77 D;  1S72 A;  3CC7 T;  2X4J A;  1MHN A;  4J9I A;  2OTL A;  4NS5 A;  1K8A U;  1K4U S;  2GGR A;  4C92 B;  4OB3 B;  1KD1 C;  1IHV A;  4RTU A;  3OYA A;  3M56 A;  4Z89 A;  5GAO m;  3EG3 A;  1R77 A;  1I07 A;  3C94 A;  2EGA A;  4HVV A;  2HKQ B;  2R5M A;  4X34 A;  2HBP A;  3PMT A;  1IZ6 A;  5HCK A;  4F17 A;  4KT0 E;  1W2B S;  1NYF A;  3P8B B;  1AVZ C;  2JZ2 A;  2QGF B;  3HFO A;  2RJF A;  5GMK j;  1SPK A;  4AFS C;  2XK0 A;  1K73 C;  3QHS A;  1K8A R;  1D3B A;  4RKU E;  5CVI A;  1C6V X;  3OYH A;  2NUT B;  3OW2 A;  1GBQ A;  1M4Z A;  1NYG A;  1M1G A;  5DLQ E;  2KRN A;  5KYU A;  3CCR T;  1IRE B;  4OB1 B;  2RQW A;  4LUE A;  1VQM Q;  2HKN A;  1BIA A;  1Y57 A;  2V8J A;  3G4S T;  1YJW T;  1SSH A;  4D8D A;  2DAQ A;  2RMO A;  1OOT A;  1BI0 A;  1M3A A;  2CH4 A;  2J7I A;  1M2V A;  2XDP A;  4BB7 A;  2DXB A;  3GPL A;  2GCX A;  2K4Y A;  1VQP Q;  1X69 A;  2DRM A;  5LJ5 f;  3CCQ A;  1ABO A;  2QQ9 A;  5CKF A;  2D1X A;  4OP0 A;  2L0A A;  4DBQ A;  1VQ5 T;  2BTT A;  3M0P A;  1AWJ A;  1M90 U;  5KYX A;  2ED0 A;  2YDL A;  1P92 A;  1OX9 A;  1YHQ T;  5I11 A;  3MET A;  3M53 A;  2Y4Y A;  1Y71 A;  3SHW A;  1CKB A;  3QO3 A;  1W2B P;  1VQL Q;  5GAM h;  2F5T X;  1M8M A;  4C5I A;  1JU5 C;  1XOV A;  1OU9 A;  3M9Q A;  2LT1 A;  1K9M R;  4KH1 B;  2QG9 B;  2CRE A;  3QSU A;  1SRL A;  4LDV A;  4K11 A;  2FG0 A;  2RB6 A;  2A3L A;  2RHI A;  5HK0 A;  2EYZ A;  1YJN A;  5LJ5 j;  1GRI A;  2CSQ A;  1PCX A;  4M77 C;  5J39 A;  1WLP B;  2JTE A;  3DB3 A;  2VB6 A;  2NUT A;  1AHJ B;  3OQ5 A;  1VYU A;  2ZPH B;  2D8J A;  3S6W A;  2PUK B;  4Z02 A;  3HL8 A;  4M7D D;  3G1J A;  1YJW Q;  2JNG A;  2R58 A;  1TUG B;  3SD4 A;  1AEY A;  1Q7Y U;  1BB9 A;  2BE9 B;  3TSZ A;  2LQN A;  3MJX A;  4C5G A;  2FL7 A;  4WCI A;  4JZ3 A;  2KY9 A;  2ZZD A;  4D8K A;  4XTU A;  2IPO B;  2E6Z A;  3VRY A;  1MMD A;  2QDL A;  4C92 C;  4QVZ A;  3JCM X;  1AOJ A;  4M78 B;  3EGX B;  2RH2 A;  4M78 E;  2HL5 C;  3V7C A;  3OYY A;  4QKU A;  1QQJ A;  1BI2 A;  2RQT A;  1EX4 A;  2RPN A;  2M51 A;  2WSE E;  4ME7 A;  1TXQ A;  4ZTF A;  2RI5 A;  1N8R C;  3FJP A;  2KR3 A;  1N8R R;  3SB2 A;  5A0D A;  3CEY A;  2QQB A;  5KYX B;  2ENM A;  2DJZ A;  1PKT A;  2P0P A;  5DLO A;  3UA6 A;  2RQU A;  4WF2 A;  1VQ6 T;  3VUZ A;  4XTV A;  4GLM A;  3JB9 G;  1ZBX A;  4N0A A;  2XIC A;  4VUB A;  3OS2 A;  4C92 D;  4RG8 A;  2OTJ T;  1B07 A;  1IRX A;  4OB2 B;  4CI0 C;  2J6K A;  4XTW A;  3L42 A;  1R8O B;  1PD0 A;  3NTI A;  1TTH B;  3VRZ A;  2VXF A;  1ZBJ A;  1UB4 A;  2QK0 A;  3QZ5 B;  4FW2 A;  4M7D G;  3CCM Q;  2HAX A;  1OPL A;  4CC3 A;  2JM8 A;  1YJW A;  5I22 A;  2MPX C;  1W1F A;  5GAM e;  1H64 1;  2QI2 A;  5A2Q E;  1VQK Q;  2QAS A;  1RAI B;  2K2V A;  4CC2 A;  1TOV A;  2FPF A;  2CSI A;  1EIF A;  3N5B B;  4C0D B;  2GBQ A;  1QMC A;  1M5Q 1;  4OMM A;  3JCM f;  3GF5 A;  1M1K U;  1VQ8 A;  1IGU A;  4E6R A;  1WPY A;  2VGN A;  1AZE A;  1VYT A;  3PIP A;  4J6Y A;  4R0K A;  1YWP A;  2DJQ A;  5CKE A;  3UA7 A;  2JJ9 A;  3MP6 A;  1VQ5 A;  4IUV A;  1WHG A;  2CP7 A;  2AKL A;  5CAI A;  1G8X A;  3VS7 A;  2DD5 A;  4DEX A;  1E6H A;  3BY7 A;  1VQK T;  1RAC B;  2DYB A;  3TVT A;  1UUE A;  4F7U F;  1WA7 A;  5HY6 A;  2IIM A;  2DVE A;  5GAN 6;  1Z9Z A;  1VQM A;  4LD6 A;  1GL5 A;  2DE0 X;  1BU1 A;  3CC4 Q;  2FPE A;  4BE2 A;  3OYM A;  1ACM B;  4BE0 A;  3IQL A;  1WGS A;  2FRW A;  2M02 A;  2DEQ A;  2JS0 A;  5DM7 R;  2PVD B;  2LJ3 A;  5D7U A;  2XD0 A;  4D6W A;  3SDZ A;  3JCM g;  2M0O A;  1ZUK A;  2LVM A;  4E7Z A;  3M0T A;  4OB0 B;  1PSE A;  1SHF A;  1WNL A;  1OU8 A;  3NHN A;  3M58 A;  3RUX A;  4ELZ C;  4JJN K;  5IXF A;  4PNO A;  2RJC A;  3I55 T;  1D0Y A;  4NL3 A;  1VQK A;  2KVQ G;  2FO0 A;  4FM4 B;  5HKC A;  1BK2 A;  4FYW B;  4AMC A;  5FWB A;  2JM9 A;  3VS1 A;  3LYI A;  5CIU A;  3OMC A;  3EHQ A;  3MEW A;  5A0G A;  3CCU Q;  2AKK A;  5GAN 5;  2E65 A;  2CP5 A;  3GBQ A;  1YJN Q;  2SRC A;  3A8G B;  2HL3 A;  2V1Q A;  1VQL A;  1GFC A;  4J9G A;  4B9W A;  5IAY A;  5GAO n;  3HRS A;  1VQ8 T;  2EYQ A;  5GAN h;  2RJE A;  3QBY A;  3EG9 A;  3OYK A;  2LDM A;  5M9O A;  3OYL A;  2OTJ Q;  3U23 A;  3GLX A;  2HSP A;  2AK5 A;  4JRQ A;  1D1C A;  1V29 B;  4PJO D;  1UJ0 A;  1OEB A;  1NZ9 A;  3FC3 A;  2GTJ A;  4M7D F;  1D0Z A;  3OW2 P;  4EMK A;  3CCM A;  2HNI A;  3RMS A;  3CCR A;  4Z88 A;  2V8K A;  3I56 A;  1WJR A;  2F2W A;  1QVG P;  2VV5 A;  5C0M A;  4M78 G;  1NPR A;  4ORZ A;  2KMT A;  5LJ3 g;  1VYV A;  3QXE B;  3LH0 A;  2A0F B;  3J81 E;  1M30 A;  3JB9 F;  4R55 A;  3CBM A;  1MGQ A;  1YFN A;  1KQS P;  3NTH A;  4HXJ A;  4WTO B;  3M0R A;  2HQX A;  5AYF A;  1Q86 C;  2YLC A;  3RKY A;  3BE3 A;  3MCA B;  1WX6 A;  3PMI A;  1M3C A;  3MP8 A;  3REA B;  2XG8 D;  1RL2 A;  3V8K A;  4E7S A;  4F7U B;  2BUD A;  3CCU A;  3I56 T;  4E7H A;  4MZP A;  3CMA T;  2MK5 A;  2FZK B;  2VUB A;  1SKU B;  4FSS A;  1WXT A;  3VKI A;  5CR2 A;  2RHX A;  1VQ7 A;  3H0I A;  1Q95 G;  2GFA A;  2GQV A;  2QQR A;  2QXF A;  3URG A;  3G71 A;  4IIO A;  2COZ A;  1UTI A;  1NBE B;  1PRM C;  2HSE B;  1OQK A;  2O01 E;  3R6N A;  5EG2 A;  1S1N A;  2O4X B;  2P84 A;  2X3X D;  4A54 A;  4Q5W A;  4KUI A;  2DPP B;  2VXE A;  1VUB A;  4F04 B;  2KNB B;  1XTD A;  1LNX A;  2LJ1 A;  3A8M B;  4BDZ A;  4C8Q A;  4M77 G;  3A98 A;  1AD5 A;  1Q81 U;  1OZ3 A;  3CCL Q;  1LVK A;  1BCM A;  9ATC B;  3MEV A;  3TEE A;  3I5S A;  3CBO A;  4JZ4 A;  4HCZ A;  4OVA A;  4MDX A;  4BDY A;  3PGG A;  4DOW A;  3TU4 K;  2EYW A;  2E1H A;  3CCS Q;  2QTX A;  3VUB A;  1I1J A;  4M77 E;  1VQ5 Q;  4PFZ A;  4FCY A;  1Q82 C;  4RTV A;  1NEG A;  4KGV B;  1K73 R;  5LJ5 g;  2G6F X;  4PLI A;  2HD0 A;  1T0J A;  2Z0W A;  3EH1 A;  1JXO A;  1NPP A;  3CME T;  5KYY A;  2COW A;  3H9N A;  3P8D A;  4KGZ B;  2NWM A;  5CKD A;  3RMQ A;  3DKM A;  2F1L A;  2RM4 A;  3UWN A;  1U1T A;  2Y90 A;  2E5Q A;  5D6X A;  3X28 B;  2NYS A;  1ZA1 B;  3CCJ Q;  2ZPF B;  4KH0 B;  4HT8 A;  3GIB A;  2RF0 A;  1YJ9 Q;  1TWB A;  2MOX A;  4O6J A;  3JSC A;  4DEY A;  2CT4 A;  4FYY B;  4LE9 A;  4EIK A;  3KFV A;  2VKN A;  1NJI C;  5D6Y A;  2J06 A;  1VQ6 A;  2YUQ A;  2GNC A;  2LTO A;  3MEU A;  2YXY A;  2YUN A;  4EMK C;  1D09 B;  3OYI A;  3PTA A;  1AWO A;  3MO8 A;  2RD1 A;  3CCV Q;  2JTM A;  2E3I A;  4M7A F;  3UT1 A;  3O5Z A;  1R0C B;  5L8R E;  1Y7X A; 
#chains in the Genus database with same CATH homology
 2DO3 A;  1FXX A;  2QDY B;  4M77 C;  5J39 A;  3OMG A;  5LJ3 f;  3DB3 A;  4FT2 A;  1M1K C;  1X01 A;  3FEO A;  1HXD A;  2M1H A;  3HPW A;  1JJ2 S;  2WSC E;  3P8H A;  5GAM f;  2MMP A;  4DQ2 A;  5I2M A;  4GY5 A;  1AHJ B;  3CCS T;  3VYH B;  3OQ5 A;  4M77 A;  3CD6 A;  2ZPH B;  3S6W A;  2PQW A;  1K9M C;  2PUK B;  4RCC A;  4Z02 A;  3J7A F;  3L2U A;  1KQ1 A;  3HL8 A;  3HP9 A;  2LQ8 A;  4M7D D;  2P4T A;  2JNG A;  2R58 A;  2FHD A;  2CKK A;  3KBG A;  3QJ6 A;  3SD4 A;  3L2R A;  1Q86 U;  3PNW C;  3T9N A;  5J3B A;  2EJF A;  2PVO B;  3ZFJ A;  4QVD A;  1Q7Y U;  1G3T A;  4C5G A;  1N6A A;  2FL7 A;  2KY9 A;  1QVG S;  2E12 A;  2ZZD A;  4JRK A;  1BKB A;  4XTU A;  3SWN C;  4C0Z A;  2E6Z A;  4RCB A;  1X75 C;  3L2Q A;  4DOV A;  4C92 C;  3CC4 T;  2FYK A;  4QVZ A;  4M77 B;  3JCM X;  5GAM d;  3PIO A;  4M78 B;  2DTH A;  3CCQ T;  2RH2 A;  4M78 E;  5KCO A;  5GMK i;  3KXT A;  5GAM g;  3L2W A;  3OW2 S;  1N27 A;  3V7C A;  1KC8 C;  2ZPE B;  1VQ4 A;  5GAN j;  3OYY A;  2MWO A;  1VQN T;  2QA4 A;  3CCE T;  2RHY A;  1BI2 A;  4KBM B;  3HSB A;  4C92 F;  3CCJ A;  5J26 A;  1W4S A;  2MF2 A;  2WSE E;  4ME7 A;  3FB9 A;  2F69 A;  3OYG A;  4ZTF A;  3ME9 A;  2RI5 A;  2RI3 A;  1KHI A;  2KK4 A;  2E70 A;  2RK1 A;  3FDR A;  4GLK A;  2BIV A;  3TRE A;  4PJO C;  1I8F A;  2WSF E;  4M7A B;  3OS1 A;  5D6W A;  1N8R C;  3CCL A;  3FJP A;  3OYF A;  4IKF A;  2JN0 A;  2E64 A;  4ZN1 A;  3SB2 A;  3HKS A;  5A0D A;  3CEY A;  4M75 E;  2EQJ A;  2QQB A;  2DJZ A;  1QVF A;  4N4G A;  2P0P A;  4M78 A;  2XU8 A;  5DLO A;  4C8Q B;  1U8R A;  5I21 A;  4WF2 A;  3L2Z A;  1VQ6 T;  2MWP A;  3VUZ A;  5GAN 7;  4L6V 5;  4XTV A;  2LCC A;  2R5A A;  4BI4 A;  2I2L A;  4DA4 A;  4C0F A;  5CQX A;  3RER A;  3JB9 G;  1ZBX A;  2KSS A;  3BFM A;  3WVD B;  4C5E A;  3PT9 A;  4N0A A;  1M90 C;  2XIC A;  4M78 D;  4ELY C;  4E7K A;  5GAN d;  3RKW A;  4VUB A;  3OS2 A;  4C92 D;  4RG8 A;  1YJ9 A;  3JCM h;  5GAN g;  2OTJ T;  1QVF S;  4BI8 B;  3QZ9 B;  4OB2 B;  4CI0 C;  4XTY A;  3EFS A;  1VQ9 T;  3M4Y A;  3OYC A;  3CME A;  5CCA A;  2VGM A;  3DLM A;  4XTW A;  3OYE A;  3L42 A;  1N9S A;  1R8O B;  2OAU A;  1G3Y A;  2KAF A;  2V8I A;  3NTI A;  3M4G A;  3INZ A;  3RKX A;  3M59 A;  4L5G A;  1GXI E;  5LJ3 d;  2VXF A;  2L5Q A;  2E41 A;  2LC4 A;  3M5A A;  4OMF B;  2X4Y A;  1UB4 A;  5FU7 C;  4EMG A;  3QZ5 B;  3AHU A;  1BYM A;  4M7D G;  3CC2 A;  3ASK A;  2HAX A;  2Y4X A;  3QUI A;  3CCM T;  4IUU A;  1YJW A;  3E1S A;  4QQD A;  3X24 B;  3RIR A;  4J83 A;  3C12 A;  5FU6 B;  3VV0 A;  5GAO q;  2C06 A;  5GAM e;  4BY6 B;  3G6E T;  1H64 1;  3CCE A;  2QA4 T;  2QI2 A;  2FB7 A;  1VQN A;  5A2Q E;  4LDW A;  3CMA A;  4XU0 A;  5FLX E;  1VQ4 T;  1QVG A;  5GAN 4;  5IT9 E;  1M9S A;  2K2V A;  1U1S A;  3EAE A;  2EJG A;  3X25 B;  4N4H A;  4BI3 A;  2F5K A;  2YHT A;  3NFC A;  5HK3 A;  1EIF A;  5LJ5 e;  4MZM A;  4NOY A;  1JRI A;  2H3J A;  3N5B B;  4C0D B;  1S72 T;  4M75 D;  1M5Q 1;  2XDD A;  2PVG B;  3GF5 A;  3JCM f;  1M1K U;  1ZHI A;  1VQ8 A;  1OI1 A;  4M7D E;  4OGE A;  2IG0 A;  2RHU A;  1VQO A;  1H3Z A;  2EAY A;  1WPY A;  2VGN A;  2LNV A;  4C8Q G;  1WJQ A;  4C8Q E;  5GMK e;  4JS5 A;  4JS4 A;  1KG1 A;  4JLG A;  3G4S A;  2O4X A;  3HHT B;  3PIP A;  4J6Y A;  2CS7 A;  2CZ6 B;  2K3X A;  3E9G A;  3NTK A;  1WJS A;  4KUD K;  4RG2 A;  2RHZ A;  4TVR A;  1VQ9 A;  1M8V A;  5CKE A;  3MP6 A;  1VQ5 A;  2VYT A;  3QDR B;  4IUV A;  1WQ7 A;  5CAI A;  5FRN A;  2EQK A;  5IN1 A;  3L2V A;  3E9F A;  3OSS C;  4BD3 A;  5GMK l;  2DD5 A;  1K73 U;  3BY7 A;  1VQK T;  3JCM b;  1OZ2 A;  3CCS A;  4JUV A;  4E7I A;  5A0L A;  2DZC A;  2L8D A;  4F7U F;  3BDL A;  3V7R A;  1YHQ A;  3FRN A;  1PSF A;  2CZ0 B;  4MML A;  5HY6 A;  1M1F A;  1G3W A;  2DK3 A;  3CCU T;  5C6S A;  2X35 A;  2DVE A;  3GNF B;  4PJO F;  5GAN 6;  4A4F A;  1Y96 B;  4M78 C;  1VQM A;  4KUL A;  4LD6 A;  1HK9 A;  4EPC A;  3DB4 A;  1LJO A;  3TCJ A;  3V8L A;  1D3B B;  3A5Z B;  4PKC C;  4LDX A;  1BIB A;  3A8O B;  3C95 A;  4QW2 A;  4BE1 A;  1YI2 T;  4X9D A;  3OSV A;  4BE2 A;  4M7D A;  3OYM A;  4E47 A;  2E6N A;  3Q1J A;  3CCV T;  4JRP A;  4BE0 A;  2M16 A;  2YRV A;  4IUP A;  2XDB A;  1WGS A;  5DM7 R;  2DEQ A;  2EIF A;  3JB9 I;  2PVD B;  1KD1 U;  4A4G A;  2XD0 A;  4D6W A;  2ZPG B;  5GAN 8;  5GAN f;  3S3O A;  1BI1 A;  3OBY A;  2R57 A;  3SDZ A;  3VJP A;  4ZGE B;  4XU3 A;  3JRZ A;  3JCM g;  4EDU A;  2LQK A;  2M0O A;  3LW5 E;  4E7L A;  3C4S A;  3JCM d;  2LVM A;  4OB0 B;  1PSE A;  1Y96 A;  5LJ3 e;  5FU7 B;  2EKO A;  1UEB A;  1WNL A;  4M77 F;  4EMH A;  3CPW A;  2K5I A;  5I2S A;  2P0K A;  4FU6 A;  5KH6 A;  4JLI A;  3M58 A;  3RUX A;  4C92 A;  4ELZ C;  3OYN A;  1I5L A;  1Q7Y C;  4JJN K;  1YIJ T;  2CGH A;  4PNO A;  4HT9 A;  2RJC A;  3I55 T;  1VQL T;  2ZGW A;  4PJO B;  3SWN A;  5LJ5 h;  5KE3 A;  3H8Z A;  4XK8 E;  2K57 A;  4M75 F;  1I81 A;  4NL3 A;  1VQK A;  3LLR A;  2KVQ G;  4FM4 B;  1NE8 A;  3FIF A;  4J7I A;  4P5N A;  1QVP A;  5HKC A;  3RES A;  4J8O A;  4M7A E;  3LYI A;  5CIU A;  1YCY A;  2L89 A;  1BI3 A;  3OMC A;  3X26 B;  5LJ3 h;  3MEW A;  5A0G A;  1QP3 A;  3LWI A;  5GAN 5;  2E65 A;  4IUQ A;  2XHC A;  2FVU A;  2K3Y A;  3A8G B;  3QG1 A;  5CKB A;  4HA8 A;  4M7A D;  1VQL A;  4M78 F;  2AHJ B;  3UDC A;  4QQ6 A;  3HFN A;  4B9W A;  2ZCF B;  5IAY A;  3JCM J;  3OY9 A;  4MDW A;  5GAO n;  4YTL A;  4C8Q C;  3HRS A;  1VQ8 T;  2DTO A;  2MAM A;  2EYQ A;  5GAN h;  2RJE A;  3A8H B;  4JRI A;  4ZN3 A;  3QBY A;  4Y28 E;  1UGQ B;  4FL6 A;  4A4H A;  2OTL T;  3OYK A;  2LDM A;  3QII A;  1LOJ A;  5M9O A;  3OYL A;  3GLX A;  2QQS A;  3LGF A;  4XAX B;  2DTI A;  2GFU A;  3G7Z A;  4LDY A;  2DD4 A;  3JCM c;  4B9X A;  2CYZ B;  2DIG A;  2D9T A;  1FWZ A;  2KDS A;  3VYG A;  1V29 B;  2RJD A;  3DLL A;  4M75 A;  4JRQ A;  4PJO D;  3BDU A;  3WXM B;  4M7A G;  1KHC A;  3JCM Q;  5CKH A;  1VIF A;  2CZ7 B;  1DJ7 B;  2IVW A;  1NZ9 A;  3FC3 A;  4M7D F;  3CCV A;  1FX7 A;  2DIQ A;  5FRO A;  1B34 A;  1QP2 A;  3L1A A;  4EMK A;  4C5H A;  3CCM A;  5KCH A;  2EQM A;  2HNI A;  3RMS A;  3R6O A;  1QW1 A;  3OYD A;  4C0G A;  2QEX A;  3CCR A;  1VQP A;  3I56 A;  2V8K A;  4FIB A;  4LDU A;  4M75 G;  1Q81 C;  1WJR A;  3EFR A;  3M54 A;  1O9S A;  2VV5 A;  3OBW A;  4PL6 A;  5C0M A;  4M78 G;  2X4W A;  1NPR A;  3LWH A;  3JB9 D;  2KMT A;  4ZTJ A;  5LJ3 g;  5KE2 A;  3QXE B;  4MMK A;  3LH0 A;  4QQG A;  5DY9 A;  5GMK m;  3GOX A;  4XTZ A;  5LJ3 j;  4E7J A;  3J81 E;  3OYJ A;  3JB9 H;  3JB9 F;  4R55 A;  3OYB A;  3CBM A;  2M9U A;  1MGQ A;  3M55 A;  2DXT A;  4II1 A;  2HQE A;  1B34 B;  4EMK B;  5GAO l;  4XU1 A;  5CO7 A;  4M7D C;  3NTH A;  3V7S A;  1K9M U;  3JAM E;  4J5Y A;  3X20 B;  2HQX A;  4RMO A;  2CZ1 B;  2DKG A;  5AYF A;  4BUG A;  2QEX T;  3OA6 A;  1Q86 C;  4M7D B;  2LX9 A;  2YLC A;  3E19 A;  3HRU A;  2PUO B;  3MCA B;  3F70 A;  3RKY A;  3OS0 A;  4R56 A;  2RA2 A;  4C8Q D;  3QYH B;  1VQ7 T;  3PMI A;  3QPH A;  4OGC A;  3GP8 A;  1UGP B;  3ER0 A;  3A8L B;  3CXC A;  1YIJ A;  3MP8 A;  3KUF A;  2EQU A;  4PLL A;  3HRT A;  4N4I A;  2XG8 D;  2ZPI B;  4M77 D;  3J80 E;  1S72 A;  3VU3 C;  1YIT T;  3CC7 T;  1RL2 A;  2X4J A;  3V8K A;  1MHN A;  4FT4 A;  4C92 G;  3CCL T;  3H6Z A;  3JCM V;  4ZGJ B;  2OTL A;  4NS5 A;  1K8A U;  3OB9 A;  2D6F A;  2DZ9 A;  1G5V A;  4F7U B;  2BUD A;  2E10 A;  3CC7 A;  3I56 T;  3CCU A;  1G3S A;  4E7H A;  3QYG B;  4C92 B;  4OB3 B;  1ZQ1 A;  2DXU A;  4MZP A;  1KD1 C;  3CMA T;  2VUB A;  4J6W A;  2LT4 A;  2DXC A;  4BAC A;  1VIE A;  3VKI A;  3OYA A;  1JBM A;  2K5L A;  5CR2 A;  2LCL A;  2RHX A;  3M56 A;  5GAO m;  1VQ7 A;  3CPF A;  3CXC S;  2NLU A;  3C94 A;  4O5V A;  2GFA A;  4BY6 C;  2GQV A;  2QQR A;  2QQA A;  2R5M A;  4X34 A;  2HBP A;  3PMT A;  4PJO G;  1IZ6 A;  2QXF A;  3CC2 T;  1X6O A;  4KT0 E;  1W2B S;  3URG A;  3P8B B;  3G71 A;  5CK9 A;  2RI2 A;  5GMK h;  5CQY A;  2JZ2 A;  3ZEH A;  3HFO A;  4XQ3 A;  4XTX A;  2YLB A;  2RJF A;  5LL6 S;  3V8J A;  2BKD N;  3JCM P;  2XKO C;  5GMK j;  2K5F A;  3PFS A;  2XK0 A;  2O01 E;  4F7U A;  3QHS A;  1K73 C;  2MI6 A;  1D3B A;  2D0Q B;  4RKU E;  5EG2 A;  5GAO r;  1KQS A;  1SSF A;  2O4X B;  5CVI A;  3OS5 A;  2EJ9 A;  4Q5W A;  4A54 A;  3CPW S;  4V2S A;  4KUI A;  1XQH A;  4M7A A;  3OYH A;  2DPP B;  4M7A C;  2VXE A;  1VUB A;  3OW2 A;  1YJ9 T;  1M4Z A;  1XTD A;  1LNX A;  3WVE B;  2GF7 A;  3A8M B;  1M1G A;  4BDZ A;  3CD6 T;  4Y91 A;  4C8Q A;  4J6X A;  4ZGD B;  5DLQ E;  3G71 T;  4M77 G;  4C92 E;  3CCR T;  1IRE B;  2PU9 B;  1VQP T;  4OB1 B;  1Q81 U;  1OZ3 A;  5FU6 C;  1N9R A;  5GAM j;  2XID A;  4M75 B;  1KQ2 A;  3MP1 A;  3G6E A;  3MEV A;  1BIA A;  2A7Y A;  2V8J A;  3G4S T;  3TEE A;  1YJW T;  2WAC A;  1VQO T;  4XU2 A;  1Q82 U;  2DAQ A;  3CBO A;  1BI0 A;  2JTF A;  4HCZ A;  4L59 A;  4OVA A;  4MDX A;  2XDP A;  4BDY A;  1OYX A;  2DXB A;  3PGG A;  3SWN B;  4BB7 A;  3GPL A;  2GCX A;  4DOW A;  1JJ2 A;  3TU4 K;  1VQM T;  2E1H A;  4NL2 A;  2QTX A;  4J7F A;  3VUB A;  2K4Y A;  3MHX A;  4M77 E;  1Q82 C;  1YIT A;  1N8R U;  1UGR B;  1UGS B;  5LJ5 g;  4QVC A;  2B8A A;  4MZT A;  4PLI A;  2RK2 A;  2HD0 A;  4HKE A;  5LJ5 d;  2JOY A;  1NPP A;  3JCM e;  3CME T;  4A4E A;  4A4K A;  5GAN 3;  3P8D A;  1WQW A;  2LRQ A;  4X9C A;  2OTJ A;  5LJ5 f;  4FSX A;  4JDS A;  1XNI A;  5CKD A;  3CCQ A;  2RO0 A;  4IUT A;  5GAN 2;  2QQ9 A;  3RMQ A;  1YBY A;  2ZPB B;  1YI2 A;  4HCB A;  3DKM A;  5CKF A;  1KC8 U;  4OP0 A;  3M57 A;  3CC4 A;  2RM4 A;  1VQ5 T;  5GAO p;  3UWN A;  4ATO A;  3UPU A;  2XI9 A;  1U1T A;  1M90 U;  2Y90 A;  2E5Q A;  5D6X A;  4N0A C;  3X28 B;  4PJO A;  1P92 A;  1YHQ T;  3I55 A;  3O8V A;  4UC4 A;  1RI0 A;  2P0Q A;  1W2B A;  3MET A;  3M53 A;  1I4K 1;  2ZPF B;  3CBP A;  3LX7 A;  3S3M A;  4HT8 A;  2Y4Y A;  3MEA A;  1Y71 A;  3GIB A;  3GNG A;  4HCC A;  2VC8 A;  3QO3 A;  3BW1 A;  2X4X A;  5GAM h;  4O6J A;  2KQW A;  4LD9 K;  3JSC A;  2F5T X;  4C5I A;  3ZBD A;  2EWN A;  1XOV A;  4F7U E;  2L3R A;  1O75 A;  3M9Q A;  2JVV A;  2LT1 A;  3CCJ T;  5FRM A;  1NJI C;  5D6Y A;  5GAN e;  3FLG A;  1JB0 E;  2EFI A;  2JUF A;  1VQ6 A;  2LTO A;  3MEU A;  4OF1 A;  3JCM W;  4PJO E;  1KQS S;  4EMK C;  3QSU A;  3OYI A;  3JB9 J;  1Y07 A;  3PTA A;  4IUR A;  3MO8 A;  4LDV A;  1NJI U;  2RD1 A;  1K8A C;  1YJN T;  3LGL A;  3QJY A;  3S3N A;  3QKJ A;  4M75 C;  2JTM A;  3SFM A;  2RB6 A;  1TH7 A;  4C8Q F;  2A3L A;  2RHI A;  5HK0 A;  4M7A F;  3UT1 A;  2G3R A;  4CRI A;  1YJN A;  4F7U G;  5L8R E;  1Y7X A;  4C0D C;  5LJ5 j;  4A53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...