2DD5A

Thiocyanate hydrolase (scnase) from thiobacillus thioparus native holo-enzyme
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase alpha subunit
publication title Structure of thiocyanate hydrolase: a new nitrile hydratase family protein with a novel five-coordinate cobalt(III) center.
pubmed doi rcsb
molecule tags Hydrolase
total genus 27
structure length 119
sequence length 119
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dd5A00
3A8LB 1UGPB 4ZGDB 3LW5E 2ZZDA 2DPPB 2DXCA 1JB0E 1V29B 2ZPHB 1DJ7B 2PU9B 2WSCE 4KT0E 3VYGA 2ZPEB 3QYHB 2ZPFB 2PUOB 4OB1B 3A8HB 3QZ9B 4OB0B 1PSFA 4L6V5 2ZCFB 2WSFE 2PVDB 3A8GB 1UGRB 3QZ5B 3VYHB 2ZPBB 3QYGB 2QDYB 3A8OB 2PUKB 2ZPIB 3WVEB 1PSEA 4Y28E 2DD5A 3X26B 2ZPGB 3X24B 2CZ7B 1QP2A 2WSEE 3A8MB 2CZ6B 2AHJB 1IREB 4XK8E 4OB3B 1QP3A 3X25B 1UGSB 5L8RE 3HHTB 2CYZB 4OB2B 2PVOB 2DD4A 4FM4B 3X28B 4RKUE 4ZGJB 2D0QB 1GXIE 2PVGB 2DXBA 3WVDB 2CZ1B 2CZ0B 4ZGEB 1UGQB 2O01E 3QXEB 3X20B 1AHJB
chains in the Genus database with same CATH superfamily
1W2BS 1T0HA 2R58A 2EQKA 2KAFA 2A0FB 3SWNB 1IO6A 2KDSA 2DK3A 2OTLQ 1VQMA 1UJ0A 1UDLA 5GMKi 1VOMA 1RLPC 1HSQA 1LOJA 3T9NA 2LMJA 1I0CA 1KD1R 2IIMA 3G4SA 1KC8R 3V7RA 5GANe 5HK0A 1YJNT 4J9IA 4XTZA 1NJIR 1VUBA 2EQMA 4QQDA 3CD6Q 2CH4A 1MMAA 3GNFB 1ZUUA 2KSSA 3M0SA 4RTWA 4L5GA 1UEBA 4M78B 2RD1A 2YUOA 1S72Q 2BIVA 2EYYA 1T3SA 4HXJA 5LJ3f 4C0DB 4L59A 1WXUA 5KYXA 4A4FA 4IKFA 1YJWT 2LQNA 1N8RR 1HD3A 4M75B 4HVVA 3A98A 1RAAB 1TU0B 2HBWA 1FYNA 5GAMf 2KRNA 4X9DA 2BZ8A 4F7UE 2DVJA 3CMEQ 3PT9A 1XJWB 4XK8E 5D7UA 3CCVT 2HD0A 1GBRA 3H41A 4LD6A 1Q86R 3FDRA 1YITA 3E9FA 3SHWA 1MGQA 2GFUA 2R5AA 5I2SA 4LXCA 2CP3A 3L2ZA 1MUZA 2BTTA 1GCPA 2J06A 4HA8A 3NPFA 4HCBA 4IUVA 5J26A 2DJQA 1B34A 2V1RA 1NE8A 2DYBA 2HQHA 2R57A 4XTUA 7AT1B 3QG1A 4DQ2A 1WHKA 1ZHIA 5LJ5e 3VRYA 1VQ8Q 4GLMA 4PL6A 2CREA 1WJRA 1TSFA 1VQ7Q 3CCJQ 1WHMA 1BIAA 4BY6C 5GJWB 3G1JA 1WGSA 5CIUA 3QKJA 5FWCA 2DBKA 2MWOA 3E1SA 4EPCA 2E10A 2V26A 1VQ9A 3QYHB 2F1LA 1WPYA 1PD0A 2G6FX 5DY9A 2QXFA 3META 5CKEA 4M7AF 4XU1A 2QDLA 3EG2A 2ESWA 5A0GA 2LC4A 2QTVA 3G6EQ 2RMOA 4AT1B 1RI9A 1Y07A 2FZKB 3RERA 1PSEA 5IXFA 5IHNA 2KVQG 1ABQA 4XU2A 1TOVA 3SB2A 1LPLA 4MDXA 1BCOA 2CSQA 1YCSB 5GAOl 1TTHB 1VQMQ 2CSIA 2RQUA 1GRIA 1AWJA 2L3SA 4HVUA 1Y7XA 2E5QA 1QP3A 3RIRA 3G4SQ 2RI3A 5GANf 1G2BA 1VQLT 1M1KU 2AZSA 2GF7A 2JTFA 3CC2T 1VQOT 2E1HA 2DLPA 2YLBA 2ROLA 4DOWA 2K2VA 1P92A 2DRKA 2HL5C 1K8AU 4JLIA 2PNIA 3SDZA 2DTIA 4M75E 1G5VA 3JB9D 3JRZA 1WXTA 1G3SA 2LQKA 3FIFA 3UPUA 1OPLA 4IIMA 1VIEA 2XDPA 2VVKA 3M4YA 3L2VA 3JB9G 1UG1A 1F1BB 2EYXA 1LNXA 2KI7A 2E70A 2MI6A 2LZ6B 1IRXA 2YLCA 3DKMA 4QVCA 2DMOA 1D09B 3EGUA 5FRMA 1ABOA 4ATOA 1KC8U 3UT1A 2J6OA 4ZN1A 5M9OA 5LJ3d 4LDXA 1ZLMA 1WNLA 3I56A 2LCCA 1JJ2A 1PCXA 1SHGA 5GAMd 2JTMA 1ZSZC 2DX1A 2GQVA 1GFDA 4LDYA 2ZPBB 3TSZA 3INZA 3JCMW 1X75C 4TVRA 3FEOA 1D0ZA 1UHCA 4UC4A 1VQPT 2LCLA 3WVEB 2EGAA 1CKAA 4CC4B 1G83A 2JN0A 2XDBA 5LJ5f 2DD5A 4Y92A 2X4JA 4M7DD 2ENMA 4FCYA 3LWIA 2QGFB 2D8HA 2QEXA 1M1FA 3JB9J 1IXDA 4J7IA 2AHJB 4ELZC 5DLOA 1Q86U 3M0TA 3OYBA 1WYXA 4M7DG 4M7DC 2DEUA 2L0AA 3N5BB 2HKQB 2GBQA 2GCXA 1JU5C 2PVOB 3PE0A 3G71A 1UGVA 1QVFP 1KFZA 4KBMB 1Z9QA 4BI3A 5GAOm 3FLGA 2E3HA 4LDUA 2DXBA 4O5VA 2LVMA 1FXXA 4C5IA 2EFIA 1YIJT 1C0MA 3EG9B 1BI3A 3JV3A 4MMLA 3NMZC 3URGA 4OMLA 1T0JA 1WZOA 4JS4A 2MWPA 3OYCA 1U1SA 3VV0A 3P8BB 3A5ZB 3R6NA 4CC7A 3CCQA 2OAWA 3I35A 3KXTA 4KRTA 2FPDA 3JAME 1PG5B 1I8FA 3VU3C 3FJ5A 1YI2T 1XQHA 3DLMA 1NG2A 3VUZA 1C1AA 4FYWB 4JRKA 5GAN7 2RHXA 1PM3A 4DEYA 3HP9A 1K9MC 4M77B 2E64A 2FG0A 4XTVA 3EG1A 1M90C 4LNPA 1HK9A 1K9AA 3L1AA 2RHUA 3CPFA 2R5MA 5GANd 4HVWA 3RDVA 4OMOA 2NUTB 2K7AA 3RMSA 2IVWA 2OAUA 4QVZA 1TUDA 5A2QE 1QP2A 1KD1C 4CC3A 4LD9K 5FU7B 1M2VB 5KYWA 4MMKA 2RJEA 3JCMb 4D6WA 2AKKA 4J9BA 1NJIC 3SWNC 2LP5A 1IREB 3JCMf 4BE1A 3RNJA 4BE2A 3HFNA 2X3XD 1NLPC 3JB9F 3TVTA 1R0BG 1SPKA 4D8DA 1O75A 1YWPA 1IHVA 1QCNA 3I56Q 1QVGS 4KUDK 2QYZA 4QW2A 2XK0A 3QIIA 4EIKA 2K9GA 4M78D 5GAOn 4N0AA 2PVGB 1AWXA 3OYGA 5IHKA 2EJ9A 2LX9A 3C4SA 1N8RC 3EGXB 3Q1JA 2CP5A 3M59A 4M78G 1RABB 4M78C 2XDDA 4KH1B 4BACA 1VQ6A 3CCST 4DBHA 5GAN4 1QWFA 5CKDA 3V7SA 4C0DC 2FPFA 1U8RA 1G8XA 2ZZDA 1Q86C 1KG1A 5IN1A 2QEXQ 3JCMJ 1FWZA 4ANJA 2P0KA 1VQ5T 1KQ1A 1O9SA 5FU6C 3U23A 5LJ3e 1SRMA 4XAXB 4BB7A 5CQYA 3CEYA 3M0PA 4L6V5 3DB4A 3G71Q 1MNEA 3GIBA 1WA7A 4M7DF 4PJJA 2M0OA 2NUZA 5GAMe 1VYTA 4HT9A 3F70A 4JS5A 1ZUKA 1B07A 2GTOA 1YJ9T 3OW2P 3OYMA 3L2QA 2XG8D 4PFZA 2DTOA 4C92A 1QVPA 2AT1B 2K3XA 2QI2A 4DA4A 1VIFA 2DIGA 1QCFA 2NWMA 4M7DA 2CZ6B 2QQ9A 2WACA 3CCQQ 3QSUA 2B86A 4C0GA 4RTTA 3CC7A 1NZ9A 3CMAT 4EMKB 2NUPB 1H3ZA 2LNVA 3CCET 4RG8A 4IUUA 2DA9A 2A36A 2PQWA 2K4YA 2X9HA 2MPXC 1ACMB 2EKHA 4ELYC 1ARKA 4IURA 1UTIA 4E7JA 5LL6S 2A08A 2QGGA 1NLOC 2RNAA 2RHIA 4JRIA 4FSXA 2AZVA 1Q7YU 2YSQA 2CUBA 2XD0A 2DF6A 3HTRA 4IUTA 2E6NA 2DZCA 2XHCA 3MEUA 3PIOA 2GNCA 2P84A 1I07A 2KNBB 5CR2A 1M1KR 3I55A 3MO8A 3OBWA 3CCUT 1BI1A 3PGGA 1X69A 4FU6A 3CCRQ 3OYEA 1H8KA 1AEYA 2FEIA 5D6YA 1K8AR 4F04B 3EH1A 3KUFA 2RJDA 2CKKA 6AT1B 2CP0A 1VYUA 4OB1B 4PJOG 4PJOC 2O9VA 1YHQT 2VXEA 3CC4A 2HEQA 2V1QA 4DEXA 3E19A 2SRCA 1M1GA 2HZYA 4RTXA 1JJ2P 3OQ5A 3JCMd 1VQKT 1K73C 1VQ4A 2DZ9A 4QT7A 2XI9A 1IHWA 3CCLQ 3OS1A 2MAMA 5IT9E 3PIPA 1SEMA 1VQ6Q 1S1NA 3OMGA 1QQJA 2VB6A 2JTEA 2KE9A 2C0IA 2DJZA 3GOXA 3I5SA 5GAOp 1BKBA 4M78F 2HBPA 1M5Q1 5KYUA 5CKBA 5FWBA 3M55A 2X4WA 3MEWA 5FW9A 1AVZC 2MIOA 2FZCB 4C92E 3TCJA 1GFCA 4Z02A 1RAFB 2QQRA 1PNJA 1IB8A 3ZBDA 2E6ZA 3X28B 2FO0A 4PK4A 1YN8A 4FYVB 2EQUA 1XOVA 3QDFA 1GXIE 5CVIA 2KY9A 5I22A 1VQNT 2OTJT 1MHNA 2LJ1A 2OTLT 3X20B 1OU8A 2RHYA 4Z8AA 5GMKj 4PFPA 2YUQA 2F2XA 4HCCA 3E9GA 2FPEA 3JCMV 3LWHA 2DPPB 1B34B 2P0QA 2DL7A 2HDAA 1SSFA 2J7IA 3CC7Q 4KULA 2ED1A 4JZ3A 4A4HA 4RMOA 3CD6T 3CCMA 5C6SA 2ZGWA 2JOYA 3ME9A 1E7OA 1PSFA 2QA4A 1XTDA 2ZCFB 1S72T 4RTZA 4C8QD 1D3BA 2JW4A 3RBBB 4XQ3A 1NYFA 2E3IA 1I5LA 1GBQA 4NOYA 3FJPA 3M4GA 1RLQC 4C8QG 4D8KA 4C8QC 4JRPA 5LJ5h 4KGZB 2EAYA 3EFRA 2EYQA 3JCMc 3R6OA 2HCKA 3OYJA 1FX7A 2VYTA 3DB3A 2KBTA 2AKLA 1M8MA 3CMET 3OW2A 2B8AA 3I55Q 2EYWA 1QW1A 2E65A 1KQSP 4Q5WA 4O6JA 3EH2A 1WHJA 2JNGA 1AOJA 1AZGB 3REBB 1RL2A 3UA7A 2M9UA 4M77D 4XTXA 3LH5A 3CC4Q 2CT4A 4FM4B 4JJCA 2A7YA 2COYA 2JM9A 3O8VA 4M7AA 1RUWA 2LJ3A 2VUBA 3LH0A 2MF2A 3S3MA 1VQ8T 1NPRA 4PJOF 4J9FA 1UHFA 4M77G 1VQ4Q 3CXCP 4M77C 4IUPA 1VQ7T 3CCJT 3EFOA 3FB9A 1K76A 3H0FA 2E4HA 3BY7A 2KMTA 1TUGB 3H9NA 4RTYA 1QMCA 1M3BA 1QWEA 3H0IA 5FROA 2MK5A 4B9XA 3JB9I 4DOVA 3VJPA 4PJOA 3BE3A 4AFSC 1IZ6A 2V8JA 3EHQA 5IH2A 2KXDA 3UDCA 3MCAB 2RK1A 4J6YA 1X01A 2BUDA 4FL6A 3G6ET 1K1ZA 4XTYA 1RAGB 1UE9A 2K5IA 1QCOA 2EGEA 3SD4A 3A8GB 3CCSA 2X3WD 3GBQA 3GF5A 1PRMC 3CPWP 2DXTA 1M8VA 2K2MA 4PNOA 3JCMe 1KSWA 1Y96A 5KYNA 3PFSA 4X9CA 2DE0X 5IXBA 2E5KA 2DL5A 1Z9ZA 5I21A 1YITQ 3HFOA 2LNHB 4J83A 3VS5A 1VQMT 2X35A 3P8DA 2AK5A 4FW2A 4HKEA 1W70A 1X6BA 2QAZA 3OS0A 2MOXA 3PMTA 2YUPA 3UF4A 1WHLA 3G7ZA 1K0XA 3OYDA 3RUXA 2FHDA 1G3YA 3G4ST 2L89A 1OV3A 4E47A 2DNUA 2EPDA 4E6RA 1M2OA 4LUDA 1FMVA 1OQKA 4RTVA 1TWBA 1I4K1 1YJ9A 4LDWA 2HQEA 4NL2A 3CCMQ 1Y57A 1Y0MA 1I5OB 2DD4A 1JJ2S 4E7SA 4C5HA 1PKSA 2QA4Q 1OX9A 1UECA 5KYYA 3OYLA 3EGDA 1J3TA 2VV5A 3VS3A 1EZZB 1KJWA 1OU9A 2CH4W 5CQXA 4OF1A 1SSHA 2QQSA 1AWWA 3OYHA 4FYYB 2ZPEB 1VQ9Q 2XIDA 2Y90A 4J9GA 4N4HA 1UGPB 2JS0A 2MYSA 2CDTA 3OYYA 4RCCA 4A54A 1WHHA 2X51A 3CBMA 4FIBA 4C8QF 3M56A 4M7AE 2XKOC 4BD3A 1MV3A 2H8HA 2I0NA 5I2MA 4F7UG 4II1A 1U1TA 2KEAA 5LJ3g 2LT1A 4BY6B 2DERA 1A0NB 3BFMA 2D1XA 3C94A 3A8HB 2RK2A 1Q7YR 2L3QA 1ZX6A 5AT1B 4Z88A 1Q82U 3RESA 3M58A 2BE7D 3JSCA 2FRWA 2O4XA 3M57A 1MNDA 4LUEA 1EIFA 5GAMg 2M02A 1K4US 4C8QA 2FRYA 4KGXB 4X34A 2ATCB 1KHIA 4AFUC 2QDYB 4E7IA 3MPUB 5GAN2 4PJOE 1WQ7A 2HQXA 1BU1A 3ASKA 1RAEB 1KIKA 1M1KC 1Q81R 2IPOB 4E7HA 2VXFA 2VKNA 1MMNA 4M77F 1UUEA 5J39A 1K8AC 2WSEE 1OEBA 3JCMP 3ULRB 2RI2A 4PFOA 4XU3A 2EVRA 4E2FB 1BK2A 3J7AF 2LJ0A 4PLIA 2K3YA 4J9DA 3X25B 1ZBJA 3A1PA 4GLKA 2VC8A 3MHXA 1UFFA 1YJNA 4Y91A 3AT1B 1KQSA 5KYWB 1ZUYA 1M4ZA 1YCYA 2EQJA 1SF9A 4E7KA 2HMAA 1CKBA 4M77A 1TXQA 2DM1A 3S3NA 1KC8C 2YUNA 1NYGA 2BE9B 4MZMA 3H8ZA 4PJMA 2BZYA 2RM4A 3I9QA 1AD5A 4JJDA 3BDUA 1WIEA 2GFAA 4FT4A 3QPHA 3A8LB 2DRMA 1HYOA 3QUIA 5GAOr 1OULA 4HCZA 2DYIA 3HKSA 4OMNA 3CXCA 1YJWA 4KUIA 2P0PA 2DKGA 4B6MA 2DL4A 5GJVB 2K57A 1TUCA 4OGCA 3C0CA 2J6FA 3MP8A 4IIOA 2PU9B 2WSCE 3TSWA 2AIRB 5CKHA 1GCQC 3EG3A 2J6KA 3L42A 2DL8A 3UATA 2DL3A 2Y4YA 3CCVA 1HJDA 1WLPB 3RMQA 1OZ3A 2G3RA 4M75D 4PLLA 1SRLA 3OMCA 3EHRA 2LDMA 2F5TX 1W6XA 4JLGA 2LT4A 1V76A 2K6DA 4M75G 4M75C 2PUKB 2DEQA 3NTKA 2D9TA 3GPLA 5GANg 1B7TA 3OYAA 3THKA 3M0RA 3CPWA 1ZSZA 1JRIA 2RA2A 1LJOA 2SEMA 2A37A 4QQGA 2KYBA 2DBMA 3KBGA 4JZ4A 4C92B 3I56T 4OB3B 1EX4A 5LJ3h 3OYFA 4RTUA 1UGSB 3SFMA 2IG0A 1IGUA 4FYXB 1PRLC 2X4YA 2VASA 4RCBA 4XU0A 2I2LA 2KR3A 4F7UF 5GAMh 1RACB 2D0QB 2BKDN 3CMEA 1JBMA 3FRNA 3WVDB 4KH0B 3CBPA 2CZ0B 1PKTA 4WCIA 2FL7A 1U5SA 1UGQB 4ME7A 3MJXA 2C06A 2PTKA 3M0QA 5I11A 2LQ8A 3QO3A 2JMAA 2MCNA 2QEXT 2RH2A 1W4SA 3QDRB 2W0ZA 4F7UA 2DXCA 1JB0E 1V29B 3TEEA 2KROA 1X6OA 5FRNA 1X27A 3VS4A 2CP2A 5KE2A 2OI3A 1UJYA 3LLRA 2ZAEA 2M1HA 3G71T 2L8DA 5LJ5g 2EWNA 4MZTA 4JJNK 1ZA1B 1YJNQ 1H641 4LDVA 2ROTA 4OMMA 1VQLA 2RN8A 5D6XA 1JXOA 2KT1A 2NYSA 3OBYA 2L3RA 3VYHB 1WDXA 3CC2A 2HKNA 1VQOA 2LCSA 1OI1A 5GMKe 2XU8A 1AWOA 4JRQA 2RF0A 1Q81U 2K5LA 3PVLA 2K79A 4OVAA 2JUFA 4XTWA 3CQTA 4A4KA 1QVFS 3BDLA 4E7ZA 2E41A 1WQWA 1W2BA 1JO8A 4Y28E 5LJ3j 3CCQT 5D6WA 1BB9A 4ESRA 2O31A 3NGPA 3E2UA 2JZ2A 2FVUA 1AT1B 2C0TA 1YJWQ 3MP6A 5A0LA 1LVKA 4C5EA 5GAMj 4CRIA 2RQTA 2ED0A 4NL3A 4OMFB 5GAN6 2XICA 4J7FA 1FMKA 2EJFA 2H3JA 3HHTB 1JXMA 3CCVQ 4OB2B 4GBQA 2K5FA 3SWNA 5KYUB 2RQRA 1NM7A 2JT4A 2F5KA 3ER0A 2L3PA 1X2QA 5GANh 3M5AA 5KYXB 2PZ1A 1RAHB 1M3AA 5GMKl 5IHIA 2LTOA 4PKCC 1BYMA 3OB9A 3CCRT 2GQIA 1VQPA 4R56A 3PMIA 4J8OA 2YHTA 1UB4A 1ZA2B 4AMCA 1RAIB 4J9CA 4M75F 5GAN5 1GCQA 2KRSA 4DBFA 2DVEA 4KGVB 3H6ZA 1DJ7B 4M7DE 4C5GA 2DXUA 4M78A 4IUQA 1ZSGA 3C95A 2RPNA 1M9SA 3VYGA 3UA6A 3ZEHA 2ZPFB 4EMGA 4AFQC 2VGNA 2L2PA 3EFSA 5DLQE 5KCOA 1OZ2A 5CO7A 4J9HA 2CS7A 5FU6B 1VYVA 4M75A 3CCLT 3JCMg 3DLLA 1VQ6T 1KQ2A 1YIJA 1QLYA 2VGMA 2YRDA 4F14A 1D3BB 2CZ7B 2QQBA 2C0OA 1Q95G 3FC3A 1Q82R 4F17A 2Y4XA 3TQ7P 1Q7YC 3V8JA 4MDWA 2RO0A 1WHGA 2BZXA 2QQAA 2X4XA 1YI2A 3D7SB 3VUBA 4J9EA 5GANj 2KRMA 3M54A 4M4ZA 4RKUE 1YBYA 4ZGJB 1VQLQ 3RKXA 3VRZA 1YNZA 1D0XA 3RKWA 3CC2Q 1VQOQ 1Q81C 3WXMB 2FYKA 4A53A 3M9QA 3GP8A 1Y71A 5KE3A 2RJCA 1AHJB 4EMHA 3J81E 2CUDA 3HRTA 4ZGDB 3OS2A 4JPBW 4M7AB 3GLXA 1NBEB 3LW5E 3MKDA 2FZGB 3NTIA 3OW2S 1M30A 3CC7T 4QKUA 1QVGP 4ORZA 1OX8A 1U3OA 4NS5A 3HL8A 2KGTA 2P4RA 4R0KA 3EFOB 3LYIA 4DBQA 2HAXA 5GMKm 3OSSC 3MP1A 3VS0A 2PUOB 2K3BA 2KXCA 3JCMQ 1G3TA 3HRSA 1D1AA 4J6XA 1BCMA 2E12A 3AHUA 2RHZA 1WFWA 4PJOB 2EGCA 3QYGB 4N4GA 2ZPIB 5EC7A 4M78E 3OA6A 4CI0C 1ZQ1A 5FU7C 1R77A 3TREA 3VS7A 1G3WA 4QVDA 1HXDA 4P5NA 3UWNA 1SKUB 3LGLA 4C0ZA 1H92A 3I55T 2D0NA 3PTAA 1VQPQ 2EJGA 4QQ6A 5LJ5j 3NTHA 2KYMA 2VWFA 1K9MU 2CGHA 4PJNA 1M90U 1Y96B 4ZTFA 3HRUA 4RUGA 4N0AC 4WTOB 4K11A 4BDYA 3L2UA 3CC4T 2YDLA 1EFNA 1YWOA 1MV0B 4LN2A 1K73R 2HNIA 1E6HA 1VQ5A 3H0HA 2Z0WA 3LGFA 2DTHA 1N9RA 4PJLA 1VQ4T 2FB7A 1KD1U 2EYZA 3KFVA 2V8IA 3JCMh 2ABLA 4ZGEB 1NJIU 4J5YA 2O01E 1QKWA 2QK0A 4BUGA 1XNIA 3L2WA 4A63B 1YIJQ 1R8OB 2LQWA 4DBRA 4Z89A 9ATCB 4A4EA 1WI7A 3MEVA 1MMGA 3I5RA 5KYYB 3VS6A 3EGDB 2ZPHB 4HT8A 2EW3A 4C92D 3VS2A 3O5ZA 2XMFA 1RADB 3RKYA 4VUBA 4C0FA 1SHFA 4A4GA 1N8RU 4F16A 4OMQA 4C92G 1YI2Q 4C92C 1X2KA 3CMAA 1PC0A 1X43A 4RG2A 2PVDB 3CCEA 2JXBA 2QG9B 1I1JA 1PWTA 3V8KA 2A3LA 3VS1A 8AT1B 4FSSA 3RR6A 1YITT 3QBYA 4B9WA 3A8OB 2YRVA 4YTLA 3S3OA 2JMCA 2RB6A 3PVQA 5HKCA 1NPPA 4CC2A 5KCHA 3C12A 2O4XB 2HL3A 2DIQA 1N6AA 2M16A 4C8QB 4EMKC 1W2BP 2LX7A 2YWWA 2JS2A 2EBPA 3CCMT 2YT6A 5CAIA 3M53A 2DO3A 3CCUA 4N4IA 1K0SA 3ZFJA 3EG9A 2QA4T 1N5ZA 1TS9A 2QASA 2V8KA 5L8RE 3QJYA 3S6WA 1KHCA 1OOTA 1JEGA 1GL5A 1YHQA 2KT8A 1LCKA 1VA7A 2CP7A 2RJFA 5CK9A 2EKOA 1VQ9T 1KK7A 2YRCA 3OYKA 3OYIA 1BIBA 2GGRA 3V8LA 2O2OA 2DETA 1VQKA 2JM8A 4E7LA 2HSPA 2YXYA 2CT3A 2EIFA 3NHNA 1PD1A 2DFUA 1R0CB 2P4TA 3CCSQ 2NLUA 4R55A 2L5QA 2QTXA 4ZN3A 4WF2A 2W10A 2A28A 5HCKA 1H3HA 4X1VA 4JUVA 1VQ5Q 3QZ9B 4OB0B 1WXBA 1D1BA 1QVGA 2NUTA 2F2WA 2KQWA 1NEGA 2WSFE 1RI0A 1KQSS 2HSEB 3VKIA 1UGRB 1M3CA 3CCRA 2RQWA 2F2VA 1D0YA 1MMDA 1PHTA 1M2VA 2M0YA 3NFCA 3SEMA 3P8HA 4GY5A 2JVVA 1X6GA 2M51A 1VQNA 2OTJA 3CBOA 1YJ9Q 2J05A 3IQLA 4JDSA 1CSKA 1JQQA 4AG2C 2ZPGB 2COZA 2OTLA 2ECZA 5GAN3 3CXCS 2LRQA 5KH6A 5CCAA 3OS5A 3JB9H 1K73U 1B3QA 5FLXE 3CCLA 1TG0A 3EGXA 4FT2A 4BI8B 1ZSZB 5AYFA 3V7CA 5A0DA 3L2RA 3CD6A 5DM7R 3CMAQ 1YFNA 4BI4A 1YP5A 2EQIA 4ZNXA 3CCEQ 3J80E 1M27C 2F69A 1S72A 1FMWA 3EG0A 2GTJA 3HPWA 4C8QE 4C92F 5GAN8 1N9SA 4MZPA 4AFZC 1N27A 5LJ5d 3ZL7C 2O88A 3QJ6A 3OSVA 2COWA 1Q82C 3CPWS 2OJ2A 4LE9A 5ECAA 4FW1A 2DAQA 1I81A 4M7DB 2MMPA 3HSBA 5HK3A 4BDZA 3QWYA 1QKXA 5GAOq 4KT0E 3CCUQ 5IAYA 4BE0A 3GNGA 3LX7A 4ZTJA 4EDUA 4JJBA 2KK4A 5HY6A 1W1FA 1T3LA 4F7UB 3REAB 5C0MA 3QZ5B 1D1CA 5L23A 1BI0A 3QWXX 4J6WA 3QHSA 1C6VX 4OMPA 3M0UA 1YHQQ 4M77E 4OP0A 1V1CA 5J3BA 2H3EB 2JJ9A 2O9SA 1BBZA 1VQ8A 4HCKA 1VQKQ 1IGQA 3PNWC 2DILA 4EMKA 4M7AD 2NUPA 1VQ7A 3X26B 3CCJA 3EAEA 3X24B 1OYXA 3MEAA 3A8MB 1SG5A 4OGEA 1E6GA 8ATCB 4V2SA 1ZBXA 4M7AG 4M7AC 3JCMX 5CKFA 4AG1C 1NEBA 3TU4K 2RQVA 1QVFA 1BI2A 1WJQA 2CYZB 3OYNA 1WJSA 2RI5A 1AZEA 3G6EA 4PJOD 1TH7A 2CZ1B 3BW1A 5GMKh 1K9MR 1M90R 5EG2A 2D6FA 2OX7A 3OY9A 1WX6A 1OPKA 2D8JA 2CP6A 3QXEB 1U06A 1VQNQ 2OTJQ
chains in the Genus database with same CATH topology
2XDDA 1W2BS 4EMHA 3J81E 2Y90A 4BACA 3CCST 1VQ6A 4N4HA 5GAN4 2R58A 1UGPB 2EQKA 3HRTA 4ZGDB 3OS2A 3OYYA 2KAFA 5CKDA 3SWNB 4M7AB 3GLXA 3V7SA 4RCCA 4A54A 3LW5E 2KDSA 4C0DC 2DK3A 3CBMA 4FIBA 1U8RA 3OW2S 3NTIA 4C8QF 2ZZDA 1VQMA 1Q86C 3CC7T 3M56A 5GMKi 4M7AE 2XKOC 4BD3A 1KG1A 5IN1A 4NS5A 3JCMJ 1FWZA 3HL8A 1LOJA 3T9NA 3OYHA 2P0KA 1VQ5T 1KQ1A 5I2MA 4F7UG 3LYIA 1O9SA 3G4SA 4II1A 5FU6C 3V7RA 5GANe 5HK0A 1U1TA 5LJ3e 2HAXA 4XAXB 1YJNT 5GMKm 5LJ3g 2LT1A 4BY6B 3OSSC 3MP1A 4XTZA 3BFMA 5CQYA 4BB7A 1VUBA 2PUOB 2EQMA 3C94A 3A8HB 4QQDA 2RK2A 3CEYA 3JCMQ 4L6V5 1Q82U 3RESA 1G3TA 3M58A 3DB4A 3GIBA 3HRSA 4M7DF 3JSCA 2M0OA 5GAMe 2O4XA 3M57A 3GNFB 4J6XA 4HT9A 1EIFA 2E12A 2KSSA 5GAMg 3AHUA 4C8QA 4L5GA 3F70A 2RHZA 4JS5A 1UEBA 4M78B 2RD1A 4PJOB 4X34A 1YJ9T 1KHIA 3QYGB 2QDYB 4E7IA 4N4GA 3OYMA 2ZPIB 2XG8D 3L2QA 2BIVA 4M78E 5GAN2 2DTOA 4C92A 1WQ7A 1ZQ1A 2HQXA 5FU7C 1QVPA 5LJ3f 3ASKA 4L59A 3TREA 4C0DB 2K3XA 4JRPA 2QI2A 1G3WA 4DA4A 4QVDA 1M1KC 1VIFA 1HXDA 4A4FA 4P5NA 3UWNA 3LGLA 4C0ZA 3I55T 4IKFA 1YJWT 3PTAA 4E7HA 2VXFA 2EJGA 4QQ6A 5LJ5j 4M77F 4M75B 5J39A 2DIGA 1K8AC 2WSEE 3NTHA 5GAMf 4M7DA 3JCMP 1K9MU 2CZ6B 2QQ9A 2WACA 2CGHA 3QSUA 2RI2A 4X9DA 1M90U 1Y96B 4F7UE 4XU3A 4ZTFA 3HRUA 3PT9A 4C0GA 4XK8E 3CC7A 3CCVT 2HD0A 3J7AF 4N0AC 4LD6A 4BDYA 3L2UA 1NZ9A 3FDRA 3CC4T 1YITA 3E9FA 4PLIA 2K3YA 3CMAT 4EMKB 3X25B 2HNIA 4GLKA 1H3ZA 1MGQA 1VQ5A 2LNVA 2VC8A 4RG8A 3CCET 2GFUA 2R5AA 5I2SA 3MHXA 4IUUA 3L2ZA 2PQWA 2K4YA 1YJNA 4Y91A 3LGFA 2DTHA 1KQSA 1N9RA 1M4ZA 1YCYA 2EQJA 4HA8A 4E7KA 1VQ4T 4M77A 2FB7A 3S3NA 4ELYC 1KC8C 4IURA 1KD1U 4MZMA 4HCBA 3H8ZA 4E7JA 4IUVA 5J26A 5LL6S 2V8IA 3JCMh 1B34A 1NE8A 2R57A 4XTUA 4ZGEB 2RHIA 4JRIA 2RM4A 3QG1A 1NJIU 4DQ2A 4J5YA 2O01E 4FSXA 1Q7YU 1ZHIA 5LJ5e 4BUGA 3BDUA 2XD0A 1XNIA 3L2WA 4IUTA 2GFAA 4FT4A 4PL6A 1R8OB 1WJRA 2E6NA 3QPHA 3A8LB 2DZCA 2XHCA 3QUIA 4A4EA 5GAOr 3MEUA 3MEVA 3PIOA 4HCZA 1BIAA 3HKSA 5CR2A 3I55A 3CXCA 4BY6C 3MO8A 3OBWA 4KUIA 2P0PA 2DKGA 3CCUT 1BI1A 3PGGA 4FU6A 3OYEA 2ZPHB 4HT8A 2K57A 1WGSA 5CIUA 3QKJA 4C92D 4OGCA 2MWOA 5D6YA 3MP8A 3RKYA 3E1SA 2PU9B 2WSCE 4VUBA 4C0FA 4EPCA 5CKHA 4A4GA 2E10A 3KUFA 3L42A 1VQ9A 2RJDA 3QYHB 1N8RU 2CKKA 1WPYA 2Y4YA 3CCVA 4OB1B 4PJOG 3RMQA 4PJOC 5DY9A 4C92G 1OZ3A 2QXFA 3META 2VXEA 5CKEA 2G3RA 4C92C 1YHQT 3CC4A 3CMAA 4M75D 4XU1A 4M7AF 4PLLA 4RG2A 2PVDB 3OMCA 3CCEA 5A0GA 3E19A 2LDMA 3V8KA 1M1GA 2F5TX 2A3LA 2LC4A 4JLGA 3OQ5A 3JCMd 1VQKT 1K73C 1VQ4A 1YITT 2LT4A 3QBYA 4B9WA 2DZ9A 2YRVA 3A8OB 2XI9A 4M75G 4YTLA 4M75C 1Y07A 3S3OA 2PUKB 2DEQA 3NTKA 2D9TA 3RERA 3GPLA 2RB6A 1PSEA 3OS1A 2MAMA 5HKCA 5GANg 5IT9E 1NPPA 2KVQG 3PIPA 3OYAA 5KCHA 3C12A 3CPWA 4XU2A 1JRIA 3OMGA 2RA2A 3SB2A 2O4XB 1LJOA 4MDXA 2DIQA 1N6AA 2M16A 4C8QB 2DJZA 3GOXA 4EMKC 5GAOl 5GAOp 1BKBA 4M78F 2HBPA 4QQGA 1M5Q1 3KBGA 3CCMT 5CKBA 5CAIA 3M55A 2X4WA 3M53A 2DO3A 3MEWA 4C92B 3I56T 3CCUA 4OB3B 1Y7XA 2E5QA 1QP3A 4N4IA 3RIRA 5LJ3h 3ZFJA 2RI3A 2QA4T 5GANf 3OYFA 1UGSB 4C92E 3SFMA 2IG0A 3TCJA 4Z02A 2V8KA 1VQLT 5L8RE 3QJYA 2X4YA 1M1KU 4RCBA 4XU0A 2I2LA 2JTFA 2GF7A 2QQRA 3CC2T 3ZBDA 1VQOT 3S6WA 2E1HA 1KHCA 2E6ZA 2YLBA 3X28B 4F7UF 4DOWA 5GAMh 2EQUA 1P92A 1XOVA 2K2VA 2D0QB 1YHQA 1GXIE 5CVIA 1K8AU 2BKDN 2RJFA 3CMEA 4JLIA 3SDZA 1JBMA 3FRNA 2DTIA 3WVDB 2KY9A 2EKOA 4M75E 5CK9A 3CBPA 1VQ9T 1VQNT 2OTJT 2CZ0B 1G5VA 3OYKA 3OYIA 1MHNA 3JB9D 3JRZA 1BIBA 2FL7A 3V8LA 1UGQB 1G3SA 2LQKA 3FIFA 4ME7A 2C06A 1VQKA 3UPUA 2OTLT 3X20B 4E7LA 2RHYA 2LQ8A 1VIEA 3QO3A 5GMKj 2EIFA 2XDPA 2QEXT 2RH2A 1W4SA 3M4YA 3QDRB 3L2VA 3E9GA 3JB9G 3JCMV 4HCCA 2MI6A 3DKMA 1LNXA 4QVCA 2E70A 2YLCA 2DPPB 2DXCA 2P4TA 4F7UA 3LWHA 2NLUA 1B34B 2P0QA 5FRMA 1JB0E 1V29B 4R55A 3TEEA 4ATOA 1X6OA 3OA6A 2L5QA 1KC8U 2QTXA 5FRNA 4ZN3A 3UT1A 5KE2A 1SSFA 4WF2A 4ZN1A 5M9OA 3LLRA 5LJ3d 4LDXA 2ZPEB 4KULA 4A4HA 2M1HA 4RMOA 3G71T 3CCMA 3CD6T 4JUVA 5C6SA 2L8DA 1WNLA 3I56A 2ZGWA 2JOYA 5LJ5g 2LCCA 2EWNA 3ME9A 3QZ9B 4OB0B 4MZTA 1QVGA 1PSFA 4JJNK 1JJ2A 2QA4A 1XTDA 2ZCFB 1S72T 2KQWA 1KQSS 2WSFE 1RI0A 1H641 4LDVA 4C8QD 3VKIA 5GAMd 1UGRB 2JTMA 1D3BA 3CCRA 1VQLA 5D6XA 2L3RA 2GQVA 3OBYA 3VYHB 4XQ3A 3CC2A 4LDYA 1VQOA 1I5LA 2ZPBB 3INZA 4NOYA 3FJPA 3JCMW 1OI1A 3NFCA 5GMKe 2XU8A 1X75C 3M4GA 3FEOA 4TVRA 4JRQA 4UC4A 3P8HA 4C8QG 1Q81U 2K5LA 4GY5A 2LCLA 4C8QC 3WVEB 2JVVA 5LJ5h 4OVAA 2JUFA 2EAYA 4XTWA 4A4KA 3EFRA 1VQNA 1QVFS 2JN0A 2EYQA 3BDLA 2E41A 3JCMc 3CBOA 5LJ5f 2XDBA 1WQWA 3R6OA 1W2BA 4Y28E 2DD5A 3OYJA 1FX7A 2VYTA 3DB3A 4JDSA 5LJ3j 3CCQT 5D6WA 2ZPGB 2X4JA 4M7DD 3CMET 2OTLA 5GAN3 3OW2A 3LWIA 2B8AA 2JZ2A 2FVUA 3CXCS 2LRQA 2QEXA 1M1FA 3MP6A 5KH6A 4J7IA 2AHJB 1QW1A 5A0LA 3JB9J 2E65A 4ELZC 5DLOA 1Q86U 5CCAA 3OYBA 4Q5WA 4C5EA 5GAMj 3OS5A 4CRIA 4O6JA 1K73U 3JB9H 4M7DG 4M7DC 5FLXE 3CCLA 4NL3A 4OMFB 2JNGA 5GAN6 2XICA 4FT2A 4J7FA 2EJFA 4BI8B 3N5BB 2GCXA 5AYFA 2H3JA 3V7CA 3HHTB 5A0DA 4OB2B 1RL2A 2PVOB 3L2RA 2M9UA 4M77D 4XTXA 3G71A 3CD6A 5DM7R 4FM4B 2A7YA 2K5FA 3O8VA 4BI4A 3SWNA 4M7AA 4KBMB 4BI3A 3J80E 2VUBA 5GAOm 3FLGA 1VQPT 3LH0A 2OTJA 2MF2A 4LDUA 3S3MA 2F69A 1S72A 2DXBA 4O5VA 2LVMA 1VQ8T 1FXXA 1NPRA 2F5KA 4PJOF 4C5IA 3HPWA 4C8QE 2EFIA 4C92F 5GAN8 1N9SA 4M77G 3ER0A 4M77C 1YIJT 4MZPA 4IUPA 1VQ7T 1N27A 3CCJT 1BI3A 5LJ5d 4MMLA 5GANh 3M5AA 3FB9A 5GMKl 2LTOA 3QJ6A 3OSVA 4PKCC 3URGA 1BYMA 3BY7A 2KMTA 3OB9A 4JS4A 1Q82C 3CPWS 3CCRT 1VQPA 4R56A 3PMIA 4J8OA 2MWPA 2YHTA 1UB4A 3OYCA 1U1SA 4M75F 3VV0A 2DAQA 1I81A 4M7DB 3P8BB 3A5ZB 2MMPA 5GAN5 5FROA 3CCQA 3HSBA 4B9XA 5HK3A 3JB9I 4BDZA 3KXTA 2DVEA 3H6ZA 1DJ7B 4DOVA 4M7DE 4C5GA 5GAOq 3JAME 2DXUA 3VJPA 1I8FA 4M78A 4KT0E 3VU3C 4PJOA 1YI2T 4IUQA 1XQHA 3C95A 1IZ6A 5IAYA 3VYGA 1M9SA 2V8JA 3ZEHA 3DLMA 4BE0A 2ZPFB 4EMGA 3GNGA 3UDCA 3MCAB 3VUZA 3LX7A 4ZTJA 2VGNA 1YJWA 4EDUA 3EFSA 2RK1A 4JRKA 4J6YA 1X01A 2KK4A 2BUDA 2RHXA 4FL6A 5DLQE 5HY6A 4XTYA 5KCOA 5GAN7 3G6ET 3HP9A 1OZ2A 2K5IA 5CO7A 4F7UB 3SD4A 3A8GB 2CS7A 4M77B 3QZ5B 5FU6B 2E64A 4XTVA 5C0MA 3CCSA 1K9MC 1BI0A 3GF5A 1M90C 4M75A 4J6WA 3QHSA 2DXTA 1M8VA 1HK9A 4M77E 3CCLT 3L1AA 4OP0A 4PNOA 3JCMe 5J3BA 1Y96A 2RHUA 3CPFA 3JCMg 3PFSA 4X9CA 3DLLA 2R5MA 1VQ6T 5GANd 1KQ2A 1VQ8A 5I21A 1YIJA 3PNWC 2VGMA 3HFOA 4J83A 3RMSA 4EMKA 2IVWA 4M7AD 1VQMT 2X35A 1VQ7A 3P8DA 3X26B 3CCJA 4PJOE 2OAUA 4HKEA 3EAEA 1D3BB 3OS0A 3X24B 1OYXA 3PMTA 4QVZA 2CZ7B 1QP2A 2QQBA 5A2QE 3MEAA 3A8MB 3G7ZA 5FU7B 1KD1C 4LD9K 3OYDA 3RUXA 4MMKA 2FHDA 4OGEA 1G3YA 3FC3A 3G4ST 2RJEA 3JCMb 4V2SA 2L89A 4D6WA 4E47A 1ZBXA 4CI0C 3SWNC 1NJIC 4M7AG 4M7AC 3JCMX 3JCMf 1IREB 5CKFA 2Y4XA 4BE1A 4BE2A 1Q7YC 3HFNA 3V8JA 4MDWA 2RO0A 1I4K1 3TU4K 1QVFA 3JB9F 1YJ9A 1BI2A 2HQEA 4LDWA 1O75A 2QQAA 4NL2A 2X4XA 1WJQA 1YI2A 2CYZB 1QVGS 3VUBA 2DD4A 5GANj 3OYNA 1JJ2S 4KUDK 4QW2A 4C5HA 2XK0A 3M54A 4RKUE 1WJSA 1YBYA 2RI5A 3QIIA 4ZGJB 5GAOn 4M78D 3G6EA 4PJOD 1TH7A 3RKXA 4N0AA 2PVGB 3OYGA 3OYLA 3RKWA 2CZ1B 2EJ9A 3BW1A 2LX9A 3WXMB 3C4SA 1Q81C 2FYKA 5GMKh 2VV5A 4A53A 3M9QA 1N8RC 3Q1JA 3GP8A 2D6FA 1Y71A 5EG2A 5CQXA 4OF1A 5KE3A 3OY9A 2QQSA 3M59A 4M78G 3QXEB 4M78C 2RJCA 1AHJB 2XIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8L B;  1UGP B;  4ZGD B;  3LW5 E;  2ZZD A;  2DPP B;  2DXC A;  1JB0 E;  1V29 B;  2ZPH B;  1DJ7 B;  2PU9 B;  2WSC E;  4KT0 E;  3VYG A;  2ZPE B;  3QYH B;  2ZPF B;  2PUO B;  4OB1 B;  3A8H B;  3QZ9 B;  4OB0 B;  1PSF A;  4L6V 5;  2ZCF B;  2WSF E;  2PVD B;  3A8G B;  1UGR B;  3QZ5 B;  3VYH B;  2ZPB B;  3QYG B;  2QDY B;  3A8O B;  2PUK B;  2ZPI B;  3WVE B;  1PSE A;  4Y28 E;  2DD5 A;  3X26 B;  2ZPG B;  3X24 B;  2CZ7 B;  1QP2 A;  2WSE E;  3A8M B;  2CZ6 B;  2AHJ B;  1IRE B;  4XK8 E;  4OB3 B;  1QP3 A;  3X25 B;  1UGS B;  5L8R E;  3HHT B;  2CYZ B;  4OB2 B;  2PVO B;  2DD4 A;  4FM4 B;  3X28 B;  4RKU E;  4ZGJ B;  2D0Q B;  1GXI E;  2PVG B;  2DXB A;  3WVD B;  2CZ1 B;  2CZ0 B;  4ZGE B;  1UGQ B;  2O01 E;  3QXE B;  3X20 B;  1AHJ B; 
#chains in the Genus database with same CATH topology
 1W2B S;  1T0H A;  2R58 A;  2EQK A;  2KAF A;  2A0F B;  3SWN B;  1IO6 A;  2KDS A;  2DK3 A;  2OTL Q;  1VQM A;  1UJ0 A;  1UDL A;  5GMK i;  1VOM A;  1RLP C;  1HSQ A;  1LOJ A;  3T9N A;  2LMJ A;  1I0C A;  1KD1 R;  2IIM A;  3G4S A;  1KC8 R;  3V7R A;  5GAN e;  5HK0 A;  1YJN T;  4J9I A;  4XTZ A;  1NJI R;  1VUB A;  2EQM A;  4QQD A;  3CD6 Q;  2CH4 A;  1MMA A;  3GNF B;  1ZUU A;  2KSS A;  3M0S A;  4RTW A;  4L5G A;  1UEB A;  4M78 B;  2RD1 A;  2YUO A;  1S72 Q;  2BIV A;  2EYY A;  1T3S A;  4HXJ A;  5LJ3 f;  4C0D B;  4L59 A;  1WXU A;  5KYX A;  4A4F A;  4IKF A;  1YJW T;  2LQN A;  1N8R R;  1HD3 A;  4M75 B;  4HVV A;  3A98 A;  1RAA B;  1TU0 B;  2HBW A;  1FYN A;  5GAM f;  2KRN A;  4X9D A;  2BZ8 A;  4F7U E;  2DVJ A;  3CME Q;  3PT9 A;  1XJW B;  4XK8 E;  5D7U A;  3CCV T;  2HD0 A;  1GBR A;  3H41 A;  4LD6 A;  1Q86 R;  3FDR A;  1YIT A;  3E9F A;  3SHW A;  1MGQ A;  2GFU A;  2R5A A;  5I2S A;  4LXC A;  2CP3 A;  3L2Z A;  1MUZ A;  2BTT A;  1GCP A;  2J06 A;  4HA8 A;  3NPF A;  4HCB A;  4IUV A;  5J26 A;  2DJQ A;  1B34 A;  2V1R A;  1NE8 A;  2DYB A;  2HQH A;  2R57 A;  4XTU A;  7AT1 B;  3QG1 A;  4DQ2 A;  1WHK A;  1ZHI A;  5LJ5 e;  3VRY A;  1VQ8 Q;  4GLM A;  4PL6 A;  2CRE A;  1WJR A;  1TSF A;  1VQ7 Q;  3CCJ Q;  1WHM A;  1BIA A;  4BY6 C;  5GJW B;  3G1J A;  1WGS A;  5CIU A;  3QKJ A;  5FWC A;  2DBK A;  2MWO A;  3E1S A;  4EPC A;  2E10 A;  2V26 A;  1VQ9 A;  3QYH B;  2F1L A;  1WPY A;  1PD0 A;  2G6F X;  5DY9 A;  2QXF A;  3MET A;  5CKE A;  4M7A F;  4XU1 A;  2QDL A;  3EG2 A;  2ESW A;  5A0G A;  2LC4 A;  2QTV A;  3G6E Q;  2RMO A;  4AT1 B;  1RI9 A;  1Y07 A;  2FZK B;  3RER A;  1PSE A;  5IXF A;  5IHN A;  2KVQ G;  1ABQ A;  4XU2 A;  1TOV A;  3SB2 A;  1LPL A;  4MDX A;  1BCO A;  2CSQ A;  1YCS B;  5GAO l;  1TTH B;  1VQM Q;  2CSI A;  2RQU A;  1GRI A;  1AWJ A;  2L3S A;  4HVU A;  1Y7X A;  2E5Q A;  1QP3 A;  3RIR A;  3G4S Q;  2RI3 A;  5GAN f;  1G2B A;  1VQL T;  1M1K U;  2AZS A;  2GF7 A;  2JTF A;  3CC2 T;  1VQO T;  2E1H A;  2DLP A;  2YLB A;  2ROL A;  4DOW A;  2K2V A;  1P92 A;  2DRK A;  2HL5 C;  1K8A U;  4JLI A;  2PNI A;  3SDZ A;  2DTI A;  4M75 E;  1G5V A;  3JB9 D;  3JRZ A;  1WXT A;  1G3S A;  2LQK A;  3FIF A;  3UPU A;  1OPL A;  4IIM A;  1VIE A;  2XDP A;  2VVK A;  3M4Y A;  3L2V A;  3JB9 G;  1UG1 A;  1F1B B;  2EYX A;  1LNX A;  2KI7 A;  2E70 A;  2MI6 A;  2LZ6 B;  1IRX A;  2YLC A;  3DKM A;  4QVC A;  2DMO A;  1D09 B;  3EGU A;  5FRM A;  1ABO A;  4ATO A;  1KC8 U;  3UT1 A;  2J6O A;  4ZN1 A;  5M9O A;  5LJ3 d;  4LDX A;  1ZLM A;  1WNL A;  3I56 A;  2LCC A;  1JJ2 A;  1PCX A;  1SHG A;  5GAM d;  2JTM A;  1ZSZ C;  2DX1 A;  2GQV A;  1GFD A;  4LDY A;  2ZPB B;  3TSZ A;  3INZ A;  3JCM W;  1X75 C;  4TVR A;  3FEO A;  1D0Z A;  1UHC A;  4UC4 A;  1VQP T;  2LCL A;  3WVE B;  2EGA A;  1CKA A;  4CC4 B;  1G83 A;  2JN0 A;  2XDB A;  5LJ5 f;  2DD5 A;  4Y92 A;  2X4J A;  4M7D D;  2ENM A;  4FCY A;  3LWI A;  2QGF B;  2D8H A;  2QEX A;  1M1F A;  3JB9 J;  1IXD A;  4J7I A;  2AHJ B;  4ELZ C;  5DLO A;  1Q86 U;  3M0T A;  3OYB A;  1WYX A;  4M7D G;  4M7D C;  2DEU A;  2L0A A;  3N5B B;  2HKQ B;  2GBQ A;  2GCX A;  1JU5 C;  2PVO B;  3PE0 A;  3G71 A;  1UGV A;  1QVF P;  1KFZ A;  4KBM B;  1Z9Q A;  4BI3 A;  5GAO m;  3FLG A;  2E3H A;  4LDU A;  2DXB A;  4O5V A;  2LVM A;  1FXX A;  4C5I A;  2EFI A;  1YIJ T;  1C0M A;  3EG9 B;  1BI3 A;  3JV3 A;  4MML A;  3NMZ C;  3URG A;  4OML A;  1T0J A;  1WZO A;  4JS4 A;  2MWP A;  3OYC A;  1U1S A;  3VV0 A;  3P8B B;  3A5Z B;  3R6N A;  4CC7 A;  3CCQ A;  2OAW A;  3I35 A;  3KXT A;  4KRT A;  2FPD A;  3JAM E;  1PG5 B;  1I8F A;  3VU3 C;  3FJ5 A;  1YI2 T;  1XQH A;  3DLM A;  1NG2 A;  3VUZ A;  1C1A A;  4FYW B;  4JRK A;  5GAN 7;  2RHX A;  1PM3 A;  4DEY A;  3HP9 A;  1K9M C;  4M77 B;  2E64 A;  2FG0 A;  4XTV A;  3EG1 A;  1M90 C;  4LNP A;  1HK9 A;  1K9A A;  3L1A A;  2RHU A;  3CPF A;  2R5M A;  5GAN d;  4HVW A;  3RDV A;  4OMO A;  2NUT B;  2K7A A;  3RMS A;  2IVW A;  2OAU A;  4QVZ A;  1TUD A;  5A2Q E;  1QP2 A;  1KD1 C;  4CC3 A;  4LD9 K;  5FU7 B;  1M2V B;  5KYW A;  4MMK A;  2RJE A;  3JCM b;  4D6W A;  2AKK A;  4J9B A;  1NJI C;  3SWN C;  2LP5 A;  1IRE B;  3JCM f;  4BE1 A;  3RNJ A;  4BE2 A;  3HFN A;  2X3X D;  1NLP C;  3JB9 F;  3TVT A;  1R0B G;  1SPK A;  4D8D A;  1O75 A;  1YWP A;  1IHV A;  1QCN A;  3I56 Q;  1QVG S;  4KUD K;  2QYZ A;  4QW2 A;  2XK0 A;  3QII A;  4EIK A;  2K9G A;  4M78 D;  5GAO n;  4N0A A;  2PVG B;  1AWX A;  3OYG A;  5IHK A;  2EJ9 A;  2LX9 A;  3C4S A;  1N8R C;  3EGX B;  3Q1J A;  2CP5 A;  3M59 A;  4M78 G;  1RAB B;  4M78 C;  2XDD A;  4KH1 B;  4BAC A;  1VQ6 A;  3CCS T;  4DBH A;  5GAN 4;  1QWF A;  5CKD A;  3V7S A;  4C0D C;  2FPF A;  1U8R A;  1G8X A;  2ZZD A;  1Q86 C;  1KG1 A;  5IN1 A;  2QEX Q;  3JCM J;  1FWZ A;  4ANJ A;  2P0K A;  1VQ5 T;  1KQ1 A;  1O9S A;  5FU6 C;  3U23 A;  5LJ3 e;  1SRM A;  4XAX B;  4BB7 A;  5CQY A;  3CEY A;  3M0P A;  4L6V 5;  3DB4 A;  3G71 Q;  1MNE A;  3GIB A;  1WA7 A;  4M7D F;  4PJJ A;  2M0O A;  2NUZ A;  5GAM e;  1VYT A;  4HT9 A;  3F70 A;  4JS5 A;  1ZUK A;  1B07 A;  2GTO A;  1YJ9 T;  3OW2 P;  3OYM A;  3L2Q A;  2XG8 D;  4PFZ A;  2DTO A;  4C92 A;  1QVP A;  2AT1 B;  2K3X A;  2QI2 A;  4DA4 A;  1VIF A;  2DIG A;  1QCF A;  2NWM A;  4M7D A;  2CZ6 B;  2QQ9 A;  2WAC A;  3CCQ Q;  3QSU A;  2B86 A;  4C0G A;  4RTT A;  3CC7 A;  1NZ9 A;  3CMA T;  4EMK B;  2NUP B;  1H3Z A;  2LNV A;  3CCE T;  4RG8 A;  4IUU A;  2DA9 A;  2A36 A;  2PQW A;  2K4Y A;  2X9H A;  2MPX C;  1ACM B;  2EKH A;  4ELY C;  1ARK A;  4IUR A;  1UTI A;  4E7J A;  5LL6 S;  2A08 A;  2QGG A;  1NLO C;  2RNA A;  2RHI A;  4JRI A;  4FSX A;  2AZV A;  1Q7Y U;  2YSQ A;  2CUB A;  2XD0 A;  2DF6 A;  3HTR A;  4IUT A;  2E6N A;  2DZC A;  2XHC A;  3MEU A;  3PIO A;  2GNC A;  2P84 A;  1I07 A;  2KNB B;  5CR2 A;  1M1K R;  3I55 A;  3MO8 A;  3OBW A;  3CCU T;  1BI1 A;  3PGG A;  1X69 A;  4FU6 A;  3CCR Q;  3OYE A;  1H8K A;  1AEY A;  2FEI A;  5D6Y A;  1K8A R;  4F04 B;  3EH1 A;  3KUF A;  2RJD A;  2CKK A;  6AT1 B;  2CP0 A;  1VYU A;  4OB1 B;  4PJO G;  4PJO C;  2O9V A;  1YHQ T;  2VXE A;  3CC4 A;  2HEQ A;  2V1Q A;  4DEX A;  3E19 A;  2SRC A;  1M1G A;  2HZY A;  4RTX A;  1JJ2 P;  3OQ5 A;  3JCM d;  1VQK T;  1K73 C;  1VQ4 A;  2DZ9 A;  4QT7 A;  2XI9 A;  1IHW A;  3CCL Q;  3OS1 A;  2MAM A;  5IT9 E;  3PIP A;  1SEM A;  1VQ6 Q;  1S1N A;  3OMG A;  1QQJ A;  2VB6 A;  2JTE A;  2KE9 A;  2C0I A;  2DJZ A;  3GOX A;  3I5S A;  5GAO p;  1BKB A;  4M78 F;  2HBP A;  1M5Q 1;  5KYU A;  5CKB A;  5FWB A;  3M55 A;  2X4W A;  3MEW A;  5FW9 A;  1AVZ C;  2MIO A;  2FZC B;  4C92 E;  3TCJ A;  1GFC A;  4Z02 A;  1RAF B;  2QQR A;  1PNJ A;  1IB8 A;  3ZBD A;  2E6Z A;  3X28 B;  2FO0 A;  4PK4 A;  1YN8 A;  4FYV B;  2EQU A;  1XOV A;  3QDF A;  1GXI E;  5CVI A;  2KY9 A;  5I22 A;  1VQN T;  2OTJ T;  1MHN A;  2LJ1 A;  2OTL T;  3X20 B;  1OU8 A;  2RHY A;  4Z8A A;  5GMK j;  4PFP A;  2YUQ A;  2F2X A;  4HCC A;  3E9G A;  2FPE A;  3JCM V;  3LWH A;  2DPP B;  1B34 B;  2P0Q A;  2DL7 A;  2HDA A;  1SSF A;  2J7I A;  3CC7 Q;  4KUL A;  2ED1 A;  4JZ3 A;  4A4H A;  4RMO A;  3CD6 T;  3CCM A;  5C6S A;  2ZGW A;  2JOY A;  3ME9 A;  1E7O A;  1PSF A;  2QA4 A;  1XTD A;  2ZCF B;  1S72 T;  4RTZ A;  4C8Q D;  1D3B A;  2JW4 A;  3RBB B;  4XQ3 A;  1NYF A;  2E3I A;  1I5L A;  1GBQ A;  4NOY A;  3FJP A;  3M4G A;  1RLQ C;  4C8Q G;  4D8K A;  4C8Q C;  4JRP A;  5LJ5 h;  4KGZ B;  2EAY A;  3EFR A;  2EYQ A;  3JCM c;  3R6O A;  2HCK A;  3OYJ A;  1FX7 A;  2VYT A;  3DB3 A;  2KBT A;  2AKL A;  1M8M A;  3CME T;  3OW2 A;  2B8A A;  3I55 Q;  2EYW A;  1QW1 A;  2E65 A;  1KQS P;  4Q5W A;  4O6J A;  3EH2 A;  1WHJ A;  2JNG A;  1AOJ A;  1AZG B;  3REB B;  1RL2 A;  3UA7 A;  2M9U A;  4M77 D;  4XTX A;  3LH5 A;  3CC4 Q;  2CT4 A;  4FM4 B;  4JJC A;  2A7Y A;  2COY A;  2JM9 A;  3O8V A;  4M7A A;  1RUW A;  2LJ3 A;  2VUB A;  3LH0 A;  2MF2 A;  3S3M A;  1VQ8 T;  1NPR A;  4PJO F;  4J9F A;  1UHF A;  4M77 G;  1VQ4 Q;  3CXC P;  4M77 C;  4IUP A;  1VQ7 T;  3CCJ T;  3EFO A;  3FB9 A;  1K76 A;  3H0F A;  2E4H A;  3BY7 A;  2KMT A;  1TUG B;  3H9N A;  4RTY A;  1QMC A;  1M3B A;  1QWE A;  3H0I A;  5FRO A;  2MK5 A;  4B9X A;  3JB9 I;  4DOV A;  3VJP A;  4PJO A;  3BE3 A;  4AFS C;  1IZ6 A;  2V8J A;  3EHQ A;  5IH2 A;  2KXD A;  3UDC A;  3MCA B;  2RK1 A;  4J6Y A;  1X01 A;  2BUD A;  4FL6 A;  3G6E T;  1K1Z A;  4XTY A;  1RAG B;  1UE9 A;  2K5I A;  1QCO A;  2EGE A;  3SD4 A;  3A8G B;  3CCS A;  2X3W D;  3GBQ A;  3GF5 A;  1PRM C;  3CPW P;  2DXT A;  1M8V A;  2K2M A;  4PNO A;  3JCM e;  1KSW A;  1Y96 A;  5KYN A;  3PFS A;  4X9C A;  2DE0 X;  5IXB A;  2E5K A;  2DL5 A;  1Z9Z A;  5I21 A;  1YIT Q;  3HFO A;  2LNH B;  4J83 A;  3VS5 A;  1VQM T;  2X35 A;  3P8D A;  2AK5 A;  4FW2 A;  4HKE A;  1W70 A;  1X6B A;  2QAZ A;  3OS0 A;  2MOX A;  3PMT A;  2YUP A;  3UF4 A;  1WHL A;  3G7Z A;  1K0X A;  3OYD A;  3RUX A;  2FHD A;  1G3Y A;  3G4S T;  2L89 A;  1OV3 A;  4E47 A;  2DNU A;  2EPD A;  4E6R A;  1M2O A;  4LUD A;  1FMV A;  1OQK A;  4RTV A;  1TWB A;  1I4K 1;  1YJ9 A;  4LDW A;  2HQE A;  4NL2 A;  3CCM Q;  1Y57 A;  1Y0M A;  1I5O B;  2DD4 A;  1JJ2 S;  4E7S A;  4C5H A;  1PKS A;  2QA4 Q;  1OX9 A;  1UEC A;  5KYY A;  3OYL A;  3EGD A;  1J3T A;  2VV5 A;  3VS3 A;  1EZZ B;  1KJW A;  1OU9 A;  2CH4 W;  5CQX A;  4OF1 A;  1SSH A;  2QQS A;  1AWW A;  3OYH A;  4FYY B;  2ZPE B;  1VQ9 Q;  2XID A;  2Y90 A;  4J9G A;  4N4H A;  1UGP B;  2JS0 A;  2MYS A;  2CDT A;  3OYY A;  4RCC A;  4A54 A;  1WHH A;  2X51 A;  3CBM A;  4FIB A;  4C8Q F;  3M56 A;  4M7A E;  2XKO C;  4BD3 A;  1MV3 A;  2H8H A;  2I0N A;  5I2M A;  4F7U G;  4II1 A;  1U1T A;  2KEA A;  5LJ3 g;  2LT1 A;  4BY6 B;  2DER A;  1A0N B;  3BFM A;  2D1X A;  3C94 A;  3A8H B;  2RK2 A;  1Q7Y R;  2L3Q A;  1ZX6 A;  5AT1 B;  4Z88 A;  1Q82 U;  3RES A;  3M58 A;  2BE7 D;  3JSC A;  2FRW A;  2O4X A;  3M57 A;  1MND A;  4LUE A;  1EIF A;  5GAM g;  2M02 A;  1K4U S;  4C8Q A;  2FRY A;  4KGX B;  4X34 A;  2ATC B;  1KHI A;  4AFU C;  2QDY B;  4E7I A;  3MPU B;  5GAN 2;  4PJO E;  1WQ7 A;  2HQX A;  1BU1 A;  3ASK A;  1RAE B;  1KIK A;  1M1K C;  1Q81 R;  2IPO B;  4E7H A;  2VXF A;  2VKN A;  1MMN A;  4M77 F;  1UUE A;  5J39 A;  1K8A C;  2WSE E;  1OEB A;  3JCM P;  3ULR B;  2RI2 A;  4PFO A;  4XU3 A;  2EVR A;  4E2F B;  1BK2 A;  3J7A F;  2LJ0 A;  4PLI A;  2K3Y A;  4J9D A;  3X25 B;  1ZBJ A;  3A1P A;  4GLK A;  2VC8 A;  3MHX A;  1UFF A;  1YJN A;  4Y91 A;  3AT1 B;  1KQS A;  5KYW B;  1ZUY A;  1M4Z A;  1YCY A;  2EQJ A;  1SF9 A;  4E7K A;  2HMA A;  1CKB A;  4M77 A;  1TXQ A;  2DM1 A;  3S3N A;  1KC8 C;  2YUN A;  1NYG A;  2BE9 B;  4MZM A;  3H8Z A;  4PJM A;  2BZY A;  2RM4 A;  3I9Q A;  1AD5 A;  4JJD A;  3BDU A;  1WIE A;  2GFA A;  4FT4 A;  3QPH A;  3A8L B;  2DRM A;  1HYO A;  3QUI A;  5GAO r;  1OUL A;  4HCZ A;  2DYI A;  3HKS A;  4OMN A;  3CXC A;  1YJW A;  4KUI A;  2P0P A;  2DKG A;  4B6M A;  2DL4 A;  5GJV B;  2K57 A;  1TUC A;  4OGC A;  3C0C A;  2J6F A;  3MP8 A;  4IIO A;  2PU9 B;  2WSC E;  3TSW A;  2AIR B;  5CKH A;  1GCQ C;  3EG3 A;  2J6K A;  3L42 A;  2DL8 A;  3UAT A;  2DL3 A;  2Y4Y A;  3CCV A;  1HJD A;  1WLP B;  3RMQ A;  1OZ3 A;  2G3R A;  4M75 D;  4PLL A;  1SRL A;  3OMC A;  3EHR A;  2LDM A;  2F5T X;  1W6X A;  4JLG A;  2LT4 A;  1V76 A;  2K6D A;  4M75 G;  4M75 C;  2PUK B;  2DEQ A;  3NTK A;  2D9T A;  3GPL A;  5GAN g;  1B7T A;  3OYA A;  3THK A;  3M0R A;  3CPW A;  1ZSZ A;  1JRI A;  2RA2 A;  1LJO A;  2SEM A;  2A37 A;  4QQG A;  2KYB A;  2DBM A;  3KBG A;  4JZ4 A;  4C92 B;  3I56 T;  4OB3 B;  1EX4 A;  5LJ3 h;  3OYF A;  4RTU A;  1UGS B;  3SFM A;  2IG0 A;  1IGU A;  4FYX B;  1PRL C;  2X4Y A;  2VAS A;  4RCB A;  4XU0 A;  2I2L A;  2KR3 A;  4F7U F;  5GAM h;  1RAC B;  2D0Q B;  2BKD N;  3CME A;  1JBM A;  3FRN A;  3WVD B;  4KH0 B;  3CBP A;  2CZ0 B;  1PKT A;  4WCI A;  2FL7 A;  1U5S A;  1UGQ B;  4ME7 A;  3MJX A;  2C06 A;  2PTK A;  3M0Q A;  5I11 A;  2LQ8 A;  3QO3 A;  2JMA A;  2MCN A;  2QEX T;  2RH2 A;  1W4S A;  3QDR B;  2W0Z A;  4F7U A;  2DXC A;  1JB0 E;  1V29 B;  3TEE A;  2KRO A;  1X6O A;  5FRN A;  1X27 A;  3VS4 A;  2CP2 A;  5KE2 A;  2OI3 A;  1UJY A;  3LLR A;  2ZAE A;  2M1H A;  3G71 T;  2L8D A;  5LJ5 g;  2EWN A;  4MZT A;  4JJN K;  1ZA1 B;  1YJN Q;  1H64 1;  4LDV A;  2ROT A;  4OMM A;  1VQL A;  2RN8 A;  5D6X A;  1JXO A;  2KT1 A;  2NYS A;  3OBY A;  2L3R A;  3VYH B;  1WDX A;  3CC2 A;  2HKN A;  1VQO A;  2LCS A;  1OI1 A;  5GMK e;  2XU8 A;  1AWO A;  4JRQ A;  2RF0 A;  1Q81 U;  2K5L A;  3PVL A;  2K79 A;  4OVA A;  2JUF A;  4XTW A;  3CQT A;  4A4K A;  1QVF S;  3BDL A;  4E7Z A;  2E41 A;  1WQW A;  1W2B A;  1JO8 A;  4Y28 E;  5LJ3 j;  3CCQ T;  5D6W A;  1BB9 A;  4ESR A;  2O31 A;  3NGP A;  3E2U A;  2JZ2 A;  2FVU A;  1AT1 B;  2C0T A;  1YJW Q;  3MP6 A;  5A0L A;  1LVK A;  4C5E A;  5GAM j;  4CRI A;  2RQT A;  2ED0 A;  4NL3 A;  4OMF B;  5GAN 6;  2XIC A;  4J7F A;  1FMK A;  2EJF A;  2H3J A;  3HHT B;  1JXM A;  3CCV Q;  4OB2 B;  4GBQ A;  2K5F A;  3SWN A;  5KYU B;  2RQR A;  1NM7 A;  2JT4 A;  2F5K A;  3ER0 A;  2L3P A;  1X2Q A;  5GAN h;  3M5A A;  5KYX B;  2PZ1 A;  1RAH B;  1M3A A;  5GMK l;  5IHI A;  2LTO A;  4PKC C;  1BYM A;  3OB9 A;  3CCR T;  2GQI A;  1VQP A;  4R56 A;  3PMI A;  4J8O A;  2YHT A;  1UB4 A;  1ZA2 B;  4AMC A;  1RAI B;  4J9C A;  4M75 F;  5GAN 5;  1GCQ A;  2KRS A;  4DBF A;  2DVE A;  4KGV B;  3H6Z A;  1DJ7 B;  4M7D E;  4C5G A;  2DXU A;  4M78 A;  4IUQ A;  1ZSG A;  3C95 A;  2RPN A;  1M9S A;  3VYG A;  3UA6 A;  3ZEH A;  2ZPF B;  4EMG A;  4AFQ C;  2VGN A;  2L2P A;  3EFS A;  5DLQ E;  5KCO A;  1OZ2 A;  5CO7 A;  4J9H A;  2CS7 A;  5FU6 B;  1VYV A;  4M75 A;  3CCL T;  3JCM g;  3DLL A;  1VQ6 T;  1KQ2 A;  1YIJ A;  1QLY A;  2VGM A;  2YRD A;  4F14 A;  1D3B B;  2CZ7 B;  2QQB A;  2C0O A;  1Q95 G;  3FC3 A;  1Q82 R;  4F17 A;  2Y4X A;  3TQ7 P;  1Q7Y C;  3V8J A;  4MDW A;  2RO0 A;  1WHG A;  2BZX A;  2QQA A;  2X4X A;  1YI2 A;  3D7S B;  3VUB A;  4J9E A;  5GAN j;  2KRM A;  3M54 A;  4M4Z A;  4RKU E;  1YBY A;  4ZGJ B;  1VQL Q;  3RKX A;  3VRZ A;  1YNZ A;  1D0X A;  3RKW A;  3CC2 Q;  1VQO Q;  1Q81 C;  3WXM B;  2FYK A;  4A53 A;  3M9Q A;  3GP8 A;  1Y71 A;  5KE3 A;  2RJC A;  1AHJ B;  4EMH A;  3J81 E;  2CUD A;  3HRT A;  4ZGD B;  3OS2 A;  4JPB W;  4M7A B;  3GLX A;  1NBE B;  3LW5 E;  3MKD A;  2FZG B;  3NTI A;  3OW2 S;  1M30 A;  3CC7 T;  4QKU A;  1QVG P;  4ORZ A;  1OX8 A;  1U3O A;  4NS5 A;  3HL8 A;  2KGT A;  2P4R A;  4R0K A;  3EFO B;  3LYI A;  4DBQ A;  2HAX A;  5GMK m;  3OSS C;  3MP1 A;  3VS0 A;  2PUO B;  2K3B A;  2KXC A;  3JCM Q;  1G3T A;  3HRS A;  1D1A A;  4J6X A;  1BCM A;  2E12 A;  3AHU A;  2RHZ A;  1WFW A;  4PJO B;  2EGC A;  3QYG B;  4N4G A;  2ZPI B;  5EC7 A;  4M78 E;  3OA6 A;  4CI0 C;  1ZQ1 A;  5FU7 C;  1R77 A;  3TRE A;  3VS7 A;  1G3W A;  4QVD A;  1HXD A;  4P5N A;  3UWN A;  1SKU B;  3LGL A;  4C0Z A;  1H92 A;  3I55 T;  2D0N A;  3PTA A;  1VQP Q;  2EJG A;  4QQ6 A;  5LJ5 j;  3NTH A;  2KYM A;  2VWF A;  1K9M U;  2CGH A;  4PJN A;  1M90 U;  1Y96 B;  4ZTF A;  3HRU A;  4RUG A;  4N0A C;  4WTO B;  4K11 A;  4BDY A;  3L2U A;  3CC4 T;  2YDL A;  1EFN A;  1YWO A;  1MV0 B;  4LN2 A;  1K73 R;  2HNI A;  1E6H A;  1VQ5 A;  3H0H A;  2Z0W A;  3LGF A;  2DTH A;  1N9R A;  4PJL A;  1VQ4 T;  2FB7 A;  1KD1 U;  2EYZ A;  3KFV A;  2V8I A;  3JCM h;  2ABL A;  4ZGE B;  1NJI U;  4J5Y A;  2O01 E;  1QKW A;  2QK0 A;  4BUG A;  1XNI A;  3L2W A;  4A63 B;  1YIJ Q;  1R8O B;  2LQW A;  4DBR A;  4Z89 A;  9ATC B;  4A4E A;  1WI7 A;  3MEV A;  1MMG A;  3I5R A;  5KYY B;  3VS6 A;  3EGD B;  2ZPH B;  4HT8 A;  2EW3 A;  4C92 D;  3VS2 A;  3O5Z A;  2XMF A;  1RAD B;  3RKY A;  4VUB A;  4C0F A;  1SHF A;  4A4G A;  1N8R U;  4F16 A;  4OMQ A;  4C92 G;  1YI2 Q;  4C92 C;  1X2K A;  3CMA A;  1PC0 A;  1X43 A;  4RG2 A;  2PVD B;  3CCE A;  2JXB A;  2QG9 B;  1I1J A;  1PWT A;  3V8K A;  2A3L A;  3VS1 A;  8AT1 B;  4FSS A;  3RR6 A;  1YIT T;  3QBY A;  4B9W A;  3A8O B;  2YRV A;  4YTL A;  3S3O A;  2JMC A;  2RB6 A;  3PVQ A;  5HKC A;  1NPP A;  4CC2 A;  5KCH A;  3C12 A;  2O4X B;  2HL3 A;  2DIQ A;  1N6A A;  2M16 A;  4C8Q B;  4EMK C;  1W2B P;  2LX7 A;  2YWW A;  2JS2 A;  2EBP A;  3CCM T;  2YT6 A;  5CAI A;  3M53 A;  2DO3 A;  3CCU A;  4N4I A;  1K0S A;  3ZFJ A;  3EG9 A;  2QA4 T;  1N5Z A;  1TS9 A;  2QAS A;  2V8K A;  5L8R E;  3QJY A;  3S6W A;  1KHC A;  1OOT A;  1JEG A;  1GL5 A;  1YHQ A;  2KT8 A;  1LCK A;  1VA7 A;  2CP7 A;  2RJF A;  5CK9 A;  2EKO A;  1VQ9 T;  1KK7 A;  2YRC A;  3OYK A;  3OYI A;  1BIB A;  2GGR A;  3V8L A;  2O2O A;  2DET A;  1VQK A;  2JM8 A;  4E7L A;  2HSP A;  2YXY A;  2CT3 A;  2EIF A;  3NHN A;  1PD1 A;  2DFU A;  1R0C B;  2P4T A;  3CCS Q;  2NLU A;  4R55 A;  2L5Q A;  2QTX A;  4ZN3 A;  4WF2 A;  2W10 A;  2A28 A;  5HCK A;  1H3H A;  4X1V A;  4JUV A;  1VQ5 Q;  3QZ9 B;  4OB0 B;  1WXB A;  1D1B A;  1QVG A;  2NUT A;  2F2W A;  2KQW A;  1NEG A;  2WSF E;  1RI0 A;  1KQS S;  2HSE B;  3VKI A;  1UGR B;  1M3C A;  3CCR A;  2RQW A;  2F2V A;  1D0Y A;  1MMD A;  1PHT A;  1M2V A;  2M0Y A;  3NFC A;  3SEM A;  3P8H A;  4GY5 A;  2JVV A;  1X6G A;  2M51 A;  1VQN A;  2OTJ A;  3CBO A;  1YJ9 Q;  2J05 A;  3IQL A;  4JDS A;  1CSK A;  1JQQ A;  4AG2 C;  2ZPG B;  2COZ A;  2OTL A;  2ECZ A;  5GAN 3;  3CXC S;  2LRQ A;  5KH6 A;  5CCA A;  3OS5 A;  3JB9 H;  1K73 U;  1B3Q A;  5FLX E;  3CCL A;  1TG0 A;  3EGX A;  4FT2 A;  4BI8 B;  1ZSZ B;  5AYF A;  3V7C A;  5A0D A;  3L2R A;  3CD6 A;  5DM7 R;  3CMA Q;  1YFN A;  4BI4 A;  1YP5 A;  2EQI A;  4ZNX A;  3CCE Q;  3J80 E;  1M27 C;  2F69 A;  1S72 A;  1FMW A;  3EG0 A;  2GTJ A;  3HPW A;  4C8Q E;  4C92 F;  5GAN 8;  1N9S A;  4MZP A;  4AFZ C;  1N27 A;  5LJ5 d;  3ZL7 C;  2O88 A;  3QJ6 A;  3OSV A;  2COW A;  1Q82 C;  3CPW S;  2OJ2 A;  4LE9 A;  5ECA A;  4FW1 A;  2DAQ A;  1I81 A;  4M7D B;  2MMP A;  3HSB A;  5HK3 A;  4BDZ A;  3QWY A;  1QKX A;  5GAO q;  4KT0 E;  3CCU Q;  5IAY A;  4BE0 A;  3GNG A;  3LX7 A;  4ZTJ A;  4EDU A;  4JJB A;  2KK4 A;  5HY6 A;  1W1F A;  1T3L A;  4F7U B;  3REA B;  5C0M A;  3QZ5 B;  1D1C A;  5L23 A;  1BI0 A;  3QWX X;  4J6W A;  3QHS A;  1C6V X;  4OMP A;  3M0U A;  1YHQ Q;  4M77 E;  4OP0 A;  1V1C A;  5J3B A;  2H3E B;  2JJ9 A;  2O9S A;  1BBZ A;  1VQ8 A;  4HCK A;  1VQK Q;  1IGQ A;  3PNW C;  2DIL A;  4EMK A;  4M7A D;  2NUP A;  1VQ7 A;  3X26 B;  3CCJ A;  3EAE A;  3X24 B;  1OYX A;  3MEA A;  3A8M B;  1SG5 A;  4OGE A;  1E6G A;  8ATC B;  4V2S A;  1ZBX A;  4M7A G;  4M7A C;  3JCM X;  5CKF A;  4AG1 C;  1NEB A;  3TU4 K;  2RQV A;  1QVF A;  1BI2 A;  1WJQ A;  2CYZ B;  3OYN A;  1WJS A;  2RI5 A;  1AZE A;  3G6E A;  4PJO D;  1TH7 A;  2CZ1 B;  3BW1 A;  5GMK h;  1K9M R;  1M90 R;  5EG2 A;  2D6F A;  2OX7 A;  3OY9 A;  1WX6 A;  1OPK A;  2D8J A;  2CP6 A;  3QXE B;  1U06 A;  1VQN Q;  2OTJ Q; 
#chains in the Genus database with same CATH homology
 2XDD A;  1W2B S;  4EMH A;  3J81 E;  2Y90 A;  4BAC A;  3CCS T;  1VQ6 A;  4N4H A;  5GAN 4;  2R58 A;  1UGP B;  2EQK A;  3HRT A;  4ZGD B;  3OS2 A;  3OYY A;  2KAF A;  5CKD A;  3SWN B;  4M7A B;  3GLX A;  3V7S A;  4RCC A;  4A54 A;  3LW5 E;  2KDS A;  4C0D C;  2DK3 A;  3CBM A;  4FIB A;  1U8R A;  3OW2 S;  3NTI A;  4C8Q F;  2ZZD A;  1VQM A;  1Q86 C;  3CC7 T;  3M56 A;  5GMK i;  4M7A E;  2XKO C;  4BD3 A;  1KG1 A;  5IN1 A;  4NS5 A;  3JCM J;  1FWZ A;  3HL8 A;  1LOJ A;  3T9N A;  3OYH A;  2P0K A;  1VQ5 T;  1KQ1 A;  5I2M A;  4F7U G;  3LYI A;  1O9S A;  3G4S A;  4II1 A;  5FU6 C;  3V7R A;  5GAN e;  5HK0 A;  1U1T A;  5LJ3 e;  2HAX A;  4XAX B;  1YJN T;  5GMK m;  5LJ3 g;  2LT1 A;  4BY6 B;  3OSS C;  3MP1 A;  4XTZ A;  3BFM A;  5CQY A;  4BB7 A;  1VUB A;  2PUO B;  2EQM A;  3C94 A;  3A8H B;  4QQD A;  2RK2 A;  3CEY A;  3JCM Q;  4L6V 5;  1Q82 U;  3RES A;  1G3T A;  3M58 A;  3DB4 A;  3GIB A;  3HRS A;  4M7D F;  3JSC A;  2M0O A;  5GAM e;  2O4X A;  3M57 A;  3GNF B;  4J6X A;  4HT9 A;  1EIF A;  2E12 A;  2KSS A;  5GAM g;  3AHU A;  4C8Q A;  4L5G A;  3F70 A;  2RHZ A;  4JS5 A;  1UEB A;  4M78 B;  2RD1 A;  4PJO B;  4X34 A;  1YJ9 T;  1KHI A;  3QYG B;  2QDY B;  4E7I A;  4N4G A;  3OYM A;  2ZPI B;  2XG8 D;  3L2Q A;  2BIV A;  4M78 E;  5GAN 2;  2DTO A;  4C92 A;  1WQ7 A;  1ZQ1 A;  2HQX A;  5FU7 C;  1QVP A;  5LJ3 f;  3ASK A;  4L59 A;  3TRE A;  4C0D B;  2K3X A;  4JRP A;  2QI2 A;  1G3W A;  4DA4 A;  4QVD A;  1M1K C;  1VIF A;  1HXD A;  4A4F A;  4P5N A;  3UWN A;  3LGL A;  4C0Z A;  3I55 T;  4IKF A;  1YJW T;  3PTA A;  4E7H A;  2VXF A;  2EJG A;  4QQ6 A;  5LJ5 j;  4M77 F;  4M75 B;  5J39 A;  2DIG A;  1K8A C;  2WSE E;  3NTH A;  5GAM f;  4M7D A;  3JCM P;  1K9M U;  2CZ6 B;  2QQ9 A;  2WAC A;  2CGH A;  3QSU A;  2RI2 A;  4X9D A;  1M90 U;  1Y96 B;  4F7U E;  4XU3 A;  4ZTF A;  3HRU A;  3PT9 A;  4C0G A;  4XK8 E;  3CC7 A;  3CCV T;  2HD0 A;  3J7A F;  4N0A C;  4LD6 A;  4BDY A;  3L2U A;  1NZ9 A;  3FDR A;  3CC4 T;  1YIT A;  3E9F A;  4PLI A;  2K3Y A;  3CMA T;  4EMK B;  3X25 B;  2HNI A;  4GLK A;  1H3Z A;  1MGQ A;  1VQ5 A;  2LNV A;  2VC8 A;  4RG8 A;  3CCE T;  2GFU A;  2R5A A;  5I2S A;  3MHX A;  4IUU A;  3L2Z A;  2PQW A;  2K4Y A;  1YJN A;  4Y91 A;  3LGF A;  2DTH A;  1KQS A;  1N9R A;  1M4Z A;  1YCY A;  2EQJ A;  4HA8 A;  4E7K A;  1VQ4 T;  4M77 A;  2FB7 A;  3S3N A;  4ELY C;  1KC8 C;  4IUR A;  1KD1 U;  4MZM A;  4HCB A;  3H8Z A;  4E7J A;  4IUV A;  5J26 A;  5LL6 S;  2V8I A;  3JCM h;  1B34 A;  1NE8 A;  2R57 A;  4XTU A;  4ZGE B;  2RHI A;  4JRI A;  2RM4 A;  3QG1 A;  1NJI U;  4DQ2 A;  4J5Y A;  2O01 E;  4FSX A;  1Q7Y U;  1ZHI A;  5LJ5 e;  4BUG A;  3BDU A;  2XD0 A;  1XNI A;  3L2W A;  4IUT A;  2GFA A;  4FT4 A;  4PL6 A;  1R8O B;  1WJR A;  2E6N A;  3QPH A;  3A8L B;  2DZC A;  2XHC A;  3QUI A;  4A4E A;  5GAO r;  3MEU A;  3MEV A;  3PIO A;  4HCZ A;  1BIA A;  3HKS A;  5CR2 A;  3I55 A;  3CXC A;  4BY6 C;  3MO8 A;  3OBW A;  4KUI A;  2P0P A;  2DKG A;  3CCU T;  1BI1 A;  3PGG A;  4FU6 A;  3OYE A;  2ZPH B;  4HT8 A;  2K57 A;  1WGS A;  5CIU A;  3QKJ A;  4C92 D;  4OGC A;  2MWO A;  5D6Y A;  3MP8 A;  3RKY A;  3E1S A;  2PU9 B;  2WSC E;  4VUB A;  4C0F A;  4EPC A;  5CKH A;  4A4G A;  2E10 A;  3KUF A;  3L42 A;  1VQ9 A;  2RJD A;  3QYH B;  1N8R U;  2CKK A;  1WPY A;  2Y4Y A;  3CCV A;  4OB1 B;  4PJO G;  3RMQ A;  4PJO C;  5DY9 A;  4C92 G;  1OZ3 A;  2QXF A;  3MET A;  2VXE A;  5CKE A;  2G3R A;  4C92 C;  1YHQ T;  3CC4 A;  3CMA A;  4M75 D;  4XU1 A;  4M7A F;  4PLL A;  4RG2 A;  2PVD B;  3OMC A;  3CCE A;  5A0G A;  3E19 A;  2LDM A;  3V8K A;  1M1G A;  2F5T X;  2A3L A;  2LC4 A;  4JLG A;  3OQ5 A;  3JCM d;  1VQK T;  1K73 C;  1VQ4 A;  1YIT T;  2LT4 A;  3QBY A;  4B9W A;  2DZ9 A;  2YRV A;  3A8O B;  2XI9 A;  4M75 G;  4YTL A;  4M75 C;  1Y07 A;  3S3O A;  2PUK B;  2DEQ A;  3NTK A;  2D9T A;  3RER A;  3GPL A;  2RB6 A;  1PSE A;  3OS1 A;  2MAM A;  5HKC A;  5GAN g;  5IT9 E;  1NPP A;  2KVQ G;  3PIP A;  3OYA A;  5KCH A;  3C12 A;  3CPW A;  4XU2 A;  1JRI A;  3OMG A;  2RA2 A;  3SB2 A;  2O4X B;  1LJO A;  4MDX A;  2DIQ A;  1N6A A;  2M16 A;  4C8Q B;  2DJZ A;  3GOX A;  4EMK C;  5GAO l;  5GAO p;  1BKB A;  4M78 F;  2HBP A;  4QQG A;  1M5Q 1;  3KBG A;  3CCM T;  5CKB A;  5CAI A;  3M55 A;  2X4W A;  3M53 A;  2DO3 A;  3MEW A;  4C92 B;  3I56 T;  3CCU A;  4OB3 B;  1Y7X A;  2E5Q A;  1QP3 A;  4N4I A;  3RIR A;  5LJ3 h;  3ZFJ A;  2RI3 A;  2QA4 T;  5GAN f;  3OYF A;  1UGS B;  4C92 E;  3SFM A;  2IG0 A;  3TCJ A;  4Z02 A;  2V8K A;  1VQL T;  5L8R E;  3QJY A;  2X4Y A;  1M1K U;  4RCB A;  4XU0 A;  2I2L A;  2JTF A;  2GF7 A;  2QQR A;  3CC2 T;  3ZBD A;  1VQO T;  3S6W A;  2E1H A;  1KHC A;  2E6Z A;  2YLB A;  3X28 B;  4F7U F;  4DOW A;  5GAM h;  2EQU A;  1P92 A;  1XOV A;  2K2V A;  2D0Q B;  1YHQ A;  1GXI E;  5CVI A;  1K8A U;  2BKD N;  2RJF A;  3CME A;  4JLI A;  3SDZ A;  1JBM A;  3FRN A;  2DTI A;  3WVD B;  2KY9 A;  2EKO A;  4M75 E;  5CK9 A;  3CBP A;  1VQ9 T;  1VQN T;  2OTJ T;  2CZ0 B;  1G5V A;  3OYK A;  3OYI A;  1MHN A;  3JB9 D;  3JRZ A;  1BIB A;  2FL7 A;  3V8L A;  1UGQ B;  1G3S A;  2LQK A;  3FIF A;  4ME7 A;  2C06 A;  1VQK A;  3UPU A;  2OTL T;  3X20 B;  4E7L A;  2RHY A;  2LQ8 A;  1VIE A;  3QO3 A;  5GMK j;  2EIF A;  2XDP A;  2QEX T;  2RH2 A;  1W4S A;  3M4Y A;  3QDR B;  3L2V A;  3E9G A;  3JB9 G;  3JCM V;  4HCC A;  2MI6 A;  3DKM A;  1LNX A;  4QVC A;  2E70 A;  2YLC A;  2DPP B;  2DXC A;  2P4T A;  4F7U A;  3LWH A;  2NLU A;  1B34 B;  2P0Q A;  5FRM A;  1JB0 E;  1V29 B;  4R55 A;  3TEE A;  4ATO A;  1X6O A;  3OA6 A;  2L5Q A;  1KC8 U;  2QTX A;  5FRN A;  4ZN3 A;  3UT1 A;  5KE2 A;  1SSF A;  4WF2 A;  4ZN1 A;  5M9O A;  3LLR A;  5LJ3 d;  4LDX A;  2ZPE B;  4KUL A;  4A4H A;  2M1H A;  4RMO A;  3G71 T;  3CCM A;  3CD6 T;  4JUV A;  5C6S A;  2L8D A;  1WNL A;  3I56 A;  2ZGW A;  2JOY A;  5LJ5 g;  2LCC A;  2EWN A;  3ME9 A;  3QZ9 B;  4OB0 B;  4MZT A;  1QVG A;  1PSF A;  4JJN K;  1JJ2 A;  2QA4 A;  1XTD A;  2ZCF B;  1S72 T;  2KQW A;  1KQS S;  2WSF E;  1RI0 A;  1H64 1;  4LDV A;  4C8Q D;  3VKI A;  5GAM d;  1UGR B;  2JTM A;  1D3B A;  3CCR A;  1VQL A;  5D6X A;  2L3R A;  2GQV A;  3OBY A;  3VYH B;  4XQ3 A;  3CC2 A;  4LDY A;  1VQO A;  1I5L A;  2ZPB B;  3INZ A;  4NOY A;  3FJP A;  3JCM W;  1OI1 A;  3NFC A;  5GMK e;  2XU8 A;  1X75 C;  3M4G A;  3FEO A;  4TVR A;  4JRQ A;  4UC4 A;  3P8H A;  4C8Q G;  1Q81 U;  2K5L A;  4GY5 A;  2LCL A;  4C8Q C;  3WVE B;  2JVV A;  5LJ5 h;  4OVA A;  2JUF A;  2EAY A;  4XTW A;  4A4K A;  3EFR A;  1VQN A;  1QVF S;  2JN0 A;  2EYQ A;  3BDL A;  2E41 A;  3JCM c;  3CBO A;  5LJ5 f;  2XDB A;  1WQW A;  3R6O A;  1W2B A;  4Y28 E;  2DD5 A;  3OYJ A;  1FX7 A;  2VYT A;  3DB3 A;  4JDS A;  5LJ3 j;  3CCQ T;  5D6W A;  2ZPG B;  2X4J A;  4M7D D;  3CME T;  2OTL A;  5GAN 3;  3OW2 A;  3LWI A;  2B8A A;  2JZ2 A;  2FVU A;  3CXC S;  2LRQ A;  2QEX A;  1M1F A;  3MP6 A;  5KH6 A;  4J7I A;  2AHJ B;  1QW1 A;  5A0L A;  3JB9 J;  2E65 A;  4ELZ C;  5DLO A;  1Q86 U;  5CCA A;  3OYB A;  4Q5W A;  4C5E A;  5GAM j;  3OS5 A;  4CRI A;  4O6J A;  1K73 U;  3JB9 H;  4M7D G;  4M7D C;  5FLX E;  3CCL A;  4NL3 A;  4OMF B;  2JNG A;  5GAN 6;  2XIC A;  4FT2 A;  4J7F A;  2EJF A;  4BI8 B;  3N5B B;  2GCX A;  5AYF A;  2H3J A;  3V7C A;  3HHT B;  5A0D A;  4OB2 B;  1RL2 A;  2PVO B;  3L2R A;  2M9U A;  4M77 D;  4XTX A;  3G71 A;  3CD6 A;  5DM7 R;  4FM4 B;  2A7Y A;  2K5F A;  3O8V A;  4BI4 A;  3SWN A;  4M7A A;  4KBM B;  4BI3 A;  3J80 E;  2VUB A;  5GAO m;  3FLG A;  1VQP T;  3LH0 A;  2OTJ A;  2MF2 A;  4LDU A;  3S3M A;  2F69 A;  1S72 A;  2DXB A;  4O5V A;  2LVM A;  1VQ8 T;  1FXX A;  1NPR A;  2F5K A;  4PJO F;  4C5I A;  3HPW A;  4C8Q E;  2EFI A;  4C92 F;  5GAN 8;  1N9S A;  4M77 G;  3ER0 A;  4M77 C;  1YIJ T;  4MZP A;  4IUP A;  1VQ7 T;  1N27 A;  3CCJ T;  1BI3 A;  5LJ5 d;  4MML A;  5GAN h;  3M5A A;  3FB9 A;  5GMK l;  2LTO A;  3QJ6 A;  3OSV A;  4PKC C;  3URG A;  1BYM A;  3BY7 A;  2KMT A;  3OB9 A;  4JS4 A;  1Q82 C;  3CPW S;  3CCR T;  1VQP A;  4R56 A;  3PMI A;  4J8O A;  2MWP A;  2YHT A;  1UB4 A;  3OYC A;  1U1S A;  4M75 F;  3VV0 A;  2DAQ A;  1I81 A;  4M7D B;  3P8B B;  3A5Z B;  2MMP A;  5GAN 5;  5FRO A;  3CCQ A;  3HSB A;  4B9X A;  5HK3 A;  3JB9 I;  4BDZ A;  3KXT A;  2DVE A;  3H6Z A;  1DJ7 B;  4DOV A;  4M7D E;  4C5G A;  5GAO q;  3JAM E;  2DXU A;  3VJP A;  1I8F A;  4M78 A;  4KT0 E;  3VU3 C;  4PJO A;  1YI2 T;  4IUQ A;  1XQH A;  3C95 A;  1IZ6 A;  5IAY A;  3VYG A;  1M9S A;  2V8J A;  3ZEH A;  3DLM A;  4BE0 A;  2ZPF B;  4EMG A;  3GNG A;  3UDC A;  3MCA B;  3VUZ A;  3LX7 A;  4ZTJ A;  2VGN A;  1YJW A;  4EDU A;  3EFS A;  2RK1 A;  4JRK A;  4J6Y A;  1X01 A;  2KK4 A;  2BUD A;  2RHX A;  4FL6 A;  5DLQ E;  5HY6 A;  4XTY A;  5KCO A;  5GAN 7;  3G6E T;  3HP9 A;  1OZ2 A;  2K5I A;  5CO7 A;  4F7U B;  3SD4 A;  3A8G B;  2CS7 A;  4M77 B;  3QZ5 B;  5FU6 B;  2E64 A;  4XTV A;  5C0M A;  3CCS A;  1K9M C;  1BI0 A;  3GF5 A;  1M90 C;  4M75 A;  4J6W A;  3QHS A;  2DXT A;  1M8V A;  1HK9 A;  4M77 E;  3CCL T;  3L1A A;  4OP0 A;  4PNO A;  3JCM e;  5J3B A;  1Y96 A;  2RHU A;  3CPF A;  3JCM g;  3PFS A;  4X9C A;  3DLL A;  2R5M A;  1VQ6 T;  5GAN d;  1KQ2 A;  1VQ8 A;  5I21 A;  1YIJ A;  3PNW C;  2VGM A;  3HFO A;  4J83 A;  3RMS A;  4EMK A;  2IVW A;  4M7A D;  1VQM T;  2X35 A;  1VQ7 A;  3P8D A;  3X26 B;  3CCJ A;  4PJO E;  2OAU A;  4HKE A;  3EAE A;  1D3B B;  3OS0 A;  3X24 B;  1OYX A;  3PMT A;  4QVZ A;  2CZ7 B;  1QP2 A;  2QQB A;  5A2Q E;  3MEA A;  3A8M B;  3G7Z A;  5FU7 B;  1KD1 C;  4LD9 K;  3OYD A;  3RUX A;  4MMK A;  2FHD A;  4OGE A;  1G3Y A;  3FC3 A;  3G4S T;  2RJE A;  3JCM b;  4V2S A;  2L89 A;  4D6W A;  4E47 A;  1ZBX A;  4CI0 C;  3SWN C;  1NJI C;  4M7A G;  4M7A C;  3JCM X;  3JCM f;  1IRE B;  5CKF A;  2Y4X A;  4BE1 A;  4BE2 A;  1Q7Y C;  3HFN A;  3V8J A;  4MDW A;  2RO0 A;  1I4K 1;  3TU4 K;  1QVF A;  3JB9 F;  1YJ9 A;  1BI2 A;  2HQE A;  4LDW A;  1O75 A;  2QQA A;  4NL2 A;  2X4X A;  1WJQ A;  1YI2 A;  2CYZ B;  1QVG S;  3VUB A;  2DD4 A;  5GAN j;  3OYN A;  1JJ2 S;  4KUD K;  4QW2 A;  4C5H A;  2XK0 A;  3M54 A;  4RKU E;  1WJS A;  1YBY A;  2RI5 A;  3QII A;  4ZGJ B;  5GAO n;  4M78 D;  3G6E A;  4PJO D;  1TH7 A;  3RKX A;  4N0A A;  2PVG B;  3OYG A;  3OYL A;  3RKW A;  2CZ1 B;  2EJ9 A;  3BW1 A;  2LX9 A;  3WXM B;  3C4S A;  1Q81 C;  2FYK A;  5GMK h;  2VV5 A;  4A53 A;  3M9Q A;  1N8R C;  3Q1J A;  3GP8 A;  2D6F A;  1Y71 A;  5EG2 A;  5CQX A;  4OF1 A;  5KE3 A;  3OY9 A;  2QQS A;  3M59 A;  4M78 G;  3QXE B;  4M78 C;  2RJC A;  1AHJ B;  2XID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...