2DD5A

Thiocyanate hydrolase (scnase) from thiobacillus thioparus native holo-enzyme
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase alpha subunit
publication title Structure of thiocyanate hydrolase: a new nitrile hydratase family protein with a novel five-coordinate cobalt(III) center.
pubmed doi rcsb
molecule tags Hydrolase
total genus 27
structure length 119
sequence length 119
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dd5A00
1GXIE 2PUKB 2WSCE 2WSEE 2ZPHB 2PVOB 3A8LB 2QDYB 2PVDB 1JB0E 2ZPGB 4RKUE 4OB1B 2DXBA 1V29B 4ZGJB 3X24B 4ZGEB 3X25B 4ZGDB 4Y28E 3QYHB 1UGRB 2WSFE 2CZ0B 2PUOB 4OB3B 2PU9B 2ZCFB 3A8HB 3QYGB 1QP2A 1UGPB 2CZ6B 1UGQB 2ZPBB 2DD5A 3QXEB 2ZPFB 2D0QB 3QZ9B 3HHTB 2PVGB 1DJ7B 3A8GB 4L6V5 3X28B 2ZZDA 5L8RE 1PSEA 2DPPB 2CYZB 4OB2B 3X20B 1UGSB 4OB0B 1AHJB 4XK8E 3X26B 1QP3A 2O01E 3WVDB 4KT0E 2ZPIB 2AHJB 4FM4B 2CZ1B 2DD4A 3QZ5B 1IREB 2CZ7B 1PSFA 3A8MB 3LW5E 3A8OB 2DXCA 3VYHB 2ZPEB 3WVEB 3VYGA
chains in the Genus database with same CATH superfamily
5GMKe 3AHUA 5CCAA 2EQJA 1WIEA 1RAGB 1BB9A 4L5GA 4M77D 4OGCA 2KI7A 4CI0C 1C1AA 4AT1B 4FYVB 5D6XA 1LVKA 1G3SA 3CCJA 2W10A 1G5VA 4MMKA 1BBZA 3OB9A 3FEOA 1XJWB 1VQ5A 2KMTA 2DL7A 2RPNA 3M5AA 4R0KA 1G83A 1WNLA 2GFUA 3OQ5A 1PG5B 2YDLA 1PM3A 1ZSZB 2DM1A 2L89A 4DOVA 2D0QB 2KROA 1PRLC 5CKBA 4J9BA 3VRZA 4PKCC 3I56T 1DJ7B 4C8QE 4ME7A 1Y96B 2CREA 3JRZA 2CSIA 4JPBW 2EGCA 2COWA 4J8OA 4OB2B 1SHFA 3I56Q 3C4SA 3EG2A 4AG2C 4ELYC 1GBQA 2P84A 4M75B 3BDLA 1IO6A 2D8HA 3LWIA 2MIOA 1YI2A 3CCLT 3V7RA 4JLGA 3OMGA 1M8VA 1D3BA 2DEUA 1Q82C 1YJWA 1YCYA 4CRIA 5GAN4 3OYHA 4OGEA 4EDUA 3P8HA 2EQKA 4DBFA 4C5GA 3CCLQ 1VYVA 4C8QG 4BDZA 3L2UA 3O8VA 5KCHA 1MNDA 2ZPEB 2JM9A 2VV5A 1A0NB 4F7UE 3CCMT 3LH5A 1YI2T 1KSWA 4LDUA 2GF7A 3MP6A 3CC2A 2X4XA 1K8AU 1Q81U 1Y7XA 2M0OA 3S6WA 5A2QE 4A4FA 2HSEB 3CCUA 1WJSA 4FT4A 4ZNXA 3CCMQ 1YI2Q 4HCBA 1N9SA 4KBMB 3HFNA 4JLIA 1YJNA 2K5FA 4PJOB 2K2VA 2YHTA 4HCCA 3LGLA 3EFOB 4R56A 2AKKA 2DVEA 2RB6A 3JB9I 3CXCS 3CD6T 3EG9B 4BE0A 2FPEA 2RA2A 3GBQA 4NL3A 3G7ZA 3CCUT 1SRLA 4PJNA 3FLGA 1AVZC 2DMOA 3OYBA 3L2VA 4F7UG 1RAHB 3NTKA 2CH4A 4WTOB 1TUGB 1JJ2A 3VS6A 2RM4A 4M75A 3CMAT 4M7AE 1D0YA 2FB7A 3CCUQ 1VQ8A 2FZKB 2DJQA 1NLOC 3SHWA 1VQMT 2KNBB 5GJVB 4HCZA 4BE2A 1IRXA 3NGPA 5I21A 3CMAQ 1ZSGA 5AYFA 1RAIB 2O4XB 1VQMQ 2FO0A 4XU1A 3I5SA 1FWZA 1UHCA 2DE0X 5GMKj 1N8RC 1UE9A 2K3YA 1BIAA 1ZUYA 4J6XA 2R5AA 2RK2A 3UPUA 4ESRA 1SRMA 2EQIA 5FU7B 3R6NA 4M7AG 1VQNA 1QMCA 4M7DE 2QGGA 3EGXB 2RQVA 5IHKA 3FJ5A 5ECAA 3VYGA 4PJOA 4ZN3A 2EYWA 4XU2A 3SD4A 3EFOA 3KBGA 1VQ7A 3M4YA 1QKXA 1Q7YU 2KRNA 2FRWA 4A63B 3EG9A 1ABQA 1JB0E 2NUTB 3OS1A 4M78C 1WHJA 4BUGA 5FU6B 1JJ2P 4AFQC 2HKQB 1KQSS 1UJYA 3VU3C 4NL2A 4M78A 4ZGJB 1UEBA 2WSFE 3PTAA 4J9FA 5GAMd 2R58A 2JTMA 5EG2A 2MPXC 4J9DA 1H3ZA 4M7DG 1U1SA 2K7AA 3CCEA 5GAOq 5CAIA 1VQ7Q 3GOXA 2Y4YA 1N5ZA 1AOJA 5KE2A 1VQPA 2RJEA 4JS5A 4OMQA 5GMKm 5GAMf 3CCRA 2XHCA 4BDYA 2FPDA 2R5MA 4OMFB 4Z89A 4D8KA 2O2OA 3RNJA 2L3PA 1I0CA 2ZAEA 2DL4A 1VQOA 4M7DF 3C95A 1ZUUA 3JCMW 2QDLA 1PHTA 3EG3A 1VQPT 1PD0A 2P4TA 4PFOA 2Z0WA 1D0XA 4XK8E 1HJDA 3EGXA 3M57A 1QP3A 3UDCA 1Q82R 2JMCA 1Q95G 1C0MA 1M3CA 3OBWA 1VQPQ 3UA7A 2QI2A 1ZUKA 5CO7A 2P0KA 2P4RA 4QQGA 1VQOT 1V1CA 2VWFA 1T0HA 3M0QA 3FC3A 2F69A 1RAEB 2XG8D 3OYYA 4A53A 3L2WA 2GTOA 2RHUA 1K8AC 4KRTA 3JB9J 1VQOQ 2HD0A 4OMMA 1V76A 4FSSA 1PKSA 1BI3A 1I5OB 1WX6A 1VYTA 1PNJA 3MO8A 3TVTA 1G3WA 1U1TA 2CT4A 4NOYA 1WA7A 2MYSA 5FROA 1M90U 2KVQG 4PJJA 1JO8A 2K5LA 1YIJA 1VQKT 3PFSA 5GAOr 3DLMA 1RABB 3HTRA 2DKGA 4M7AB 2C06A 2CDTA 2MI6A 2GQVA 1T3LA 2RJCA 1QW1A 1M1GA 3HFOA 2K5IA 1VQKQ 2JN0A 5HCKA 4C0DC 1UGQB 1NM7A 2XU8A 4HVWA 1M5Q1 4IIOA 4BD3A 2EYXA 1NYFA 3MCAB 1YITA 2ZZDA 4RTUA 4GY5A 2L3QA 5CQXA 5CKEA 2DJZA 1UHFA 1VQ9T 2CYZB 1EFNA 1RUWA 1UDLA 2FHDA 4J9IA 3PGGA 3CPWA 1BCMA 4X9DA 1K9MC 3I55A 1VQ9Q 1Q86R 2M9UA 2LZ6B 2ZPIB 5CR2A 1YITT 3N5BB 3J81E 4A54A 4FYXB 1HD3A 2DD4A 2EJ9A 5LJ5j 2K3XA 2HBWA 2RNAA 1F1BB 2OX7A 4IUUA 1WXUA 2DLPA 1OU9A 2DXCA 1YITQ 5KYYB 1M1KU 1CKAA 1WJRA 4J6YA 1AWWA 2JZ2A 1WXBA 1WLPB 2KYBA 1Q7YC 2KDSA 3T9NA 2RN8A 3L2RA 1HSQA 5I2SA 1UUEA 1RAFB 3CMET 1QVPA 3CC4A 3TU4K 1B7TA 4M7DD 3VUZA 2ZPGB 4M75E 3EFRA 4RTWA 2QQBA 4OB1B 4C92C 1V29B 2QTVA 3X24B 3VS5A 5GAMg 4FW2A 1WPYA 3CXCA 3BY7A 3QYHB 1SSFA 2COZA 3CCVT 1B07A 2CT3A 4C5HA 3RUXA 1D1AA 4QQ6A 1QVFA 5HK3A 2DL8A 1E6HA 3PVLA 2FL7A 2A0FB 1EX4A 3CPWP 3QXEB 1GCQC 4Z02A 2CS7A 2QYZA 3CEYA 1X2KA 1XNIA 2DERA 3CCVQ 1GCQA 3H6ZA 3EAEA 2M0YA 4KGXB 4XTUA 4II1A 2KK4A 4M75G 1TWBA 3E19A 3EG1A 5J3BA 1PSEA 5GMKi 1G3YA 2EGAA 3AT1B 4PJOE 2QK0A 2K6DA 2HQHA 6AT1B 3CPFA 1ZA1B 4JZ3A 1UTIA 2LMJA 2ED1A 1KQ2A 3J7AF 3PMTA 2VXEA 4A4KA 4N4HA 1IREB 2MCNA 3A8MB 3JCMd 4M75F 1AWJA 3M59A 3G6EA 4DBQA 1KD1R 2K79A 1M2OA 1K8AR 2FG0A 2P0PA 2CP3A 4FT2A 1K73U 2JJ9A 3CXCP 1Q81R 4HT8A 2QQSA 3OYNA 2J05A 1GXIE 5I2MA 1RADB 1X75C 5GAOp 4Y92A 1QVGS 2BIVA 1OEBA 2LCLA 3JB9H 4PJOG 1AEYA 1QVFP 5CQYA 1W6XA 2DYBA 1W1FA 1MMAA 1TUCA 4WF2A 4B9WA 5DM7R 5GANd 1Y71A 2LT4A 3UATA 3OYEA 4J9GA 5GAN2 2V26A 4ANJA 3CBMA 5LJ3h 2LRQA 3OS5A 4N4IA 3H8ZA 3NHNA 4PL6A 5LJ3d 1D3BB 3QUIA 2YSQA 5GAN7 1KQ1A 5GANf 3E9GA 1ZX6A 1SKUB 1Y57A 3PNWC 5KYWA 1I4K1 4AFZC 4PJOF 2OTLA 4FIBA 2FZGB 2HSPA 2RQRA 4TVRA 2LJ3A 2ZPBB 5CK9A 4JDSA 2HL5C 4QVDA 3JSCA 4KGVB 1O9SA 3INZA 5LJ3f 2XDBA 3QZ9B 1S1NA 1EIFA 4FU6A 3I9QA 2EPDA 2KR3A 4OMNA 3OS0A 2OTLT 4IURA 3UF4A 1BI0A 2B8AA 5GAOm 5KYUA 1BI2A 1UB4A 2DYIA 2IPOB 4JJBA 2ROTA 4KULA 1OX9A 4LDWA 1OPKA 3CCJT 2OTLQ 2G3RA 2F5KA 3HRUA 4N4GA 2XD0A 3VS4A 1ARKA 3GP8A 1VQ5T 1IHVA 2NLUA 2RHZA 2D0NA 3DB4A 2CP6A 5GAOn 4D6WA 2GCXA 3CCJQ 4CC3A 1K0XA 2EYZA 1M1KC 2AK5A 4RUGA 5FWBA 3SWNC 4M77C 3SEMA 4MMLA 1OV3A 2QXFA 1VQ5Q 5J39A 4M77A 2X9HA 1UJ0A 1OYXA 3OYIA 4ATOA 4MZTA 1JXMA 8ATCB 2WSEE 2HCKA 2JXBA 2LDMA 1ACMB 1T3SA 1ZQ1A 4OMPA 4JJNK 2V1RA 3SFMA 2BUDA 1SG5A 4PFZA 1LCKA 2VKNA 3WXMB 1G2BA 1M3AA 4Z88A 5KYXA 4LDVA 3M54A 2F5TX 2A08A 1RACB 1OOTA 1JRIA 3MP1A 1JEGA 1H641 4M75D 1YJWT 1OQKA 1QQJA 2X3WD 1VUBA 3GIBA 3L2QA 2GQIA 1NPPA 4DEYA 2X3XD 3FIFA 2DVJA 1NJIC 1X43A 3DB3A 2AT1B 3REBB 3M0UA 1OZ2A 1AZGB 4O5VA 1OU8A 3QWXX 2YRVA 1YJWQ 1BU1A 4C8QF 4AMCA 4E7KA 3CC2T 1EZZB 4EIKA 4QW2A 5IXFA 4EMHA 1KHIA 1U3OA 3OSVA 1VIEA 1M2VB 4J6WA 1H8KA 2YUQA 2EWNA 3L2ZA 2E5QA 1PC0A 2ENMA 1N6AA 2DTHA 3CC2Q 1HXDA 4M78B 1YJNT 3QG1A 1D1BA 5IN1A 1YWPA 1JXOA 2RJDA 2VASA 1Y07A 2YLBA 2YT6A 3JCMg 4MDWA 2X35A 2J7IA 3QZ5B 1YJNQ 2CZ7B 2V8KA 4PJOD 3LW5E 3M0PA 2DO3A 1K73C 2NUPA 3TCJA 2KSSA 1JQQA 5LJ5d 2RD1A 3EH1A 2EAYA 2W0ZA 4F7UF 4PLLA 1TOVA 2K57A 2DIQA 4LDXA 2KAFA 4AFSC 1VQ8T 1WFWA 2CGHA 1K9MU 1RLPC 2QDYB 4QQDA 5GANg 2HNIA 1M90R 1IXDA 2M1HA 3P8DA 1KC8R 7AT1B 4LUDA 3H9NA 1H3HA 1FX7A 1VQ8Q 1QCFA 3TSWA 2A7YA 3EGUA 4B9XA 4FW1A 2LQ8A 3SDZA 5LJ3g 2JOYA 3GNGA 4ZGEB 1GL5A 2HBPA 2F1LA 1VA7A 1AWXA 2XMFA 1GBRA 3QHSA 3FB9A 5CKDA 1MMGA 4OVAA 1M2VA 1MUZA 1VQNT 1Z9QA 1YP5A 3JCMP 2EVRA 4F16A 4M7AF 4RTTA 1QCNA 3ER0A 4A4HA 3OS2A 1PCXA 3H0HA 3G4SA 5GAMh 4CC7A 1VQ7T 1MMNA 2WACA 1VQNQ 3M0RA 5L8RE 3OW2A 3U23A 1NEBA 3G71A 3ULRB 2DPPB 2M16A 5DY9A 1W2BS 2HEQA 5D6WA 1KJWA 1O75A 4RCBA 1I5LA 3G4ST 3V7CA 3CCSA 2DL5A 5GAN6 4JZ4A 3CQTA 3G71T 1AZEA 4E47A 1IGUA 2O9VA 3CCET 3BE3A 3G4SQ 4FYYB 2LJ0A 2DF6A 3LH0A 1QVGA 2E3IA 4C0DB 3OYDA 2I0NA 4C8QD 3G71Q 3GNFB 3RIRA 4MZMA 4RTVA 5C0MA 3CCRT 4HVUA 3CCEQ 3CCST 4BI3A 2ZPHB 3HRTA 1PKTA 4IKFA 2PQWA 2J06A 1E7OA 1IGQA 1QWFA 2CH4W 2ESWA 3TREA 3CCRQ 1K9AA 5FRNA 4FCYA 5GAMe 3CCSQ 2P0QA 4F17A 4XTZA 5D7UA 2C0IA 4DEXA 5CVIA 4QT7A 3VS2A 2A37A 2RHXA 2X4JA 2XIDA 3OW2P 2HQEA 2PU9B 3DKMA 2E10A 2I2LA 1VQ6A 2OI3A 5M9OA 5HK0A 1J3TA 2ZPFB 2CUBA 2ECZA 1XTDA 2DETA 2AZSA 2F2VA 4EMKC 4C5IA 3A8GB 2L2PA 2KQWA 2AZVA 3VRYA 3JCMX 3O5ZA 4FYWB 4EMKA 2ED0A 4OF1A 2MAMA 1VQ6T 4FSXA 2M51A 4M77E 2DXTA 1QVGP 3JCMJ 3TQ7P 4J7IA 2VYTA 1YJ9A 4C92B 1ZA2B 3GPLA 2HZYA 2XKOC 1YIJT 2O01E 2V1QA 3EHQA 1RAAB 1VQ6Q 3META 2AHJB 2OAUA 1YHQA 3OA6A 4FM4B 4BI8B 4FL6A 2G6FX 3FRNA 2KGTA 4RG2A 3VUBA 1K73R 5LJ5g 4KGZB 4KUDK 2RQUA 1YIJQ 2LTOA 1SEMA 4M7AD 1YJ9T 2ATCB 1LOJA 1N8RR 4PLIA 2A36A 4C0GA 2SEMA 2QGFB 5EC7A 4M77G 2RK1A 4QVZA 1KIKA 1YJ9Q 1X6GA 2DXUA 3NPFA 1WZOA 2ROLA 3MHXA 1NG2A 4Y91A 2YXYA 2DBMA 1YNZA 4E7IA 2FEIA 4RMOA 2OTJA 2KXCA 1KHCA 3X25B 3JCMV 3I55T 4ZGDB 1JJ2S 2R57A 3ASKA 1UGRB 4M4ZA 1TTHB 1T0JA 3RERA 1QP2A 1TXQA 2EW3A 2GBQA 4PNOA 4XTWA 2CKKA 1FMVA 2IG0A 3I55Q 3JV3A 4BB7A 1KG1A 2VVKA 3JB9G 1WQWA 3R6OA 1W70A 4X1VA 2L0AA 4CC2A 4C92A 3OYJA 4IUQA 3VKIA 3OY9A 2VB6A 4RTYA 1VQLA 3PIOA 4DBHA 2YLCA 1QLYA 4KUIA 2YRDA 3TSZA 3CC4T 5IXBA 2IIMA 4JRIA 2BZ8A 3JB9F 2JM8A 1NJIU 1ABOA 5KCOA 2F2WA 3CC4Q 2BZYA 1VQLT 2E12A 4BY6C 1ZLMA 4PJMA 1MHNA 1K4US 4BACA 4HXJA 1CSKA 3V8LA 4C0FA 5KYWB 1UG1A 1G8XA 2HDAA 3CCQA 3BW1A 3NTIA 2KBTA 1VQLQ 2RH2A 1R0CB 3RR6A 2Y90A 3A1PA 4HCKA 5GAMj 4M7DC 2V8JA 5GJWB 3M53A 5AT1B 3OYAA 3RBBB 5IHIA 5DLOA 2JVVA 2IVWA 2L5QA 2EYYA 4L59A 2E41A 2HL3A 2JTEA 1R8OB 2RI2A 3JCMh 3KFVA 2LX7A 1HK9A 4A4GA 4M78E 2DA9A 2E1HA 5KYUB 5FW9A 3QJYA 2BZXA 5HY6A 2DIGA 4ZTJA 1TSFA 2EKOA 2YRCA 4RCCA 3CCQQ 5GAN8 1I07A 1WQ7A 3FDRA 4LDYA 4Y28E 3UA6A 3JCMf 4A4EA 3Q1JA 3C94A 4OB3B 3QPHA 3QYGB 1KK7A 4HT9A 2K4YA 3VS3A 5GANh 1IB8A 1KQSA 1X69A 2AIRB 3C12A 3M0TA 3G6ET 1SF9A 2KT1A 3RKXA 3QBYA 3SWNB 4GLKA 5LL6S 4M77B 1IHWA 5GAN3 1X6BA 2X4WA 2LC4A 4IIMA 3L42A 4M78G 3G6EQ 5KE3A 1W2BA 2YWWA 3OSSC 3LWHA 2D9TA 4J9EA 3ZFJA 3THKA 2VGMA 1WYXA 5KYXB 3JCMe 1R0BG 3KXTA 4E7HA 5IAYA 3OYFA 3E9FA 1NLPC 3IQLA 3V7SA 3D7SB 2B86A 3JCMb 3E2UA 2JS2A 1RL2A 4YTLA 1CKBA 3JAME 4M78F 4DOWA 1JBMA 2CP2A 2QQ9A 3E1SA 2M02A 1X27A 4XAXB 2LNHB 3ME9A 2DTIA 2FPFA 2E3HA 3HKSA 3ZBDA 3NTHA 1K9MR 1WDXA 2DRKA 2NUZA 1G3TA 3I56A 2QQRA 5HKCA 5GANe 3LLRA 3M56A 3BDUA 2BKDN 3EGDA 4DBRA 4E7JA 3EG0A 1KQSP 1N9RA 1QKWA 5LJ3e 3OYMA 3RKYA 3JB9D 2DNUA 2O9SA 4IUVA 2QASA 3SWNA 1R77A 2RJFA 1Q7YR 4LUEA 2GGRA 2XICA 3CCLA 4NS5A 4E7ZA 3M58A 1W2BP 3H0FA 2JS0A 1MNEA 4J83A 1VOMA 3M4GA 4Z8AA 1GFDA 4F14A 1TUDA 1M8MA 2NUPB 2QA4A 3QWYA 8AT1B 1U06A 2AKLA 1X01A 2HAXA 2LQNA 3CCMA 3M0SA 1XOVA 3QKJA 4XU0A 4C5EA 3CPWS 2OAWA 2CSQA 5KYNA 4L6V5 3EHRA 3TEEA 4JUVA 4E6RA 2LNVA 2EYQA 5CKHA 3VS1A 2RI5A 1M30A 3RDVA 3MEUA 4ZN1A 1UGSB 2QA4T 4OB0B 4CC4B 1M3BA 2KRMA 1TG0A 4PJLA 4KT0E 1KD1U 2K2MA 2PNIA 3PT9A 3UT1A 2K9GA 3CD6A 1FMWA 2DTOA 1B34B 2QA4Q 2EIFA 1W4SA 1BKBA 3HRSA 1ZSZC 3MEWA 1QCOA 1NBEB 1ZSZA 2CP5A 1RI9A 2LJ1A 3CMAA 3RMQA 1BK2A 2EKHA 2C0OA 5FRMA 4V2SA 2PUKB 1D0ZA 2X51A 3CC7A 2EQUA 2F2XA 1UGVA 1Y96A 2A3LA 1WHKA 2DAQA 3H41A 1VQMA 4J9HA 3OYLA 4D8DA 5LJ5h 4M75C 1TU0B 3BFMA 3EH2A 1JU5C 2DXBA 4C92E 1QVFS 1I8FA 3CD6Q 5J26A 2ZGWA 1C6VX 2LQWA 2MOXA 2RI3A 3CC7T 2KT8A 1RI0A 3HP9A 3RESA 3SB2A 2JT4A 4BI4A 3OYCA 2VC8A 1K76A 4E2FB 3RMSA 1D09B 4M78D 1UGPB 1WJQA 2DZCA 5LJ5f 2YUOA 3RKWA 3JCMQ 3REAB 4E7LA 2LCSA 1X2QA 1SHGA 3CC7Q 2CZ6B 2LQKA 2DD5A 4K11A 3HPWA 4RTZA 2FYKA 4JRKA 4J7FA 4RTXA 2BE9B 3L1AA 2JW4A 2YUPA 3MPUB 3MKDA 1Q86C 2LX9A 5KH6A 2QQAA 4C92G 3I35A 1B34A 3MP8A 1NEGA 3QO3A 4PJOC 1I1JA 9ATCB 4GLMA 4IUPA 4LXCA 4AFUC 2O31A 1OI1A 3GF5A 4JJCA 2EJFA 2HQXA 2D8JA 5LJ5e 5GANj 2D1XA 2LVMA 5I22A 1PSFA 4AG1C 2GNCA 3HL8A 4C92F 2H3EB 2XDPA 4Q5WA 1HYOA 5LJ3j 4HKEA 2EFIA 2VXFA 4E7SA 5FLXE 2WSCE 3M55A 2DK3A 2RF0A 1Y0MA 4C8QB 4EMKB 4F04B 3S3OA 1YCSB 4QVCA 1M1KR 1MMDA 1MGQA 1Z9ZA 5A0DA 4ELZC 5CKFA 1UFFA 5IHNA 1WXTA 1NYGA 1NPRA 3NFCA 4ZTFA 2PZ1A 2J6FA 3URGA 3G1JA 4C0ZA 2O4XA 4XQ3A 1KFZA 2EQMA 1FYNA 2PUOB 2VUBA 2ZCFB 1TS9A 3OMCA 1ZHIA 1UECA 1WGSA 2JNGA 2FRYA 4LNPA 5FU7C 4IUTA 1E6GA 4RG8A 3GLXA 3OYKA 2J6OA 3V8JA 2A28A 3PVQA 2E65A 1AWOA 3NMZC 4P5NA 2SRCA 2PVGB 5GAOl 3QSUA 3VS7A 2O88A 3MEVA 1LNXA 1PRMC 4F7UB 1FXXA 2QTXA 1NJIR 3X20B 5FU6C 3S3NA 4DQ2A 1GCPA 2NUTA 1OX8A 2L3SA 5L23A 4KH0B 1OULA 5FWCA 1KD1C 2JMAA 2E64A 1VQKA 1M27C 1Q81C 1YWOA 4EPCA 3FJPA 4C8QC 2JTFA 2OJ2A 3P8BB 2CZ1B 1BYMA 3CBPA 4C8QA 3QJ6A 2H8HA 4HVVA 1RLQC 3PMIA 2CP0A 3A8OB 1P92A 4UC4A 4JS4A 2RQWA 2JUFA 1IZ6A 3EFSA 1KC8U 2XI9A 1LJOA 5IT9E 1U8RA 5D6YA 2LP5A 2V8IA 2PVOB 3PE0A 4PFPA 2VGNA 2X4YA 3A8LB 3H0IA 3CBOA 3VJPA 3A98A 4XTYA 2PVDB 1VQ9A 2DRMA 4BE1A 2COYA 3ZL7C 1VYUA 4OMLA 5A0GA 1U5SA 1M9SA 3QIIA 1LPLA 1BI1A 2EJGA 4PK4A 2E6ZA 2NWMA 4LD6A 2L3RA 2CZ0B 2DEQA 1YHQT 3A8HB 4QKUA 2KRSA 4F7UA 2GTJA 4BY6B 2BTTA 1PD1A 2LT1A 1ZBJA 4C92D 4R55A 1VQ4A 2RQTA 2ABLA 1S72A 2DL3A 2HMAA 2FVUA 4GBQA 1YHQQ 2XK0A 2QEXA 4M7DB 2E4HA 2DFUA 4O6JA 5CIUA 1BIBA 3X28B 3ZEHA 2XDDA 1XQHA 3QDFA 3CMEA 1MV0B 1QWEA 2RHIA 4OMOA 1VQ4T 4M77F 3DLLA 1S72T 1TH7A 2QG9B 4LN2A 4B6MA 5GAN5 1I81A 1YBYA 3PIPA 1X6OA 3UWNA 2QEXT 1NZ9A 2FZCB 1AHJB 4WCIA 4X34A 3X26B 2OTJT 4M7AC 1VIFA 1VQ4Q 1BCOA 1S72Q 1PWTA 4M7AA 4N0AC 4HA8A 3CCVA 2QEXQ 4VUBA 3OYGA 4J5YA 2DX1A 4OP0A 4JRQA 1MV3A 2D6FA 2OTJQ 1N27A 4N0AA 1Q82U 2EGEA 2RHYA 3M9QA 3VS0A 3KUFA 1D1CA 2J6KA 1WI7A 3JCMc 3CMEQ 3J80E 1H92A 1K0SA 5C6SA 5IH2A 3MEAA 4J9CA 3OBYA 3I5RA 1GFCA 2KY9A 2RMOA 2EBPA 4RKUE 2MK5A 1ZBXA 2NYSA 2MWPA 4ORZA 2KE9A 2C0TA 2CUDA 4M7DA 4XTXA 1SSHA 4JJDA 2MWOA 2Y4XA 2E70A 1M1FA 2DILA 3A5ZB 5GMKh 3CCQT 3OW2S 2H3JA 5A0LA 3LX7A 5KYYA 4MZPA 2BE7D 1AT1B 1WHGA 1AD5A 2E6NA 3HHTB 2DBKA 1NE8A 4DA4A 1K1ZA 3MJXA 3HSBA 1SPKA 3C0CA 3EGDB 5I11A 5GMKl 2LCCA 1FMKA 1WHHA 3F70A 4X9CA 4EMGA 3LYIA 4LE9A 2K3BA 1OPLA 2MF2A 1M4ZA 3QDRB 2GFAA 1GRIA 3WVDB 3S3MA 2KEAA 2CP7A 4KH1B 2L8DA 1WHLA 1YFNA 4XTVA 2MMPA 1B3QA 5DLQE 1N8RU 4JRPA 2DZ9A 3VV0A 1Q86U 2HKNA 1YN8A 1M90C 2YUNA 3VYHB 1WHMA 2E5KA 1KC8C 2KYMA 4XU3A 1OZ3A 2QAZA 2RO0A 2KXDA 4LD9K 4MDXA 3WVEB 3V8KA 2PTKA 3LGFA
chains in the Genus database with same CATH topology
5GMKe 2PUKB 3AHUA 5CCAA 2EQJA 3CC7A 3CCST 1Q7YC 4BI3A 2EQUA 2ZPHB 2KDSA 1Y96A 2A3LA 3HRTA 3T9NA 4IKFA 2PQWA 4L5GA 2DAQA 3L2RA 5I2SA 1VQMA 3CMET 4M77D 1QVPA 4OGCA 3CC4A 3TU4K 4M7DD 3OYLA 3TREA 5FRNA 3VUZA 2ZPGB 4CI0C 4M75C 5LJ5h 4M75E 5GAMe 3EFRA 3BFMA 2QQBA 2P0QA 4OB1B 4XTZA 4C92C 2DXBA 1V29B 4C92E 1QVFS 1I8FA 5D6XA 5J26A 2ZGWA 1G3SA 3X24B 5CVIA 3CCJA 5GAMg 1WPYA 1G5VA 3CXCA 2RI3A 3CC7T 2RHXA 2X4JA 3BY7A 4MMKA 3HP9A 1RI0A 3RESA 2XIDA 3QYHB 3SB2A 4BI4A 3OYCA 3OB9A 2VC8A 2HQEA 3FEOA 2PU9B 1SSFA 1VQ5A 3RMSA 3DKMA 2E10A 2KMTA 4M78D 3CCVT 1UGPB 1WJQA 4C5HA 2DZCA 3M5AA 3RUXA 5LJ5f 2I2LA 3RKWA 3JCMQ 4QQ6A 1QVFA 4E7LA 5HK3A 2GFUA 1WNLA 1VQ6A 2CZ6B 2LQKA 3OQ5A 5M9OA 5HK0A 2FL7A 2DD5A 3QXEB 4Z02A 2CS7A 2L89A 4DOVA 3CEYA 3HPWA 2ZPFB 4PJOD 1XTDA 1XNIA 2D0QB 2FYKA 5CKBA 4JRKA 4J7FA 3H6ZA 4PKCC 3I56T 3EAEA 3L1AA 1DJ7B 4EMKC 4C5IA 3A8GB 4ME7A 4C8QE 1Y96B 3JRZA 4XTUA 2KQWA 4II1A 1Q86C 2LX9A 2KK4A 4M75G 3JCMX 3E19A 5KH6A 2QQAA 4EMKA 4J8OA 4C92G 3MP8A 1B34A 5J3BA 1PSEA 5GMKi 4OF1A 4OB2B 2MAMA 1VQ6T 1G3YA 4FSXA 3C4SA 3QO3A 4M77E 4PJOC 2DXTA 4PJOE 3JCMJ 4ELYC 4IUPA 4J7IA 2VYTA 4M75B 3BDLA 3CPFA 3LWIA 1YJ9A 4C92B 1OI1A 3GF5A 3GPLA 1KQ2A 2XKOC 2EJFA 1YIJT 2O01E 3J7AF 2HQXA 1YI2A 3PMTA 2VXEA 3V7RA 3CCLT 3META 2AHJB 4N4HA 2OAUA 4A4KA 4JLGA 5LJ5e 3OA6A 3CMAA 3OMGA 5GANj 1YHQA 1D3BA 1M8VA 4FM4B 4BI8B 4FL6A 1IREB 1Q82C 1YJWA 2LVMA 1YCYA 1PSFA 3A8MB 3FRNA 4M75F 4CRIA 3JCMd 4RG2A 5GAN4 3VUBA 5LJ5g 3HL8A 4C92F 3OYHA 4OGEA 4EDUA 4KUDK 3P8HA 2EQKA 2LTOA 4C5GA 2XDPA 3M59A 3G6EA 4Q5WA 5LJ3j 4HKEA 4C8QG 4M7AD 2EFIA 4BDZA 2P0PA 3O8VA 3L2UA 4FT2A 2ZPEB 5KCHA 1YJ9T 1K73U 4HT8A 2VXFA 2QQSA 3OYNA 2VV5A 1LOJA 5FLXE 1GXIE 5I2MA 1X75C 2WSCE 4F7UE 5GAOp 4PLIA 3CCMT 1YI2T 3M55A 1QVGS 2BIVA 4C0GA 4LDUA 2GF7A 3MP6A 3CC2A 2DK3A 2X4XA 2LCLA 1K8AU 3JB9H 4M77G 4C8QB 4EMKB 1Y7XA 4PJOG 3S3OA 1Q81U 2M0OA 4QVCA 2RK1A 3S6WA 5A2QE 4QVZA 4A4FA 1MGQA 2DXUA 5CQYA 3CCUA 5A0DA 3MHXA 1WJSA 4FT4A 4ELZC 4Y91A 4HCBA 4WF2A 1N9SA 4KBMB 5CKFA 4B9WA 5DM7R 5GANd 4E7IA 3HFNA 4JLIA 1Y71A 2LT4A 1YJNA 1NPRA 3OYEA 3NFCA 2K5FA 5GAN2 4ZTFA 4PJOB 4RMOA 2K2VA 2YHTA 3URGA 2OTJA 1KHCA 4C0ZA 2O4XA 3CBMA 4XQ3A 3X25B 3JCMV 5LJ3h 3LGLA 4ZGDB 2R57A 4R56A 2EQMA 3I55T 1JJ2S 3ASKA 2DVEA 2LRQA 1UGRB 3OS5A 3H8ZA 4N4IA 2PUOB 4PL6A 2VUBA 5LJ3d 1D3BB 2RB6A 2ZCFB 3QUIA 3JB9I 5GAN7 3CXCS 3CD6T 1KQ1A 3OMCA 3RERA 1ZHIA 5GANf 1QP2A 3E9GA 4BE0A 1WGSA 2JNGA 3PNWC 4V2SA 1I4K1 2RA2A 5FU7C 4PJOF 4NL3A 3G7ZA 4PNOA 4XTWA 4FIBA 3CCUT 2OTLA 4IUTA 3FLGA 2CKKA 2IG0A 4BB7A 1KG1A 3OYBA 4RG8A 3L2VA 4F7UG 4TVRA 2ZPBB 5CK9A 3GLXA 3JB9G 4JDSA 3OYKA 1WQWA 3NTKA 3R6OA 4QVDA 3JSCA 3V8JA 1O9SA 1JJ2A 2E65A 3INZA 5LJ3f 2XDBA 2RM4A 3QZ9B 4M75A 3CMAT 4P5NA 1EIFA 2PVGB 5GAOl 3QSUA 4C92A 4M7AE 2FB7A 3OYJA 4FU6A 4IUQA 3VKIA 1VQ8A 3OY9A 3MEVA 1LNXA 1VQLA 4F7UB 3PIOA 1FXXA 2YLCA 1VQMT 4BE2A 4KUIA 4HCZA 3OS0A 2OTLT 2QTXA 4IURA 3CC4T 3X20B 1BI0A 5FU6C 5I21A 2B8AA 3S3NA 4JRIA 4DQ2A 5GAOm 4Y28E 5AYFA 1UB4A 1BI2A 3JB9F 1NJIU 4KULA 4LDWA 1KD1C 3CCJT 2O4XB 4XU1A 5KCOA 1FWZA 2E64A 1VQKA 1Q81C 2G3RA 2F5KA 3HRUA 4EPCA 4N4GA 5GMKj 1N8RC 2E12A 3FJPA 1VQLT 4C8QC 2XD0A 4BY6C 3GP8A 1MHNA 2JTFA 2K3YA 1VQ5T 1BIAA 2NLUA 2RHZA 2CZ1B 3DB4A 3P8BB 4BACA 1BYMA 4C0FA 3V8LA 3CBPA 4C8QA 3QJ6A 4J6XA 5GAOn 4D6WA 2GCXA 3CCQA 2R5AA 2RK2A 3PMIA 3UPUA 3A8OB 1M1KC 1P92A 3BW1A 5FU7B 3NTIA 4M7AG 1VQNA 3SWNC 2RH2A 4M77C 4UC4A 2Y90A 4MMLA 5GAMj 4JS4A 2JUFA 2QXFA 2V8JA 4M7DC 3M53A 3OYAA 4M7DE 1IZ6A 5J39A 3EFSA 5DLOA 2JVVA 2XI9A 2IVWA 4M77A 3VYGA 1KC8U 4PJOA 2L5QA 1LJOA 4ZN3A 5IT9E 4L59A 1OYXA 2E41A 4XU2A 5D6YA 3SD4A 3OYIA 4MZTA 1U8RA 3KBGA 4ATOA 1VQ7A 3M4YA 2WSEE 2V8IA 1R8OB 2PVOB 2RI2A 2VGNA 2LDMA 3JCMh 2X4YA 3A8LB 1ZQ1A 3CBOA 3VJPA 4JJNK 1Q7YU 4XTYA 2PVDB 1VQ9A 1HK9A 3SFMA 4A4GA 4BE1A 2BUDA 1JB0E 3OS1A 1N8RU 4M78C 4M78E 3WXMB 4BUGA 2E1HA 5FU6B 5A0GA 1KQSS 3QJYA 1M9SA 3VU3C 3QIIA 4NL2A 4M78A 5HY6A 4LDVA 2DIGA 4ZGJB 1BI1A 3M54A 2F5TX 2EJGA 4ZTJA 2EKOA 4RCCA 2E6ZA 5GAN8 1JRIA 1WQ7A 3FDRA 2L3RA 1UEBA 3MP1A 4LD6A 2WSFE 4LDYA 2CZ0B 3Q1JA 3JCMf 3C94A 2DEQA 4A4EA 3PTAA 4OB3B 1YHQT 5GAMd 3A8HB 2R58A 2JTMA 5EG2A 4F7UA 1H641 3QPHA 3QYGB 1H3ZA 4M75D 4BY6B 1YJWT 4M7DG 4HT9A 1VUBA 2LT1A 1U1SA 2K4YA 4C92D 3L2QA 4R55A 3CCEA 1NPPA 3GIBA 5GANh 5GAOq 3FIFA 1VQ4A 1KQSA 5CAIA 1NJIC 3C12A 1S72A 3DB3A 3G6ET 3GOXA 2Y4YA 5KE2A 2FVUA 1VQPA 3RKXA 1OZ2A 2XK0A 2RJEA 4JS5A 2QEXA 3QBYA 4O5VA 4GLKA 5LL6S 4M77B 3SWNB 5GAMf 5GMKm 2YRVA 4M7DB 5GAN3 4C8QF 3CCRA 2XHCA 4BDYA 2R5MA 2X4WA 4OMFB 4E7KA 4O6JA 2LC4A 5CIUA 3CC2T 1BIBA 3X28B 3L42A 4M78G 3ZEHA 4QW2A 5KE3A 4EMHA 2XDDA 1XQHA 1KHIA 1W2BA 3CMEA 3OSVA 3OSSC 1VIEA 2RHIA 1VQ4T 4M77F 3LWHA 1VQOA 4J6WA 4M7DF 2D9TA 3DLLA 3C95A 2EWNA 1S72T 3L2ZA 3ZFJA 1TH7A 2E5QA 3JCMW 1N6AA 1I81A 1YBYA 2DTHA 2VGMA 5GAN5 2P4TA 1VQPT 1HXDA 1X6OA 3PIPA 3UWNA 4M78B 2QEXT 1NZ9A 3QG1A 3JCMe 1YJNT 1AHJB 4X34A 5IN1A 3KXTA 4XK8E 3X26B 2OTJT 4E7HA 3M57A 1QP3A 5IAYA 2RJDA 3OYFA 4M7AC 3E9FA 1VIFA 1Y07A 2YLBA 3V7SA 3JCMg 4MDWA 3UDCA 2X35A 3RMQA 3JCMb 4M7AA 3OBWA 1RL2A 4N0AC 3QZ5B 4HA8A 4YTLA 3CCVA 2CZ7B 4VUBA 3JAME 2QI2A 2V8KA 4J5YA 3LW5E 1JBMA 4M78F 4DOWA 3OYGA 4OP0A 2QQ9A 2P0KA 3E1SA 4QQGA 5CO7A 4JRQA 1N27A 1VQOT 2D6FA 4N0AA 2DO3A 1Q82U 4XAXB 2RHYA 1K73C 3ME9A 3M9QA 2DTIA 3TCJA 2KSSA 3FC3A 3KUFA 5LJ5d 3HKSA 3ZBDA 3NTHA 2F69A 2RD1A 2EAYA 4F7UF 2XG8D 3OYYA 3JCMc 4A53A 3L2WA 1G3TA 4PLLA 2K57A 2DIQA 2RHUA 1K8AC 4LDXA 2KAFA 3JB9J 3I56A 2QQRA 3J80E 5HKCA 5GANe 2HD0A 1VQ8T 3LLRA 3M56A 3BDUA 2CGHA 1K9MU 2BKDN 1BI3A 5C6SA 2QDYB 4E7JA 3MEAA 4QQDA 5GANg 2HNIA 3MO8A 1N9RA 2M1HA 3OBYA 3P8DA 2KY9A 5LJ3e 1G3WA 1U1TA 1FX7A 4RKUE 3OYMA 4NOYA 3RKYA 3JB9D 1ZBXA 4IUVA 2MWPA 2A7YA 5FROA 1M90U 3CCRT 4B9XA 3SDZA 2LQ8A 5LJ3g 2JOYA 2KVQG 3GNGA 2K5LA 3SWNA 4ZGEB 2RJFA 1YIJA 1VQKT 3PFSA 4M7DA 4XTXA 5GAOr 2XICA 4HCCA 3DLMA 3CCLA 2MWOA 2HBPA 4NS5A 2DKGA 2Y4XA 4M7AB 2C06A 2MI6A 3M58A 2GQVA 2E70A 1M1FA 3QHSA 3FB9A 5CKDA 2RJCA 3A5ZB 5GMKh 5FRMA 4J83A 3CCQT 3M4GA 4OVAA 1QW1A 3OW2S 1M1GA 3HFOA 2K5IA 2JN0A 2H3JA 4C0DC 1UGQB 5A0LA 1VQNT 3LX7A 2XU8A 4MZPA 2QA4A 3JCMP 4M7AF 1M5Q1 3ER0A 4A4HA 2E6NA 4BD3A 3HHTB 1NE8A 1X01A 3OS2A 2HAXA 3CCMA 3QKJA 1XOVA 4XU0A 4C5EA 5GAMh 3G4SA 3MCAB 3CPWS 4DA4A 4L6V5 3TEEA 1YITA 2WACA 4JUVA 1VQ7T 3HSBA 2LNVA 2EYQA 2ZZDA 5CKHA 4GY5A 2RI5A 5L8RE 5CQXA 3OW2A 5GMKl 5CKEA 3G71A 2DJZA 2LCCA 2DPPB 2CYZB 1VQ9T 3MEUA 3F70A 4ZN1A 1UGSB 2M16A 4X9CA 5DY9A 4EMGA 1W2BS 2FHDA 3LYIA 5D6WA 2QA4T 4OB0B 2MF2A 1M4ZA 3PGGA 1O75A 3CPWA 4RCBA 4X9DA 1I5LA 1K9MC 3QDRB 2GFAA 3I55A 3G4ST 3WVDB 3S3MA 4KT0E 2M9UA 2ZPIB 3V7CA 5CR2A 1YITT 1KD1U 3CCSA 3N5BB 3PT9A 3UT1A 2L8DA 3CD6A 3J81E 4A54A 2DTOA 4XTVA 5GAN6 1B34B 2MMPA 2DD4A 2EIFA 1W4SA 1BKBA 2EJ9A 5DLQE 2DZ9A 4E47A 5LJ5j 3G71T 2K3XA 4JRPA 3HRSA 3VV0A 1Q86U 3CCET 3MEWA 4IUUA 1M90C 2DXCA 3VYHB 3LH0A 1KC8C 1M1KU 1QVGA 4XU3A 1OZ3A 4C0DB 2RO0A 3OYDA 4LD9K 4MDXA 1WJRA 4C8QD 3WVEB 3V8KA 3GNFB 3LGFA 3RIRA 4J6YA 2JZ2A 4MZMA 5C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXI E;  2PUK B;  2WSC E;  2WSE E;  2ZPH B;  2PVO B;  3A8L B;  2QDY B;  2PVD B;  1JB0 E;  2ZPG B;  4RKU E;  4OB1 B;  2DXB A;  1V29 B;  4ZGJ B;  3X24 B;  4ZGE B;  3X25 B;  4ZGD B;  4Y28 E;  3QYH B;  1UGR B;  2WSF E;  2CZ0 B;  2PUO B;  4OB3 B;  2PU9 B;  2ZCF B;  3A8H B;  3QYG B;  1QP2 A;  1UGP B;  2CZ6 B;  1UGQ B;  2ZPB B;  2DD5 A;  3QXE B;  2ZPF B;  2D0Q B;  3QZ9 B;  3HHT B;  2PVG B;  1DJ7 B;  3A8G B;  4L6V 5;  3X28 B;  2ZZD A;  5L8R E;  1PSE A;  2DPP B;  2CYZ B;  4OB2 B;  3X20 B;  1UGS B;  4OB0 B;  1AHJ B;  4XK8 E;  3X26 B;  1QP3 A;  2O01 E;  3WVD B;  4KT0 E;  2ZPI B;  2AHJ B;  4FM4 B;  2CZ1 B;  2DD4 A;  3QZ5 B;  1IRE B;  2CZ7 B;  1PSF A;  3A8M B;  3LW5 E;  3A8O B;  2DXC A;  3VYH B;  2ZPE B;  3WVE B;  3VYG A; 
#chains in the Genus database with same CATH topology
 5GMK e;  3AHU A;  5CCA A;  2EQJ A;  1WIE A;  1RAG B;  1BB9 A;  4L5G A;  4M77 D;  4OGC A;  2KI7 A;  4CI0 C;  1C1A A;  4AT1 B;  4FYV B;  5D6X A;  1LVK A;  1G3S A;  3CCJ A;  2W10 A;  1G5V A;  4MMK A;  1BBZ A;  3OB9 A;  3FEO A;  1XJW B;  1VQ5 A;  2KMT A;  2DL7 A;  2RPN A;  3M5A A;  4R0K A;  1G83 A;  1WNL A;  2GFU A;  3OQ5 A;  1PG5 B;  2YDL A;  1PM3 A;  1ZSZ B;  2DM1 A;  2L89 A;  4DOV A;  2D0Q B;  2KRO A;  1PRL C;  5CKB A;  4J9B A;  3VRZ A;  4PKC C;  3I56 T;  1DJ7 B;  4C8Q E;  4ME7 A;  1Y96 B;  2CRE A;  3JRZ A;  2CSI A;  4JPB W;  2EGC A;  2COW A;  4J8O A;  4OB2 B;  1SHF A;  3I56 Q;  3C4S A;  3EG2 A;  4AG2 C;  4ELY C;  1GBQ A;  2P84 A;  4M75 B;  3BDL A;  1IO6 A;  2D8H A;  3LWI A;  2MIO A;  1YI2 A;  3CCL T;  3V7R A;  4JLG A;  3OMG A;  1M8V A;  1D3B A;  2DEU A;  1Q82 C;  1YJW A;  1YCY A;  4CRI A;  5GAN 4;  3OYH A;  4OGE A;  4EDU A;  3P8H A;  2EQK A;  4DBF A;  4C5G A;  3CCL Q;  1VYV A;  4C8Q G;  4BDZ A;  3L2U A;  3O8V A;  5KCH A;  1MND A;  2ZPE B;  2JM9 A;  2VV5 A;  1A0N B;  4F7U E;  3CCM T;  3LH5 A;  1YI2 T;  1KSW A;  4LDU A;  2GF7 A;  3MP6 A;  3CC2 A;  2X4X A;  1K8A U;  1Q81 U;  1Y7X A;  2M0O A;  3S6W A;  5A2Q E;  4A4F A;  2HSE B;  3CCU A;  1WJS A;  4FT4 A;  4ZNX A;  3CCM Q;  1YI2 Q;  4HCB A;  1N9S A;  4KBM B;  3HFN A;  4JLI A;  1YJN A;  2K5F A;  4PJO B;  2K2V A;  2YHT A;  4HCC A;  3LGL A;  3EFO B;  4R56 A;  2AKK A;  2DVE A;  2RB6 A;  3JB9 I;  3CXC S;  3CD6 T;  3EG9 B;  4BE0 A;  2FPE A;  2RA2 A;  3GBQ A;  4NL3 A;  3G7Z A;  3CCU T;  1SRL A;  4PJN A;  3FLG A;  1AVZ C;  2DMO A;  3OYB A;  3L2V A;  4F7U G;  1RAH B;  3NTK A;  2CH4 A;  4WTO B;  1TUG B;  1JJ2 A;  3VS6 A;  2RM4 A;  4M75 A;  3CMA T;  4M7A E;  1D0Y A;  2FB7 A;  3CCU Q;  1VQ8 A;  2FZK B;  2DJQ A;  1NLO C;  3SHW A;  1VQM T;  2KNB B;  5GJV B;  4HCZ A;  4BE2 A;  1IRX A;  3NGP A;  5I21 A;  3CMA Q;  1ZSG A;  5AYF A;  1RAI B;  2O4X B;  1VQM Q;  2FO0 A;  4XU1 A;  3I5S A;  1FWZ A;  1UHC A;  2DE0 X;  5GMK j;  1N8R C;  1UE9 A;  2K3Y A;  1BIA A;  1ZUY A;  4J6X A;  2R5A A;  2RK2 A;  3UPU A;  4ESR A;  1SRM A;  2EQI A;  5FU7 B;  3R6N A;  4M7A G;  1VQN A;  1QMC A;  4M7D E;  2QGG A;  3EGX B;  2RQV A;  5IHK A;  3FJ5 A;  5ECA A;  3VYG A;  4PJO A;  4ZN3 A;  2EYW A;  4XU2 A;  3SD4 A;  3EFO A;  3KBG A;  1VQ7 A;  3M4Y A;  1QKX A;  1Q7Y U;  2KRN A;  2FRW A;  4A63 B;  3EG9 A;  1ABQ A;  1JB0 E;  2NUT B;  3OS1 A;  4M78 C;  1WHJ A;  4BUG A;  5FU6 B;  1JJ2 P;  4AFQ C;  2HKQ B;  1KQS S;  1UJY A;  3VU3 C;  4NL2 A;  4M78 A;  4ZGJ B;  1UEB A;  2WSF E;  3PTA A;  4J9F A;  5GAM d;  2R58 A;  2JTM A;  5EG2 A;  2MPX C;  4J9D A;  1H3Z A;  4M7D G;  1U1S A;  2K7A A;  3CCE A;  5GAO q;  5CAI A;  1VQ7 Q;  3GOX A;  2Y4Y A;  1N5Z A;  1AOJ A;  5KE2 A;  1VQP A;  2RJE A;  4JS5 A;  4OMQ A;  5GMK m;  5GAM f;  3CCR A;  2XHC A;  4BDY A;  2FPD A;  2R5M A;  4OMF B;  4Z89 A;  4D8K A;  2O2O A;  3RNJ A;  2L3P A;  1I0C A;  2ZAE A;  2DL4 A;  1VQO A;  4M7D F;  3C95 A;  1ZUU A;  3JCM W;  2QDL A;  1PHT A;  3EG3 A;  1VQP T;  1PD0 A;  2P4T A;  4PFO A;  2Z0W A;  1D0X A;  4XK8 E;  1HJD A;  3EGX A;  3M57 A;  1QP3 A;  3UDC A;  1Q82 R;  2JMC A;  1Q95 G;  1C0M A;  1M3C A;  3OBW A;  1VQP Q;  3UA7 A;  2QI2 A;  1ZUK A;  5CO7 A;  2P0K A;  2P4R A;  4QQG A;  1VQO T;  1V1C A;  2VWF A;  1T0H A;  3M0Q A;  3FC3 A;  2F69 A;  1RAE B;  2XG8 D;  3OYY A;  4A53 A;  3L2W A;  2GTO A;  2RHU A;  1K8A C;  4KRT A;  3JB9 J;  1VQO Q;  2HD0 A;  4OMM A;  1V76 A;  4FSS A;  1PKS A;  1BI3 A;  1I5O B;  1WX6 A;  1VYT A;  1PNJ A;  3MO8 A;  3TVT A;  1G3W A;  1U1T A;  2CT4 A;  4NOY A;  1WA7 A;  2MYS A;  5FRO A;  1M90 U;  2KVQ G;  4PJJ A;  1JO8 A;  2K5L A;  1YIJ A;  1VQK T;  3PFS A;  5GAO r;  3DLM A;  1RAB B;  3HTR A;  2DKG A;  4M7A B;  2C06 A;  2CDT A;  2MI6 A;  2GQV A;  1T3L A;  2RJC A;  1QW1 A;  1M1G A;  3HFO A;  2K5I A;  1VQK Q;  2JN0 A;  5HCK A;  4C0D C;  1UGQ B;  1NM7 A;  2XU8 A;  4HVW A;  1M5Q 1;  4IIO A;  4BD3 A;  2EYX A;  1NYF A;  3MCA B;  1YIT A;  2ZZD A;  4RTU A;  4GY5 A;  2L3Q A;  5CQX A;  5CKE A;  2DJZ A;  1UHF A;  1VQ9 T;  2CYZ B;  1EFN A;  1RUW A;  1UDL A;  2FHD A;  4J9I A;  3PGG A;  3CPW A;  1BCM A;  4X9D A;  1K9M C;  3I55 A;  1VQ9 Q;  1Q86 R;  2M9U A;  2LZ6 B;  2ZPI B;  5CR2 A;  1YIT T;  3N5B B;  3J81 E;  4A54 A;  4FYX B;  1HD3 A;  2DD4 A;  2EJ9 A;  5LJ5 j;  2K3X A;  2HBW A;  2RNA A;  1F1B B;  2OX7 A;  4IUU A;  1WXU A;  2DLP A;  1OU9 A;  2DXC A;  1YIT Q;  5KYY B;  1M1K U;  1CKA A;  1WJR A;  4J6Y A;  1AWW A;  2JZ2 A;  1WXB A;  1WLP B;  2KYB A;  1Q7Y C;  2KDS A;  3T9N A;  2RN8 A;  3L2R A;  1HSQ A;  5I2S A;  1UUE A;  1RAF B;  3CME T;  1QVP A;  3CC4 A;  3TU4 K;  1B7T A;  4M7D D;  3VUZ A;  2ZPG B;  4M75 E;  3EFR A;  4RTW A;  2QQB A;  4OB1 B;  4C92 C;  1V29 B;  2QTV A;  3X24 B;  3VS5 A;  5GAM g;  4FW2 A;  1WPY A;  3CXC A;  3BY7 A;  3QYH B;  1SSF A;  2COZ A;  3CCV T;  1B07 A;  2CT3 A;  4C5H A;  3RUX A;  1D1A A;  4QQ6 A;  1QVF A;  5HK3 A;  2DL8 A;  1E6H A;  3PVL A;  2FL7 A;  2A0F B;  1EX4 A;  3CPW P;  3QXE B;  1GCQ C;  4Z02 A;  2CS7 A;  2QYZ A;  3CEY A;  1X2K A;  1XNI A;  2DER A;  3CCV Q;  1GCQ A;  3H6Z A;  3EAE A;  2M0Y A;  4KGX B;  4XTU A;  4II1 A;  2KK4 A;  4M75 G;  1TWB A;  3E19 A;  3EG1 A;  5J3B A;  1PSE A;  5GMK i;  1G3Y A;  2EGA A;  3AT1 B;  4PJO E;  2QK0 A;  2K6D A;  2HQH A;  6AT1 B;  3CPF A;  1ZA1 B;  4JZ3 A;  1UTI A;  2LMJ A;  2ED1 A;  1KQ2 A;  3J7A F;  3PMT A;  2VXE A;  4A4K A;  4N4H A;  1IRE B;  2MCN A;  3A8M B;  3JCM d;  4M75 F;  1AWJ A;  3M59 A;  3G6E A;  4DBQ A;  1KD1 R;  2K79 A;  1M2O A;  1K8A R;  2FG0 A;  2P0P A;  2CP3 A;  4FT2 A;  1K73 U;  2JJ9 A;  3CXC P;  1Q81 R;  4HT8 A;  2QQS A;  3OYN A;  2J05 A;  1GXI E;  5I2M A;  1RAD B;  1X75 C;  5GAO p;  4Y92 A;  1QVG S;  2BIV A;  1OEB A;  2LCL A;  3JB9 H;  4PJO G;  1AEY A;  1QVF P;  5CQY A;  1W6X A;  2DYB A;  1W1F A;  1MMA A;  1TUC A;  4WF2 A;  4B9W A;  5DM7 R;  5GAN d;  1Y71 A;  2LT4 A;  3UAT A;  3OYE A;  4J9G A;  5GAN 2;  2V26 A;  4ANJ A;  3CBM A;  5LJ3 h;  2LRQ A;  3OS5 A;  4N4I A;  3H8Z A;  3NHN A;  4PL6 A;  5LJ3 d;  1D3B B;  3QUI A;  2YSQ A;  5GAN 7;  1KQ1 A;  5GAN f;  3E9G A;  1ZX6 A;  1SKU B;  1Y57 A;  3PNW C;  5KYW A;  1I4K 1;  4AFZ C;  4PJO F;  2OTL A;  4FIB A;  2FZG B;  2HSP A;  2RQR A;  4TVR A;  2LJ3 A;  2ZPB B;  5CK9 A;  4JDS A;  2HL5 C;  4QVD A;  3JSC A;  4KGV B;  1O9S A;  3INZ A;  5LJ3 f;  2XDB A;  3QZ9 B;  1S1N A;  1EIF A;  4FU6 A;  3I9Q A;  2EPD A;  2KR3 A;  4OMN A;  3OS0 A;  2OTL T;  4IUR A;  3UF4 A;  1BI0 A;  2B8A A;  5GAO m;  5KYU A;  1BI2 A;  1UB4 A;  2DYI A;  2IPO B;  4JJB A;  2ROT A;  4KUL A;  1OX9 A;  4LDW A;  1OPK A;  3CCJ T;  2OTL Q;  2G3R A;  2F5K A;  3HRU A;  4N4G A;  2XD0 A;  3VS4 A;  1ARK A;  3GP8 A;  1VQ5 T;  1IHV A;  2NLU A;  2RHZ A;  2D0N A;  3DB4 A;  2CP6 A;  5GAO n;  4D6W A;  2GCX A;  3CCJ Q;  4CC3 A;  1K0X A;  2EYZ A;  1M1K C;  2AK5 A;  4RUG A;  5FWB A;  3SWN C;  4M77 C;  3SEM A;  4MML A;  1OV3 A;  2QXF A;  1VQ5 Q;  5J39 A;  4M77 A;  2X9H A;  1UJ0 A;  1OYX A;  3OYI A;  4ATO A;  4MZT A;  1JXM A;  8ATC B;  2WSE E;  2HCK A;  2JXB A;  2LDM A;  1ACM B;  1T3S A;  1ZQ1 A;  4OMP A;  4JJN K;  2V1R A;  3SFM A;  2BUD A;  1SG5 A;  4PFZ A;  1LCK A;  2VKN A;  3WXM B;  1G2B A;  1M3A A;  4Z88 A;  5KYX A;  4LDV A;  3M54 A;  2F5T X;  2A08 A;  1RAC B;  1OOT A;  1JRI A;  3MP1 A;  1JEG A;  1H64 1;  4M75 D;  1YJW T;  1OQK A;  1QQJ A;  2X3W D;  1VUB A;  3GIB A;  3L2Q A;  2GQI A;  1NPP A;  4DEY A;  2X3X D;  3FIF A;  2DVJ A;  1NJI C;  1X43 A;  3DB3 A;  2AT1 B;  3REB B;  3M0U A;  1OZ2 A;  1AZG B;  4O5V A;  1OU8 A;  3QWX X;  2YRV A;  1YJW Q;  1BU1 A;  4C8Q F;  4AMC A;  4E7K A;  3CC2 T;  1EZZ B;  4EIK A;  4QW2 A;  5IXF A;  4EMH A;  1KHI A;  1U3O A;  3OSV A;  1VIE A;  1M2V B;  4J6W A;  1H8K A;  2YUQ A;  2EWN A;  3L2Z A;  2E5Q A;  1PC0 A;  2ENM A;  1N6A A;  2DTH A;  3CC2 Q;  1HXD A;  4M78 B;  1YJN T;  3QG1 A;  1D1B A;  5IN1 A;  1YWP A;  1JXO A;  2RJD A;  2VAS A;  1Y07 A;  2YLB A;  2YT6 A;  3JCM g;  4MDW A;  2X35 A;  2J7I A;  3QZ5 B;  1YJN Q;  2CZ7 B;  2V8K A;  4PJO D;  3LW5 E;  3M0P A;  2DO3 A;  1K73 C;  2NUP A;  3TCJ A;  2KSS A;  1JQQ A;  5LJ5 d;  2RD1 A;  3EH1 A;  2EAY A;  2W0Z A;  4F7U F;  4PLL A;  1TOV A;  2K57 A;  2DIQ A;  4LDX A;  2KAF A;  4AFS C;  1VQ8 T;  1WFW A;  2CGH A;  1K9M U;  1RLP C;  2QDY B;  4QQD A;  5GAN g;  2HNI A;  1M90 R;  1IXD A;  2M1H A;  3P8D A;  1KC8 R;  7AT1 B;  4LUD A;  3H9N A;  1H3H A;  1FX7 A;  1VQ8 Q;  1QCF A;  3TSW A;  2A7Y A;  3EGU A;  4B9X A;  4FW1 A;  2LQ8 A;  3SDZ A;  5LJ3 g;  2JOY A;  3GNG A;  4ZGE B;  1GL5 A;  2HBP A;  2F1L A;  1VA7 A;  1AWX A;  2XMF A;  1GBR A;  3QHS A;  3FB9 A;  5CKD A;  1MMG A;  4OVA A;  1M2V A;  1MUZ A;  1VQN T;  1Z9Q A;  1YP5 A;  3JCM P;  2EVR A;  4F16 A;  4M7A F;  4RTT A;  1QCN A;  3ER0 A;  4A4H A;  3OS2 A;  1PCX A;  3H0H A;  3G4S A;  5GAM h;  4CC7 A;  1VQ7 T;  1MMN A;  2WAC A;  1VQN Q;  3M0R A;  5L8R E;  3OW2 A;  3U23 A;  1NEB A;  3G71 A;  3ULR B;  2DPP B;  2M16 A;  5DY9 A;  1W2B S;  2HEQ A;  5D6W A;  1KJW A;  1O75 A;  4RCB A;  1I5L A;  3G4S T;  3V7C A;  3CCS A;  2DL5 A;  5GAN 6;  4JZ4 A;  3CQT A;  3G71 T;  1AZE A;  4E47 A;  1IGU A;  2O9V A;  3CCE T;  3BE3 A;  3G4S Q;  4FYY B;  2LJ0 A;  2DF6 A;  3LH0 A;  1QVG A;  2E3I A;  4C0D B;  3OYD A;  2I0N A;  4C8Q D;  3G71 Q;  3GNF B;  3RIR A;  4MZM A;  4RTV A;  5C0M A;  3CCR T;  4HVU A;  3CCE Q;  3CCS T;  4BI3 A;  2ZPH B;  3HRT A;  1PKT A;  4IKF A;  2PQW A;  2J06 A;  1E7O A;  1IGQ A;  1QWF A;  2CH4 W;  2ESW A;  3TRE A;  3CCR Q;  1K9A A;  5FRN A;  4FCY A;  5GAM e;  3CCS Q;  2P0Q A;  4F17 A;  4XTZ A;  5D7U A;  2C0I A;  4DEX A;  5CVI A;  4QT7 A;  3VS2 A;  2A37 A;  2RHX A;  2X4J A;  2XID A;  3OW2 P;  2HQE A;  2PU9 B;  3DKM A;  2E10 A;  2I2L A;  1VQ6 A;  2OI3 A;  5M9O A;  5HK0 A;  1J3T A;  2ZPF B;  2CUB A;  2ECZ A;  1XTD A;  2DET A;  2AZS A;  2F2V A;  4EMK C;  4C5I A;  3A8G B;  2L2P A;  2KQW A;  2AZV A;  3VRY A;  3JCM X;  3O5Z A;  4FYW B;  4EMK A;  2ED0 A;  4OF1 A;  2MAM A;  1VQ6 T;  4FSX A;  2M51 A;  4M77 E;  2DXT A;  1QVG P;  3JCM J;  3TQ7 P;  4J7I A;  2VYT A;  1YJ9 A;  4C92 B;  1ZA2 B;  3GPL A;  2HZY A;  2XKO C;  1YIJ T;  2O01 E;  2V1Q A;  3EHQ A;  1RAA B;  1VQ6 Q;  3MET A;  2AHJ B;  2OAU A;  1YHQ A;  3OA6 A;  4FM4 B;  4BI8 B;  4FL6 A;  2G6F X;  3FRN A;  2KGT A;  4RG2 A;  3VUB A;  1K73 R;  5LJ5 g;  4KGZ B;  4KUD K;  2RQU A;  1YIJ Q;  2LTO A;  1SEM A;  4M7A D;  1YJ9 T;  2ATC B;  1LOJ A;  1N8R R;  4PLI A;  2A36 A;  4C0G A;  2SEM A;  2QGF B;  5EC7 A;  4M77 G;  2RK1 A;  4QVZ A;  1KIK A;  1YJ9 Q;  1X6G A;  2DXU A;  3NPF A;  1WZO A;  2ROL A;  3MHX A;  1NG2 A;  4Y91 A;  2YXY A;  2DBM A;  1YNZ A;  4E7I A;  2FEI A;  4RMO A;  2OTJ A;  2KXC A;  1KHC A;  3X25 B;  3JCM V;  3I55 T;  4ZGD B;  1JJ2 S;  2R57 A;  3ASK A;  1UGR B;  4M4Z A;  1TTH B;  1T0J A;  3RER A;  1QP2 A;  1TXQ A;  2EW3 A;  2GBQ A;  4PNO A;  4XTW A;  2CKK A;  1FMV A;  2IG0 A;  3I55 Q;  3JV3 A;  4BB7 A;  1KG1 A;  2VVK A;  3JB9 G;  1WQW A;  3R6O A;  1W70 A;  4X1V A;  2L0A A;  4CC2 A;  4C92 A;  3OYJ A;  4IUQ A;  3VKI A;  3OY9 A;  2VB6 A;  4RTY A;  1VQL A;  3PIO A;  4DBH A;  2YLC A;  1QLY A;  4KUI A;  2YRD A;  3TSZ A;  3CC4 T;  5IXB A;  2IIM A;  4JRI A;  2BZ8 A;  3JB9 F;  2JM8 A;  1NJI U;  1ABO A;  5KCO A;  2F2W A;  3CC4 Q;  2BZY A;  1VQL T;  2E12 A;  4BY6 C;  1ZLM A;  4PJM A;  1MHN A;  1K4U S;  4BAC A;  4HXJ A;  1CSK A;  3V8L A;  4C0F A;  5KYW B;  1UG1 A;  1G8X A;  2HDA A;  3CCQ A;  3BW1 A;  3NTI A;  2KBT A;  1VQL Q;  2RH2 A;  1R0C B;  3RR6 A;  2Y90 A;  3A1P A;  4HCK A;  5GAM j;  4M7D C;  2V8J A;  5GJW B;  3M53 A;  5AT1 B;  3OYA A;  3RBB B;  5IHI A;  5DLO A;  2JVV A;  2IVW A;  2L5Q A;  2EYY A;  4L59 A;  2E41 A;  2HL3 A;  2JTE A;  1R8O B;  2RI2 A;  3JCM h;  3KFV A;  2LX7 A;  1HK9 A;  4A4G A;  4M78 E;  2DA9 A;  2E1H A;  5KYU B;  5FW9 A;  3QJY A;  2BZX A;  5HY6 A;  2DIG A;  4ZTJ A;  1TSF A;  2EKO A;  2YRC A;  4RCC A;  3CCQ Q;  5GAN 8;  1I07 A;  1WQ7 A;  3FDR A;  4LDY A;  4Y28 E;  3UA6 A;  3JCM f;  4A4E A;  3Q1J A;  3C94 A;  4OB3 B;  3QPH A;  3QYG B;  1KK7 A;  4HT9 A;  2K4Y A;  3VS3 A;  5GAN h;  1IB8 A;  1KQS A;  1X69 A;  2AIR B;  3C12 A;  3M0T A;  3G6E T;  1SF9 A;  2KT1 A;  3RKX A;  3QBY A;  3SWN B;  4GLK A;  5LL6 S;  4M77 B;  1IHW A;  5GAN 3;  1X6B A;  2X4W A;  2LC4 A;  4IIM A;  3L42 A;  4M78 G;  3G6E Q;  5KE3 A;  1W2B A;  2YWW A;  3OSS C;  3LWH A;  2D9T A;  4J9E A;  3ZFJ A;  3THK A;  2VGM A;  1WYX A;  5KYX B;  3JCM e;  1R0B G;  3KXT A;  4E7H A;  5IAY A;  3OYF A;  3E9F A;  1NLP C;  3IQL A;  3V7S A;  3D7S B;  2B86 A;  3JCM b;  3E2U A;  2JS2 A;  1RL2 A;  4YTL A;  1CKB A;  3JAM E;  4M78 F;  4DOW A;  1JBM A;  2CP2 A;  2QQ9 A;  3E1S A;  2M02 A;  1X27 A;  4XAX B;  2LNH B;  3ME9 A;  2DTI A;  2FPF A;  2E3H A;  3HKS A;  3ZBD A;  3NTH A;  1K9M R;  1WDX A;  2DRK A;  2NUZ A;  1G3T A;  3I56 A;  2QQR A;  5HKC A;  5GAN e;  3LLR A;  3M56 A;  3BDU A;  2BKD N;  3EGD A;  4DBR A;  4E7J A;  3EG0 A;  1KQS P;  1N9R A;  1QKW A;  5LJ3 e;  3OYM A;  3RKY A;  3JB9 D;  2DNU A;  2O9S A;  4IUV A;  2QAS A;  3SWN A;  1R77 A;  2RJF A;  1Q7Y R;  4LUE A;  2GGR A;  2XIC A;  3CCL A;  4NS5 A;  4E7Z A;  3M58 A;  1W2B P;  3H0F A;  2JS0 A;  1MNE A;  4J83 A;  1VOM A;  3M4G A;  4Z8A A;  1GFD A;  4F14 A;  1TUD A;  1M8M A;  2NUP B;  2QA4 A;  3QWY A;  8AT1 B;  1U06 A;  2AKL A;  1X01 A;  2HAX A;  2LQN A;  3CCM A;  3M0S A;  1XOV A;  3QKJ A;  4XU0 A;  4C5E A;  3CPW S;  2OAW A;  2CSQ A;  5KYN A;  4L6V 5;  3EHR A;  3TEE A;  4JUV A;  4E6R A;  2LNV A;  2EYQ A;  5CKH A;  3VS1 A;  2RI5 A;  1M30 A;  3RDV A;  3MEU A;  4ZN1 A;  1UGS B;  2QA4 T;  4OB0 B;  4CC4 B;  1M3B A;  2KRM A;  1TG0 A;  4PJL A;  4KT0 E;  1KD1 U;  2K2M A;  2PNI A;  3PT9 A;  3UT1 A;  2K9G A;  3CD6 A;  1FMW A;  2DTO A;  1B34 B;  2QA4 Q;  2EIF A;  1W4S A;  1BKB A;  3HRS A;  1ZSZ C;  3MEW A;  1QCO A;  1NBE B;  1ZSZ A;  2CP5 A;  1RI9 A;  2LJ1 A;  3CMA A;  3RMQ A;  1BK2 A;  2EKH A;  2C0O A;  5FRM A;  4V2S A;  2PUK B;  1D0Z A;  2X51 A;  3CC7 A;  2EQU A;  2F2X A;  1UGV A;  1Y96 A;  2A3L A;  1WHK A;  2DAQ A;  3H41 A;  1VQM A;  4J9H A;  3OYL A;  4D8D A;  5LJ5 h;  4M75 C;  1TU0 B;  3BFM A;  3EH2 A;  1JU5 C;  2DXB A;  4C92 E;  1QVF S;  1I8F A;  3CD6 Q;  5J26 A;  2ZGW A;  1C6V X;  2LQW A;  2MOX A;  2RI3 A;  3CC7 T;  2KT8 A;  1RI0 A;  3HP9 A;  3RES A;  3SB2 A;  2JT4 A;  4BI4 A;  3OYC A;  2VC8 A;  1K76 A;  4E2F B;  3RMS A;  1D09 B;  4M78 D;  1UGP B;  1WJQ A;  2DZC A;  5LJ5 f;  2YUO A;  3RKW A;  3JCM Q;  3REA B;  4E7L A;  2LCS A;  1X2Q A;  1SHG A;  3CC7 Q;  2CZ6 B;  2LQK A;  2DD5 A;  4K11 A;  3HPW A;  4RTZ A;  2FYK A;  4JRK A;  4J7F A;  4RTX A;  2BE9 B;  3L1A A;  2JW4 A;  2YUP A;  3MPU B;  3MKD A;  1Q86 C;  2LX9 A;  5KH6 A;  2QQA A;  4C92 G;  3I35 A;  1B34 A;  3MP8 A;  1NEG A;  3QO3 A;  4PJO C;  1I1J A;  9ATC B;  4GLM A;  4IUP A;  4LXC A;  4AFU C;  2O31 A;  1OI1 A;  3GF5 A;  4JJC A;  2EJF A;  2HQX A;  2D8J A;  5LJ5 e;  5GAN j;  2D1X A;  2LVM A;  5I22 A;  1PSF A;  4AG1 C;  2GNC A;  3HL8 A;  4C92 F;  2H3E B;  2XDP A;  4Q5W A;  1HYO A;  5LJ3 j;  4HKE A;  2EFI A;  2VXF A;  4E7S A;  5FLX E;  2WSC E;  3M55 A;  2DK3 A;  2RF0 A;  1Y0M A;  4C8Q B;  4EMK B;  4F04 B;  3S3O A;  1YCS B;  4QVC A;  1M1K R;  1MMD A;  1MGQ A;  1Z9Z A;  5A0D A;  4ELZ C;  5CKF A;  1UFF A;  5IHN A;  1WXT A;  1NYG A;  1NPR A;  3NFC A;  4ZTF A;  2PZ1 A;  2J6F A;  3URG A;  3G1J A;  4C0Z A;  2O4X A;  4XQ3 A;  1KFZ A;  2EQM A;  1FYN A;  2PUO B;  2VUB A;  2ZCF B;  1TS9 A;  3OMC A;  1ZHI A;  1UEC A;  1WGS A;  2JNG A;  2FRY A;  4LNP A;  5FU7 C;  4IUT A;  1E6G A;  4RG8 A;  3GLX A;  3OYK A;  2J6O A;  3V8J A;  2A28 A;  3PVQ A;  2E65 A;  1AWO A;  3NMZ C;  4P5N A;  2SRC A;  2PVG B;  5GAO l;  3QSU A;  3VS7 A;  2O88 A;  3MEV A;  1LNX A;  1PRM C;  4F7U B;  1FXX A;  2QTX A;  1NJI R;  3X20 B;  5FU6 C;  3S3N A;  4DQ2 A;  1GCP A;  2NUT A;  1OX8 A;  2L3S A;  5L23 A;  4KH0 B;  1OUL A;  5FWC A;  1KD1 C;  2JMA A;  2E64 A;  1VQK A;  1M27 C;  1Q81 C;  1YWO A;  4EPC A;  3FJP A;  4C8Q C;  2JTF A;  2OJ2 A;  3P8B B;  2CZ1 B;  1BYM A;  3CBP A;  4C8Q A;  3QJ6 A;  2H8H A;  4HVV A;  1RLQ C;  3PMI A;  2CP0 A;  3A8O B;  1P92 A;  4UC4 A;  4JS4 A;  2RQW A;  2JUF A;  1IZ6 A;  3EFS A;  1KC8 U;  2XI9 A;  1LJO A;  5IT9 E;  1U8R A;  5D6Y A;  2LP5 A;  2V8I A;  2PVO B;  3PE0 A;  4PFP A;  2VGN A;  2X4Y A;  3A8L B;  3H0I A;  3CBO A;  3VJP A;  3A98 A;  4XTY A;  2PVD B;  1VQ9 A;  2DRM A;  4BE1 A;  2COY A;  3ZL7 C;  1VYU A;  4OML A;  5A0G A;  1U5S A;  1M9S A;  3QII A;  1LPL A;  1BI1 A;  2EJG A;  4PK4 A;  2E6Z A;  2NWM A;  4LD6 A;  2L3R A;  2CZ0 B;  2DEQ A;  1YHQ T;  3A8H B;  4QKU A;  2KRS A;  4F7U A;  2GTJ A;  4BY6 B;  2BTT A;  1PD1 A;  2LT1 A;  1ZBJ A;  4C92 D;  4R55 A;  1VQ4 A;  2RQT A;  2ABL A;  1S72 A;  2DL3 A;  2HMA A;  2FVU A;  4GBQ A;  1YHQ Q;  2XK0 A;  2QEX A;  4M7D B;  2E4H A;  2DFU A;  4O6J A;  5CIU A;  1BIB A;  3X28 B;  3ZEH A;  2XDD A;  1XQH A;  3QDF A;  3CME A;  1MV0 B;  1QWE A;  2RHI A;  4OMO A;  1VQ4 T;  4M77 F;  3DLL A;  1S72 T;  1TH7 A;  2QG9 B;  4LN2 A;  4B6M A;  5GAN 5;  1I81 A;  1YBY A;  3PIP A;  1X6O A;  3UWN A;  2QEX T;  1NZ9 A;  2FZC B;  1AHJ B;  4WCI A;  4X34 A;  3X26 B;  2OTJ T;  4M7A C;  1VIF A;  1VQ4 Q;  1BCO A;  1S72 Q;  1PWT A;  4M7A A;  4N0A C;  4HA8 A;  3CCV A;  2QEX Q;  4VUB A;  3OYG A;  4J5Y A;  2DX1 A;  4OP0 A;  4JRQ A;  1MV3 A;  2D6F A;  2OTJ Q;  1N27 A;  4N0A A;  1Q82 U;  2EGE A;  2RHY A;  3M9Q A;  3VS0 A;  3KUF A;  1D1C A;  2J6K A;  1WI7 A;  3JCM c;  3CME Q;  3J80 E;  1H92 A;  1K0S A;  5C6S A;  5IH2 A;  3MEA A;  4J9C A;  3OBY A;  3I5R A;  1GFC A;  2KY9 A;  2RMO A;  2EBP A;  4RKU E;  2MK5 A;  1ZBX A;  2NYS A;  2MWP A;  4ORZ A;  2KE9 A;  2C0T A;  2CUD A;  4M7D A;  4XTX A;  1SSH A;  4JJD A;  2MWO A;  2Y4X A;  2E70 A;  1M1F A;  2DIL A;  3A5Z B;  5GMK h;  3CCQ T;  3OW2 S;  2H3J A;  5A0L A;  3LX7 A;  5KYY A;  4MZP A;  2BE7 D;  1AT1 B;  1WHG A;  1AD5 A;  2E6N A;  3HHT B;  2DBK A;  1NE8 A;  4DA4 A;  1K1Z A;  3MJX A;  3HSB A;  1SPK A;  3C0C A;  3EGD B;  5I11 A;  5GMK l;  2LCC A;  1FMK A;  1WHH A;  3F70 A;  4X9C A;  4EMG A;  3LYI A;  4LE9 A;  2K3B A;  1OPL A;  2MF2 A;  1M4Z A;  3QDR B;  2GFA A;  1GRI A;  3WVD B;  3S3M A;  2KEA A;  2CP7 A;  4KH1 B;  2L8D A;  1WHL A;  1YFN A;  4XTV A;  2MMP A;  1B3Q A;  5DLQ E;  1N8R U;  4JRP A;  2DZ9 A;  3VV0 A;  1Q86 U;  2HKN A;  1YN8 A;  1M90 C;  2YUN A;  3VYH B;  1WHM A;  2E5K A;  1KC8 C;  2KYM A;  4XU3 A;  1OZ3 A;  2QAZ A;  2RO0 A;  2KXD A;  4LD9 K;  4MDX A;  3WVE B;  3V8K A;  2PTK A;  3LGF A; 
#chains in the Genus database with same CATH homology
 5GMK e;  2PUK B;  3AHU A;  5CCA A;  2EQJ A;  3CC7 A;  3CCS T;  1Q7Y C;  4BI3 A;  2EQU A;  2ZPH B;  2KDS A;  1Y96 A;  2A3L A;  3HRT A;  3T9N A;  4IKF A;  2PQW A;  4L5G A;  2DAQ A;  3L2R A;  5I2S A;  1VQM A;  3CME T;  4M77 D;  1QVP A;  4OGC A;  3CC4 A;  3TU4 K;  4M7D D;  3OYL A;  3TRE A;  5FRN A;  3VUZ A;  2ZPG B;  4CI0 C;  4M75 C;  5LJ5 h;  4M75 E;  5GAM e;  3EFR A;  3BFM A;  2QQB A;  2P0Q A;  4OB1 B;  4XTZ A;  4C92 C;  2DXB A;  1V29 B;  4C92 E;  1QVF S;  1I8F A;  5D6X A;  5J26 A;  2ZGW A;  1G3S A;  3X24 B;  5CVI A;  3CCJ A;  5GAM g;  1WPY A;  1G5V A;  3CXC A;  2RI3 A;  3CC7 T;  2RHX A;  2X4J A;  3BY7 A;  4MMK A;  3HP9 A;  1RI0 A;  3RES A;  2XID A;  3QYH B;  3SB2 A;  4BI4 A;  3OYC A;  3OB9 A;  2VC8 A;  2HQE A;  3FEO A;  2PU9 B;  1SSF A;  1VQ5 A;  3RMS A;  3DKM A;  2E10 A;  2KMT A;  4M78 D;  3CCV T;  1UGP B;  1WJQ A;  4C5H A;  2DZC A;  3M5A A;  3RUX A;  5LJ5 f;  2I2L A;  3RKW A;  3JCM Q;  4QQ6 A;  1QVF A;  4E7L A;  5HK3 A;  2GFU A;  1WNL A;  1VQ6 A;  2CZ6 B;  2LQK A;  3OQ5 A;  5M9O A;  5HK0 A;  2FL7 A;  2DD5 A;  3QXE B;  4Z02 A;  2CS7 A;  2L89 A;  4DOV A;  3CEY A;  3HPW A;  2ZPF B;  4PJO D;  1XTD A;  1XNI A;  2D0Q B;  2FYK A;  5CKB A;  4JRK A;  4J7F A;  3H6Z A;  4PKC C;  3I56 T;  3EAE A;  3L1A A;  1DJ7 B;  4EMK C;  4C5I A;  3A8G B;  4ME7 A;  4C8Q E;  1Y96 B;  3JRZ A;  4XTU A;  2KQW A;  4II1 A;  1Q86 C;  2LX9 A;  2KK4 A;  4M75 G;  3JCM X;  3E19 A;  5KH6 A;  2QQA A;  4EMK A;  4J8O A;  4C92 G;  3MP8 A;  1B34 A;  5J3B A;  1PSE A;  5GMK i;  4OF1 A;  4OB2 B;  2MAM A;  1VQ6 T;  1G3Y A;  4FSX A;  3C4S A;  3QO3 A;  4M77 E;  4PJO C;  2DXT A;  4PJO E;  3JCM J;  4ELY C;  4IUP A;  4J7I A;  2VYT A;  4M75 B;  3BDL A;  3CPF A;  3LWI A;  1YJ9 A;  4C92 B;  1OI1 A;  3GF5 A;  3GPL A;  1KQ2 A;  2XKO C;  2EJF A;  1YIJ T;  2O01 E;  3J7A F;  2HQX A;  1YI2 A;  3PMT A;  2VXE A;  3V7R A;  3CCL T;  3MET A;  2AHJ B;  4N4H A;  2OAU A;  4A4K A;  4JLG A;  5LJ5 e;  3OA6 A;  3CMA A;  3OMG A;  5GAN j;  1YHQ A;  1D3B A;  1M8V A;  4FM4 B;  4BI8 B;  4FL6 A;  1IRE B;  1Q82 C;  1YJW A;  2LVM A;  1YCY A;  1PSF A;  3A8M B;  3FRN A;  4M75 F;  4CRI A;  3JCM d;  4RG2 A;  5GAN 4;  3VUB A;  5LJ5 g;  3HL8 A;  4C92 F;  3OYH A;  4OGE A;  4EDU A;  4KUD K;  3P8H A;  2EQK A;  2LTO A;  4C5G A;  2XDP A;  3M59 A;  3G6E A;  4Q5W A;  5LJ3 j;  4HKE A;  4C8Q G;  4M7A D;  2EFI A;  4BDZ A;  2P0P A;  3O8V A;  3L2U A;  4FT2 A;  2ZPE B;  5KCH A;  1YJ9 T;  1K73 U;  4HT8 A;  2VXF A;  2QQS A;  3OYN A;  2VV5 A;  1LOJ A;  5FLX E;  1GXI E;  5I2M A;  1X75 C;  2WSC E;  4F7U E;  5GAO p;  4PLI A;  3CCM T;  1YI2 T;  3M55 A;  1QVG S;  2BIV A;  4C0G A;  4LDU A;  2GF7 A;  3MP6 A;  3CC2 A;  2DK3 A;  2X4X A;  2LCL A;  1K8A U;  3JB9 H;  4M77 G;  4C8Q B;  4EMK B;  1Y7X A;  4PJO G;  3S3O A;  1Q81 U;  2M0O A;  4QVC A;  2RK1 A;  3S6W A;  5A2Q E;  4QVZ A;  4A4F A;  1MGQ A;  2DXU A;  5CQY A;  3CCU A;  5A0D A;  3MHX A;  1WJS A;  4FT4 A;  4ELZ C;  4Y91 A;  4HCB A;  4WF2 A;  1N9S A;  4KBM B;  5CKF A;  4B9W A;  5DM7 R;  5GAN d;  4E7I A;  3HFN A;  4JLI A;  1Y71 A;  2LT4 A;  1YJN A;  1NPR A;  3OYE A;  3NFC A;  2K5F A;  5GAN 2;  4ZTF A;  4PJO B;  4RMO A;  2K2V A;  2YHT A;  3URG A;  2OTJ A;  1KHC A;  4C0Z A;  2O4X A;  3CBM A;  4XQ3 A;  3X25 B;  3JCM V;  5LJ3 h;  3LGL A;  4ZGD B;  2R57 A;  4R56 A;  2EQM A;  3I55 T;  1JJ2 S;  3ASK A;  2DVE A;  2LRQ A;  1UGR B;  3OS5 A;  3H8Z A;  4N4I A;  2PUO B;  4PL6 A;  2VUB A;  5LJ3 d;  1D3B B;  2RB6 A;  2ZCF B;  3QUI A;  3JB9 I;  5GAN 7;  3CXC S;  3CD6 T;  1KQ1 A;  3OMC A;  3RER A;  1ZHI A;  5GAN f;  1QP2 A;  3E9G A;  4BE0 A;  1WGS A;  2JNG A;  3PNW C;  4V2S A;  1I4K 1;  2RA2 A;  5FU7 C;  4PJO F;  4NL3 A;  3G7Z A;  4PNO A;  4XTW A;  4FIB A;  3CCU T;  2OTL A;  4IUT A;  3FLG A;  2CKK A;  2IG0 A;  4BB7 A;  1KG1 A;  3OYB A;  4RG8 A;  3L2V A;  4F7U G;  4TVR A;  2ZPB B;  5CK9 A;  3GLX A;  3JB9 G;  4JDS A;  3OYK A;  1WQW A;  3NTK A;  3R6O A;  4QVD A;  3JSC A;  3V8J A;  1O9S A;  1JJ2 A;  2E65 A;  3INZ A;  5LJ3 f;  2XDB A;  2RM4 A;  3QZ9 B;  4M75 A;  3CMA T;  4P5N A;  1EIF A;  2PVG B;  5GAO l;  3QSU A;  4C92 A;  4M7A E;  2FB7 A;  3OYJ A;  4FU6 A;  4IUQ A;  3VKI A;  1VQ8 A;  3OY9 A;  3MEV A;  1LNX A;  1VQL A;  4F7U B;  3PIO A;  1FXX A;  2YLC A;  1VQM T;  4BE2 A;  4KUI A;  4HCZ A;  3OS0 A;  2OTL T;  2QTX A;  4IUR A;  3CC4 T;  3X20 B;  1BI0 A;  5FU6 C;  5I21 A;  2B8A A;  3S3N A;  4JRI A;  4DQ2 A;  5GAO m;  4Y28 E;  5AYF A;  1UB4 A;  1BI2 A;  3JB9 F;  1NJI U;  4KUL A;  4LDW A;  1KD1 C;  3CCJ T;  2O4X B;  4XU1 A;  5KCO A;  1FWZ A;  2E64 A;  1VQK A;  1Q81 C;  2G3R A;  2F5K A;  3HRU A;  4EPC A;  4N4G A;  5GMK j;  1N8R C;  2E12 A;  3FJP A;  1VQL T;  4C8Q C;  2XD0 A;  4BY6 C;  3GP8 A;  1MHN A;  2JTF A;  2K3Y A;  1VQ5 T;  1BIA A;  2NLU A;  2RHZ A;  2CZ1 B;  3DB4 A;  3P8B B;  4BAC A;  1BYM A;  4C0F A;  3V8L A;  3CBP A;  4C8Q A;  3QJ6 A;  4J6X A;  5GAO n;  4D6W A;  2GCX A;  3CCQ A;  2R5A A;  2RK2 A;  3PMI A;  3UPU A;  3A8O B;  1M1K C;  1P92 A;  3BW1 A;  5FU7 B;  3NTI A;  4M7A G;  1VQN A;  3SWN C;  2RH2 A;  4M77 C;  4UC4 A;  2Y90 A;  4MML A;  5GAM j;  4JS4 A;  2JUF A;  2QXF A;  2V8J A;  4M7D C;  3M53 A;  3OYA A;  4M7D E;  1IZ6 A;  5J39 A;  3EFS A;  5DLO A;  2JVV A;  2XI9 A;  2IVW A;  4M77 A;  3VYG A;  1KC8 U;  4PJO A;  2L5Q A;  1LJO A;  4ZN3 A;  5IT9 E;  4L59 A;  1OYX A;  2E41 A;  4XU2 A;  5D6Y A;  3SD4 A;  3OYI A;  4MZT A;  1U8R A;  3KBG A;  4ATO A;  1VQ7 A;  3M4Y A;  2WSE E;  2V8I A;  1R8O B;  2PVO B;  2RI2 A;  2VGN A;  2LDM A;  3JCM h;  2X4Y A;  3A8L B;  1ZQ1 A;  3CBO A;  3VJP A;  4JJN K;  1Q7Y U;  4XTY A;  2PVD B;  1VQ9 A;  1HK9 A;  3SFM A;  4A4G A;  4BE1 A;  2BUD A;  1JB0 E;  3OS1 A;  1N8R U;  4M78 C;  4M78 E;  3WXM B;  4BUG A;  2E1H A;  5FU6 B;  5A0G A;  1KQS S;  3QJY A;  1M9S A;  3VU3 C;  3QII A;  4NL2 A;  4M78 A;  5HY6 A;  4LDV A;  2DIG A;  4ZGJ B;  1BI1 A;  3M54 A;  2F5T X;  2EJG A;  4ZTJ A;  2EKO A;  4RCC A;  2E6Z A;  5GAN 8;  1JRI A;  1WQ7 A;  3FDR A;  2L3R A;  1UEB A;  3MP1 A;  4LD6 A;  2WSF E;  4LDY A;  2CZ0 B;  3Q1J A;  3JCM f;  3C94 A;  2DEQ A;  4A4E A;  3PTA A;  4OB3 B;  1YHQ T;  5GAM d;  3A8H B;  2R58 A;  2JTM A;  5EG2 A;  4F7U A;  1H64 1;  3QPH A;  3QYG B;  1H3Z A;  4M75 D;  4BY6 B;  1YJW T;  4M7D G;  4HT9 A;  1VUB A;  2LT1 A;  1U1S A;  2K4Y A;  4C92 D;  3L2Q A;  4R55 A;  3CCE A;  1NPP A;  3GIB A;  5GAN h;  5GAO q;  3FIF A;  1VQ4 A;  1KQS A;  5CAI A;  1NJI C;  3C12 A;  1S72 A;  3DB3 A;  3G6E T;  3GOX A;  2Y4Y A;  5KE2 A;  2FVU A;  1VQP A;  3RKX A;  1OZ2 A;  2XK0 A;  2RJE A;  4JS5 A;  2QEX A;  3QBY A;  4O5V A;  4GLK A;  5LL6 S;  4M77 B;  3SWN B;  5GAM f;  5GMK m;  2YRV A;  4M7D B;  5GAN 3;  4C8Q F;  3CCR A;  2XHC A;  4BDY A;  2R5M A;  2X4W A;  4OMF B;  4E7K A;  4O6J A;  2LC4 A;  5CIU A;  3CC2 T;  1BIB A;  3X28 B;  3L42 A;  4M78 G;  3ZEH A;  4QW2 A;  5KE3 A;  4EMH A;  2XDD A;  1XQH A;  1KHI A;  1W2B A;  3CME A;  3OSV A;  3OSS C;  1VIE A;  2RHI A;  1VQ4 T;  4M77 F;  3LWH A;  1VQO A;  4J6W A;  4M7D F;  2D9T A;  3DLL A;  3C95 A;  2EWN A;  1S72 T;  3L2Z A;  3ZFJ A;  1TH7 A;  2E5Q A;  3JCM W;  1N6A A;  1I81 A;  1YBY A;  2DTH A;  2VGM A;  5GAN 5;  2P4T A;  1VQP T;  1HXD A;  1X6O A;  3PIP A;  3UWN A;  4M78 B;  2QEX T;  1NZ9 A;  3QG1 A;  3JCM e;  1YJN T;  1AHJ B;  4X34 A;  5IN1 A;  3KXT A;  4XK8 E;  3X26 B;  2OTJ T;  4E7H A;  3M57 A;  1QP3 A;  5IAY A;  2RJD A;  3OYF A;  4M7A C;  3E9F A;  1VIF A;  1Y07 A;  2YLB A;  3V7S A;  3JCM g;  4MDW A;  3UDC A;  2X35 A;  3RMQ A;  3JCM b;  4M7A A;  3OBW A;  1RL2 A;  4N0A C;  3QZ5 B;  4HA8 A;  4YTL A;  3CCV A;  2CZ7 B;  4VUB A;  3JAM E;  2QI2 A;  2V8K A;  4J5Y A;  3LW5 E;  1JBM A;  4M78 F;  4DOW A;  3OYG A;  4OP0 A;  2QQ9 A;  2P0K A;  3E1S A;  4QQG A;  5CO7 A;  4JRQ A;  1N27 A;  1VQO T;  2D6F A;  4N0A A;  2DO3 A;  1Q82 U;  4XAX B;  2RHY A;  1K73 C;  3ME9 A;  3M9Q A;  2DTI A;  3TCJ A;  2KSS A;  3FC3 A;  3KUF A;  5LJ5 d;  3HKS A;  3ZBD A;  3NTH A;  2F69 A;  2RD1 A;  2EAY A;  4F7U F;  2XG8 D;  3OYY A;  3JCM c;  4A53 A;  3L2W A;  1G3T A;  4PLL A;  2K57 A;  2DIQ A;  2RHU A;  1K8A C;  4LDX A;  2KAF A;  3JB9 J;  3I56 A;  2QQR A;  3J80 E;  5HKC A;  5GAN e;  2HD0 A;  1VQ8 T;  3LLR A;  3M56 A;  3BDU A;  2CGH A;  1K9M U;  2BKD N;  1BI3 A;  5C6S A;  2QDY B;  4E7J A;  3MEA A;  4QQD A;  5GAN g;  2HNI A;  3MO8 A;  1N9R A;  2M1H A;  3OBY A;  3P8D A;  2KY9 A;  5LJ3 e;  1G3W A;  1U1T A;  1FX7 A;  4RKU E;  3OYM A;  4NOY A;  3RKY A;  3JB9 D;  1ZBX A;  4IUV A;  2MWP A;  2A7Y A;  5FRO A;  1M90 U;  3CCR T;  4B9X A;  3SDZ A;  2LQ8 A;  5LJ3 g;  2JOY A;  2KVQ G;  3GNG A;  2K5L A;  3SWN A;  4ZGE B;  2RJF A;  1YIJ A;  1VQK T;  3PFS A;  4M7D A;  4XTX A;  5GAO r;  2XIC A;  4HCC A;  3DLM A;  3CCL A;  2MWO A;  2HBP A;  4NS5 A;  2DKG A;  2Y4X A;  4M7A B;  2C06 A;  2MI6 A;  3M58 A;  2GQV A;  2E70 A;  1M1F A;  3QHS A;  3FB9 A;  5CKD A;  2RJC A;  3A5Z B;  5GMK h;  5FRM A;  4J83 A;  3CCQ T;  3M4G A;  4OVA A;  1QW1 A;  3OW2 S;  1M1G A;  3HFO A;  2K5I A;  2JN0 A;  2H3J A;  4C0D C;  1UGQ B;  5A0L A;  1VQN T;  3LX7 A;  2XU8 A;  4MZP A;  2QA4 A;  3JCM P;  4M7A F;  1M5Q 1;  3ER0 A;  4A4H A;  2E6N A;  4BD3 A;  3HHT B;  1NE8 A;  1X01 A;  3OS2 A;  2HAX A;  3CCM A;  3QKJ A;  1XOV A;  4XU0 A;  4C5E A;  5GAM h;  3G4S A;  3MCA B;  3CPW S;  4DA4 A;  4L6V 5;  3TEE A;  1YIT A;  2WAC A;  4JUV A;  1VQ7 T;  3HSB A;  2LNV A;  2EYQ A;  2ZZD A;  5CKH A;  4GY5 A;  2RI5 A;  5L8R E;  5CQX A;  3OW2 A;  5GMK l;  5CKE A;  3G71 A;  2DJZ A;  2LCC A;  2DPP B;  2CYZ B;  1VQ9 T;  3MEU A;  3F70 A;  4ZN1 A;  1UGS B;  2M16 A;  4X9C A;  5DY9 A;  4EMG A;  1W2B S;  2FHD A;  3LYI A;  5D6W A;  2QA4 T;  4OB0 B;  2MF2 A;  1M4Z A;  3PGG A;  1O75 A;  3CPW A;  4RCB A;  4X9D A;  1I5L A;  1K9M C;  3QDR B;  2GFA A;  3I55 A;  3G4S T;  3WVD B;  3S3M A;  4KT0 E;  2M9U A;  2ZPI B;  3V7C A;  5CR2 A;  1YIT T;  1KD1 U;  3CCS A;  3N5B B;  3PT9 A;  3UT1 A;  2L8D A;  3CD6 A;  3J81 E;  4A54 A;  2DTO A;  4XTV A;  5GAN 6;  1B34 B;  2MMP A;  2DD4 A;  2EIF A;  1W4S A;  1BKB A;  2EJ9 A;  5DLQ E;  2DZ9 A;  4E47 A;  5LJ5 j;  3G71 T;  2K3X A;  4JRP A;  3HRS A;  3VV0 A;  1Q86 U;  3CCE T;  3MEW A;  4IUU A;  1M90 C;  2DXC A;  3VYH B;  3LH0 A;  1KC8 C;  1M1K U;  1QVG A;  4XU3 A;  1OZ3 A;  4C0D B;  2RO0 A;  3OYD A;  4LD9 K;  4MDX A;  1WJR A;  4C8Q D;  3WVE B;  3V8K A;  3GNF B;  3LGF A;  3RIR A;  4J6Y A;  2JZ2 A;  4MZM A;  5C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...