2DD8H

Crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
b'VQLQQSGAEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGGITPILGIANYAQKFQGRVTITTDESTSTAYMELSSLRSEDTAVYYCARDTVMGGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG Heavy Chain
publication title Structure of Severe Acute Respiratory Syndrome Coronavirus Receptor-binding Domain Complexed with Neutralizing Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 42
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2006-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dd8H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dd8H01
3HZVA 2IANE 1G0DA 5EZIH 4QLRA 1INQA 1ZS8B 1DUZB 5DK0A 1J0YA 4UB0H 3WL9A 1UJ3A 5KAQF 4NBXB 2Q86B 3DNKA 1T5XB 2BSTA 2KPNA 4LGRB 4MMXC 3SDAD 3QIBC 3D0VB 3UYRH 3QDJD 4RMVA 2QR0A 1AC0A 3OB0H 1MH5A 1OQOA 2NXYB 3G6JA 4EVNB 1TJGH 5B21A 2D7QA 5KG9A 2IANB 2LQRA 4XMPH 2GJZB 3DPBA 4L4TE 1FYTD 4N0FB 1EEYA 2JK5B 4F7TA 3FFCA 3ARSA 1BF2A 2XRAL 4K71B 3CK0L 4TRPH 3WD5L 5I1CH 4HEPG 1KEGH 3BRGC 2ZUWA 4J8RB 3KYNB 1V3LA 2W0KA 2DM4A 2R56H 3NCYP 1QR1A 4QHUB 3LKOB 5I8CB 2HVKA 4W4NA 2P24B 4L8SB 3VRLF 2XG5A 3ES6B 3VGDA 4B53A 1DBJL 1QSFD 1X5ZA 3BP7A 1JCKA 3RVTD 1ZLVH 4L4TB 4IOIA 5EZOH 1U8PB 3QDGA 4JRXE 4APQC 5IFJA 5HXMA 1CXIA 5FO9B 4KV5E 3U6RB 1AQKH 3IF1B 3CH1A 4ENED 5KVGL 5C0JA 1MCWW 3MLUL 4MJ6A 3ARBD 5D1QD 4DKDC 4NQSB 5DEFA 5HGAA 2Z35B 4BH7A 4PR5B 3W81A 1I1YA 1A7NH 1JTTA 3GSNB 2CDEA 3RUGA 5JHLL 3GSQA 5CGTA 1Y6MR 4NN5C 3P2TA 2LFGA 3O3AB 1BVZA 3MRHB 1K8DA 1XH3A 1ZLSH 2F8OA 2ARWA 2CKBH 5KSVB 1T1WA 3SO3C 3O4LB 4JRXB 5CP3A 3A6CH 4LSPH 3S97C 1RK0A 5DVMA 2D4DA 5I15L 1GZPA 4H8WC 5CUSH 3AY4A 1Q72L 1R24A 1YNLL 3MFGB 4Y1AA 3U0WL 1MQKL 1E4KC 3FT2A 5D7IA 2HVJB 1BJ1H 4GSDH 1NUDA 4QRPD 3ROLA 4YZFF 5HHVH 4KDTC 2NPLX 1QVOB 4Z7WE 3DUUA 1CFQA 4PD4J 2FEDC 2VISA 5DJ2B 4Y16D 5K59E 2OK0L 1AR2A 2COQA 4KDWA 3WFEH 2EDQA 4Q6YA 3B2VL 1NBVH 1TTFA 5I17A 5D1XD 4HAGA 2ICWI 5GGRB 4IHOB 4KK8C 4Y5YC 3BXNB 5SX4I 1I9JH 4IIQB 5CJ8A 1E4XH 2X4PA 1CDBA 4KUCF 2XNAA 1FL5A 3KVQA 4DWHA 2MKWA 4XMPL 1TLKA 3WIHL 3GBNL 3O4OC 1KLUB 5FYKH 1S7TB 4RGMB 2EZ0D 3HPLA 3WS3B 2XKUA 4U1IA 2A2QT 1YEFH 5I1JH 4NQVB 2H3NB 1IZJA 3MJGX 2R56L 1DLHB 3N1PC 1IFHL 4PRBA 2AJZA 5AYUH 2YR3A 1IKFH 5GGUB 5IB2B 4B0MM 4QHMB 4K94C 3W5MA 5EC1B 4ODXA 5I74B 2BY2A 4ZAKA 4P2OD 2VXQH 1FE8H 5DSCB 4HIHB 5KOVC 5ADOH 4P5TC 1RPQA 3GMMA 3C08L 3QJHB 4XGZB 5DMGC 1JZ7A 3IVKA 4OV6F 1I3UA 1VGEL 2LTQC 2CKBB 4NN6C 1A1MB 5DD1L 5HGHA 2AXHA 1T66D 3WXVL 2XY2A 3P4MB 4BK5A 4ZFFB 2J2ZA 3VXRB 1UZ6E 3IDUA 1JZ2A 3BH8B 4YO0A 4YEFA 2Q76A 2Y5TA 3BRFA 4NM8H 1ONQA 4RMUA 5GXBB 3A67H 1ZLSL 5AEAA 2DBLH 5DI8A 1U3HA 5EOTA 5F97E 2ZZUT 1TPXC 3O2VH 3L3DA 4JFDE 3T0EA 1CWVA 1YMMB 4DCQA 1NFIA 5FYKE 2QV2A 5JW4R 3SGKC 5I1LA 5DD6A 4GSDL 5JOFA 3ARVA 5HHVL 3ARDB 2AXFB 2EXWC 4LRNL 4U1SB 4JFYA 2OZ4A 2HKHH 3L3GB 5J56B 3LRHA 4P57B 4OM0L 3MRJB 2CXGA 4JVUA 4JB9L 2VNCA 3PWPA 3TPKA 2YRLA 1CFNA 3SGEH 3QG7L 4JFDB 3ZTJH 3EOTL 4K3JL 2BX5A 3T4YB 3GIVB 5E9DA 2NLJA 5IB4A 5CEZL 4WU7B 2H26B 4LVNB 3NPSB 1UH2A 3S5LA 4DKFH 4JQIH 3U2SB 4NOBA 3BSZL 5EO0B 4M1CC 3L3KA 3I75B 4KZDL 2OMNA 4RZCA 3RNQA 4JFEA 4MAUH 4BFGA 5IMMA 3MLTB 2R4SH 3OKEA 3LEXB 2LU3A 1EDQA 4PUBL 2AABL 4KKCD 3RIFK 2MHAB 1RJLA 3MV7E 1YPZE 3LH2L 1YMHA 5EOCH 1YUHA 4NJ9H 3U7WH 3OGCB 3EYSH 4ESKA 4KHXH 5J8OA 1MJ7L 4LARH 1EERB 1KXTB 1XFPA 3WJJA 3Q6GH 3IS0X 3ZYOA 4K2UL 5DDHA 5ADOL 3O9WD 1C12A 4B41A 3IXTB 1MFCH 1QRND 1TQCC 4NQTA 5C9JA 4YDJA 4AEHL 1S9XA 3MPCA 1YPZB 2C4FT 1WK0A 1JWMB 3DV6A 3VE0B 3WFBL 2JELL 4WVRA 3MJ9H 3S36H 1ZGLA 4QRRD 5E1AA 5TDOA 3NOIA 3ULVH 5C0AA 1WUNT 3SJVE 1DLFL 3P0YL 4P0DA 2V2TA 2VL5B 4IMLB 5C2BH 3MUHL 4IEFB 3AGVA 4L9LC 1DFBH 4KJWD 1WBZA 2HTLC 3WIHA 3MACH 1GPOH 5DJ0B 3N0PB 3TF7C 1G9ML 4NQED 1NC4D 3VFSB 4HIIA 3RWCA 1J05A 3BRDA 2XWTB 2OL3H 5C0FA 1TDQA 5FYJL 3KXFD 4OZHE 4U3HA 1JHTB 2HJLA 2DQEH 1T0NB 1U93A 4JFQB 3SJVB 5F3HB 4ONHB 1WICA 3RUGF 4G6AC 4XP9H 5C0CD 2BOCB 2E27L 3L6FB 1IGCL 1CDGA 1Y0LA 1I8MB 2WUBH 2ESVD 5GZND 4HKZA 3L5IA 1DQML 2HT3D 4U49A 5MENA 4OCRH 2VAAB 3BHBA 1XR8B 1X5KA 4GW1B 1LE5B 3V4PH 4BH8A 4LSVH 3SCMD 1FNEA 4OIIL 1IGYA 1UB5B 4O02H 3DMMD 3WLBB 1GYAA 2R8SH 3VI3E 1IL1A 5D7IF 3VFWB 5FOBB 4OFVA 4LHUD 1FGNH 1ORSA 4JFFA 3P4NA 1JGVH 1QBAA 4GBXC 3QXAB 1YEIH 2X89A 3V5DB 3CD4A 4Z7UE 2R4RL 3ULVE 4GW4B 1WZ1H 2CUMA 4L3EB 1UZ8A 3JVGA 3N1QC 3GSRA 1HQ4B 1IGIH 3C5ZB 5F1NA 3O3DA 4XXDA 4PREA 4PB0H 2O5ZH 4Y89A 4X5WB 3GK8H 3IDIB 1AKJD 1Q9KA 4XPHL 1I7TB 4QTHB 4BA8A 5TQ0H 2YD1A 5JNYB 5E2TH 1ERNA 4RNRB 2VLJD 4H0IA 4M7ZB 1MY5A 1OTSC 4WEBH 4M4PA 3MR9B 4LPXA 5C07A 5H35A 4WHDA 3RX7A 1DEEB 5ICYA 1CLOH 1AD0A 3MJ9L 4WHYH 4ONFH 3DXAA 4ZG1A 2EKSB 3S5LG 4NNPH 2GEEA 4ZUSB 3D18B 1TMCB 3NMEA 1CTOA 3C6LB 2BY3A 3LHPL 3MACL 4X5LA 5DK2B 5GS0D 2VIRA 5KJRL 3NABH 5E8EA 5D2NC 3TJEH 4FQQB 5ETUA 8FABB 4UUJA 5F70A 4E5XB 3WHE1 4HF5L 1L0QA 3FQUB 3TBTA 4X4ME 4M9PA 1IAMA 4PG2C 5ADPL 2NXZC 2GSIA 3L7EA 1PJ9A 5B3JF 3QIUD 4GRLC 3T1WA 1GSMA 2J8UE 2ZCHH 5DVKA 1VFBB 1KPVB 1D5XA 4QXGH 4BM7A 2YKLL 5D8JL 1GGCL 4JGMA 2XOTA 2EE3A 2XWBB 3FO1B 2UZXB 4ISVB 1X5AA 4LCCB 3CJJA 4Y5XA 4XPFH 4G42B 4OAWA 4V2BA 3V5KB 2HJFA 3IAGC 2VZUA 3GSOB 3QNYB 2ICCA 3WEXA 1MJJA 1EIBA 3V6OA 4PS4H 1WIUA 3VGFA 2R8SL 1BQLH 4O2EB 2W0LA 1KLGA 1CFTA 2J8UB 5FGRA 5EUOA 1E28A 1MVFA 1JGVL 3CVHH 3JTSA 4Y4FD 1KCRL 1OTTC 4BELD 1YEIL 4PGBA 3K0WA 1UKSA 1R0AL 2FZ3A 3TNNA 1WZ1L 1EMTL 3RRQA 4G7YH 3F58L 4NO5B 4NHUA 1XIWB 2NY3B 3C60C 2DTML 2H8PA 1NCAL 1Z6JT 1GGYA 1TITA 1LGVA 2PW2B 1BBDH 5GSVA 1D6VL 2DWDA 4R6UA 2FWOB 4GKSB 1F58L 1L9MA 4GRWF 3W0WD 3CX2A 3F65A 2VLLB 3MGAA 5GRZA 1LEIB 1GZQB 4JHWL 3H7LA 3KPQB 4JFHD 5DEGA 3GMRB 4OCYL 3G08B 4FQJL 3QIBA 5F1IB 4U0QB 1X6NA 5EU6B 3OF6A 5T1LB 2R9HC 2G9HB 3MJ7B 4RAUA 5HHQB 3HZMB 4QGTA 2MPAL 4NQUA 3WKMH 3KXFE 3IDJA 2ZNWA 1QFWM 3PNWB 2EDWA 4MB5A 2P1YA 1UT9A 1KJ3H 1X5IA 3X11A 3BKYL 4KUCD 4JDVB 3L95B 1KIPB 2CRZA 5CGYC 1M05A 4XXCC 1F2QA 3DRTB 1A9BB 2CDGB 2FL5A 3DV4A 4R3SB 5EBMA 5L2JA 4R0LA 1AHWB 1QBLH 3UXFA 5H8DA 3LD8B 2GQHA 1U8LA 3RX8A 4WFEE 2MCPL 5CJOL 2JTDA 3HE6C 5EFIB 4XWGH 3TH4T 4MLIA 2VMFA 3DVGB 1NCUA 5GS0H 1T0PB 3H3KA 4APQA 4R2GB 2Y7QA 4PGEA 3QEHA 5DUML 1IGTA 3T3PE 1KBGH 3T0BA 1W0WA 3E3QE 4LEOA 2EICA 4UT7L 3VWJB 4CDHA 2MJWA 1FG2B 5FFLA 1G7PA 1WFNA 3TBWB 2ADIA 5D7LA 5L7XL 4AQ1B 2EIDA 2BY0A 3CVHB 2DD8H 4Z0BL 2DKSA 4V2CB 3PP3K 3MNVA 3BUYA 5DJAA 4LVOB 5T3ZH 5D71H 3QUKB 5JA8B 1RIVH 2FR4A 3CSYA 3EGSA 1D9KD 1U8IA 4XNZC 4C4KT 5FEBA 4ZFGL 1G7LB 2Z8RA 4NKDA 1BVKB 2DF3A 4YBLC 1R3KB 1E4KA 4G7YL 4S1QL 1JE6A 5E8PB 4KDTA 4NQCA 1RZFL 3PDOB 4MZ2A 3FTGB 4YX2L 1IMHC 4R7DA 2HYMA 1DEDA 2ICEA 2VRAA 2Z9TA 4A6YH 1FFNA 5FKPA 5GQBA 2Q3ZA 4LCIL 1KJ2B 1SJEB 4I77L 4MS8D 4WHCA 1NDGA 4XRCA 1JRHI 1NL0H 5DFWH 4E41D 4P4RB 1P4BL 1ODAA 4Z95H 1NDMA 3VXSA 5FKAA 1K3ZA 1RSFA 5LWYH 4G8GA 4K23L 2I9LA 4Y5YA 4U2YA 3L3OB 1SJVA 1KJ2L 3QO0A 4UV7H 5CP7A 3U9PL 2X4TB 1T7XA 1UKQA 4I3SH 4EZMA 2X4OB 1OLZA 3VFPB 1AO7A 1B90A 4MA3B 4F9PC 3ARZA 5JW4N 3AU1A 4HD9A 5EBGA 5J06A 1DN0B 2ADFH 2CLZB 5T3ZE 4S1DC 1Q0YH 2UWEE 2C5DC 4NZTH 4HUVA 3UTPE 3O41B 5EORH 1A6AB 3DJ9A 1F4HA 4IM8A 2GUOB 2XZZA 4DAGL 5I19L 5EIIB 4WUUA 3O2DA 3HI1A 1AGEA 1JGLH 4XX1E 4LSRL 5DHVA 2W9DH 3D39D 5B38B 2HH0L 1J8HA 3T1FA 1LO3L 3ARFB 4ELME 4RGOL 5DXWA 4P5TA 2VSCA 1GHFH 3WE6B 1P2CA 1TCRB 2ZKHL 4OZFA 5EZLA 5C08A 3TWCH 1WEJH 1H8NA 2UWEB 5F1SA 1KN4H 4G8IA 3REWA 1KNOA 5A2KH 1FFPB 3ELAT 1U8JA 3HE7B 5EIVA 3R06A 2DD8L 3G9AB 4IRSD 3HMXL 1T03L 3FOLA 4HIEA 3TBSB 3SHSA 2X70B 3CDGB 3SQOH 3O3EB 4BZ1H 5JHDE 5E70A 1HH6A 1UM4H 1RAMA 4ELMB 3PDGA 2AEQH 4AG4L 4ZS7H 2FECL 2HJKB 4J23A 4OF3A 5CEXB 4A6YB 2P8MB 3RNKA 3G5XB 1IQDB 3LSOB 4HUNB 1N0LA 1NBYB 3SGKA 3VDBA 3QDGD 1KPUA 2OMBA 3VXPA 1RIUL 4X6BA 2CJUL 4D0BA 1I1AC 4Y2DB 1LNUA 3ILPA 1LO0L 4NRYA 3AB0B 3UAJD 1EO5A 3WUZA 1IC7H 3H7BB 1CICC 4GG6A 2DLHA 32C2B 1TZIA 2V2XB 5SWQB 4PJEE 4Z95L 4WUKL 5EUOF 4ZO7A 1SM3H 5DURD 1AR1D 2Z92A 4FA8A 4CVXB 1WWWX 4UDTA 4KRPB 3I6GB 4UAOB 2XYCA 1AGBB 1MCRA 3O6FB 2DB8A 2EIZB 1JV5A 1AQDA 3KPRE 2FDBP 2FJGA 2YD7A 4Y1AD 2I60L 2CIIB 2JJTC 2EH8H 2VQ1B 4L29B 1CE1L 2H6PA 3MYJA 2ADJB 1Q9WA 3B2UD 4PJEB 4Y4HD 5D70H 2IG2H 5CSZB 5FYLD 5DJ6A 2YOCA 1WAAA 2DBJA 1MF2L 3FL7A 5IVZB 3MBEB 3ILQD 1OSPL 3KPRB 3IJSB 2HFEA 1ZHLA 4JN2A 4XP6L 3S88H 1J87A 3LDBB 3O0RL 4HDIA 2A9NH 2WUCH 2D7PA 1A7BA 4KMLB 3CLFH 4JO2H 1TFHA 5E5RB 4CVUA 1G1YA 5DMKB 3A0OA 1WEJL 1KN4L 1P6FA 1QLFB 4GG8B 4Q9QH 3RU8H 4D3CH 2XZQH 4X4XA 3G6AB 3OWEA 3QA3A 4FXLA 4PJBA 5IV2B 4FFVC 1FDLL 4YXKH 2GJJA 3C09B 1BLNA 3SDXA 2ATPB 4L9LA 1X9QA 2ITDB 2NY0C 2BCKB 3QEQA 1MCDA 4CMHC 1HH9A 2YRPA 3IDMA 1M71B 1NSNL 3BDYH 3BX7C 3NCEB 4HLJA 3BPOB 4RMTA 1YYLH 4POZD 4GMSL 3ARYA 1HI6B 4KXZI 4NNXA 2X4SA 3HNSL 3NCJL 2IBBA 2H1PH 2EEBA 1BFTA 2HN7A 4XVUC 3O2WH 1G6RH 2MKLC 1OP5K 3O45B 3TH2T 5TGBB 3HS0A 4JKLA 4WI6A 1T7ZA 4HXAL 2X4QA 4NC0B 3CVIL 4XHJC 1I8KB 4DGIL 1TETL 3IXAA 5IR1B 1MPAL 5FUOL 5DD5L 4JJHA 4OZFG 3LQAL 1HXMA 2V17H 5ICXA 1ROWA 5FUCC 2UVEA 3KPTA 1U3HD 5C0IB 4M48H 5E8OB 2D3VA 1UWEH 1S7VA 5IFAL 2FB4L 3HC4H 3HMXA 1FL3A 5H37H 4BKLA 4NHCH 4FQCL 5DQJB 3QUXC 2YEZA 1NJ9A 1FNAA 4RMSA 1X5GA 3QJFA 4UQ3B 2E6JA 2EH8L 5CP3H 3T09A 4LBEB 3ZYZA 1PKQE 5FHBH 3VU2A 1MOEA 5M95B 5GGVL 5FK9A 5C09E 4EDWL 4NO2A 1FLRH 2NMSA 1LD9B 4CDGC 3ZKMD 1T89C 3PWPD 3FFCE 2O61A 2R23B 3BWAB 1MEXL 3TCLA 4ZOEA 5FDYA 4K3HA 3X12A 2XXCB 1KB5L 4KTYA 5E9DD 4MDJB 3EYOB 4X80L 3A6BH 2QR0B 4JO2L 1DQJA 3QH3B 1PKQB 3U0TB 3PWNB 2ZUTA 3KYMB 5C09B 2DIJA 5ID0A 4HMEA 4Q9QL 4HGWB 3QDGE 4JFED 3OB8A 1LK3H 4L3CB 3FFCB 3KNBB 1BAFH 4K8RH 1I7UA 1OD9A 1HXYA 3G5VA 1MI5E 3BGMA 4PBVC 3DETC 4YXKL 2R0LL 3UYPA 3QDHA 1R3HB 2OX5A 5L0QC 2BERA 4L4VA 2HRPH 3STZB 1P7KA 1OCWH 4X7SH 1M7XA 3EJZD 1G6RB 5D2NA 3S3PA 3O4LD 1QLEH 3BT2H 2I07B 6FABL 4IRJB 2DQGH 4EN3B 3DUSA 3VJ6B 2FO4B 3AAZB 2DQJH 4G80A 3CU1A 4PG2A 1XCQB 4RA3A 2H1PL 1NCCH 4HHAA 1C08B 1FH5H 1G6RL 1MI5B 4GRLA 4GAJL 1CDJA 5CD5C 4OM1L 5HJ3A 1HK6A 1FV1A 4U1GB 3IU3A 5D7IE 3QQ3A 5LGJB 5F89B 2GTWB 5C0AD 3O6MH 4UIMB 5AZ2H 5A3IC 4GS7B 1U8QB 1MRFH 3V79C 3QNZA 2O5YH 4PJ9B 1I1FB 4FN0A 3HB3C 1M6OB 1RK0B 5JZ7D 1YEGL 4MCZA 2A83B 5GRVL 5HGBA 3F5WB 5CKAA 4UU9A 4NHCL 3VXQA 3RY4A 4O51A 25C8L 2EXYC 4CVZB 2J4WH 3L5WB 2PTTA 1XGPA 2AV1A 1EHLH 3NFSH 1XGTB 4GG6F 4TUOB 1HE7A 3LQMA 1R3IL 4OQTL 2DQIH 1RD6A 1YECH 2OM5A 3MRIB 4G9DB 1MVUA 1T1XA 2OJEB 5E5MA 5HY9B 3MV8A 1INEH 5MEND 1BD2E 3QFDB 4GAYB 3ISWA 5I17B 4PLKD 4NJAH 5F44A 5T3XL 4KI1A 4MAYB 3TM6A 4UTAH 5I75B 4NQDA 3MOBH 4LKCA 5IF0B 2IH3A 1A7PL 2HKFH 3P4LA 1H9VA 4OGXL 1DUYA 4JFFD 5HYSB 4UILL 1P53A 1EFXA 1MQ8A 2A38A 2X89D 4M00A 3SE3C 1WAAF 1BAFL 2X7LB 3H3PH 1BD2B 3VXRD 4JJ5A 3X3GH 3VFOA 5D2LE 4DQOH 3B3IB 1FFRA 5HHNA 1OAKL 2UY6A 4XXCA 4EUPB 2YPVH 1OCWL 2IEPA 4X7SL 5B3JE 5K9JL 1F5WA 3ZL4H 4HIJA 1TVBA 1YEKH 1QLEL 3BT2L 4YHOL 1DZBA 1DANU 2P5WB 3QUYB 2MQ3A 4RFEA 4ODXB 3MV01 2GAZB 1I8IB 2NNAB 2GCYB 2W38A 2ZSVA 3HE6A 4HBQA 4K7PH 4CN1A 1HIMH 2BJML 2B7DT 3PL6B 5IKCB 3INUL 4OLWH 3VRIA 3MRDA 2XWJA 4FFYL 1KACB 3T0EE 5D2LB 3SPVB 4OCXL 5C07D 4PJBF 4G7VH 1K6QL 3D3VB 4CU7A 5CSGA 1NLDH 1UH3A 2JIXB 4XC1H 1KB5A 3BVNB 2Q76B 1EGJH 3SDXF 1SY6L 3QQ9D 4MJ2A 3X14B 5CEZD 2Y1VA 5KSUA 2VLKE 1ED3B 5B22A 1I7ZA 4XPAH 1AD9A 4LCUB 5F7YC 1W2KT 3OKLA 1S5IH 3MBXL 3ULUC 5D1ZB 1K8IA 2ZCLH 4NSKA 4OGYL 4I0PC 1WWAX 4U6YB 5GJSH 3T0EB 1L7IH 1WZMA 3S3SA 2VLME 1H8SA 2J4WL 1GGUA 4X7TA 1BQHA 4HQQH 1VKXA 1CVRA 4PJ7B 3RWHB 1PQZA 4F7MA 2VLKB 1O5DT 4NPYA 4F58H 2FX8H 5LCVH 3C5SA 3KPMA 3VI4E 4RFOL 3HRZA 5HHPB 2DQIL 3FCTA 1EBPA 3PJSA 3DSFH 5BZDB 3HC0A 3P73A 2DM2A 1HWGB 1B88A 1U3ZA 1KC5L 3L5HA 4JKMA 3UPRA 3SDCC 2VDKL 1IAIH 5IB4B 2XN9A 3RTQC 3EZ8A 3FOMA 2Y07H 4OZGA 3CFDA 4X6CA 4YQXH 1QQDA 3GUTB 1HHHA 1BX2B 4KQ4L 4O2CB 5TF1L 1PG7H 1T5WB 3LKNA 4KKBC 4M6NL 3IDXL 4YFLF 5EB9A 3H3PL 5SWSE 4HZAA 4UV4H 4F9PA 4OD2A 3GNML 5EU5B 4ZD3H 2IALB 3VCLB 4PG9A 5ESAA 2VDPL 1QACA 1EXUA 3D85A 3OR7B 3S8WA 5FYJD 2BSSB 2J3SA 2PYEB 5EPMB 3MRKA 1IC4L 5LJYH 3SO5A 1MELA 2UYLA 1F3JA 1IEHA 2OQJB 2JB6A 1J0HA 3GSXA 4LU5H 5IB3A 1G7MA 5SWSB 4MZ3A 4OQTA 1XF2A 5CJXC 4OLWL 4K55A 3DX8A 4PJ5E 1KIQA 5T1KA 1NC2A 3OF6D 5FGCE 4PJHE 4YWGH 5GIRA 1KF9B 5ALBH 4MWFA 3IKCA 5E00B 4Z78A 3SE4C 5T5FH 1OP3K 2FHBA 2BOBA 1Z9SA 1ZT4A 4NKOA 4M5ZH 1HNFA 1Q1JH 3H0TA 3QCVH 4GRMB 4P3CL 4WW1B 3JV4A 4YR6B 3C9NB 3QHFH 3H9HB 4F7EA 4I2XE 4PJ5B 3S3JA 3UZQA 1HKFA 4U6XA 4JO3L 1GAFL 4PJHB 2NY2C 1RJCA 4K9EL 1QSEE 1UGNA 3BEWB 3NPZB 3QWRA 5BRZA 1JUFA 4Q6IB 3GSWA 4XB7A 4Z0XB 5C71A 4O00A 1KEML 4APQD 3FRPA 1RZ8B 4PJXB 3DROB 3DX6A 2XKNB 5ENWA 4G3YH 4G8FA 5ESVA 1I1AA 2YMXH 1S9WB 1XR9A 3HPJB 3MCLH 4L3ED 3ZKXB 4P2RB 4YXHL 3RWDB 1OF2B 3CFKA 4I2XB 5FA3A 4EDXB 5KVDH 1NANH 1CICA 3C5ZD 2CXKA 1QSEB 4RWYH 1P84J 5J4MA 3MSPA 4MA8H 5EO1A 1D6EA 1XGQB 1VA9A 3N9GH 4YQXL 4FABL 2ZG3A 5D96C 4ORGA 3ZE2F 3BKMH 3IGAA 4W68A 1CDIA 2F5AL 3T0XA 2P8LB 4GXUN 2JJTA 3GBMH 5L8KB 1IZKA 5C0DB 4ZQKB 1BVLA 2HLAB 5K9OB 1KENH 4NQCD 4YDLC 4TNWF 1E6OL 15C8H 2Z4QB 1RHHA 3FQXA 1LVEA 4I18A 4PREB 2FEDD 3DXAE 4F2MA 1BQHG 1VEPA 3FZUC 3AREA 2V5YA 3PQYE 2IGFH 3C6LD 2X41A 2NX5E 3LEVL 2H2SC 1R6VA 5DUPL 3WV0A 1JZ8A 4AM0A 3KR3L 4Z7QF 4GLRI 1DJSA 1OPGH 2L4OA 3ZKQD 3QXTA 4KK6D 2HG5A 4YHPA 4J3WA 3VXSD 1ZTXL 2BNQA 3GM8A 4LAQL 3WNPA 4G8GD 4TPRL 4YJZL 4KK8D 2EYRB 3MGTA 1MWAL 4PY7B 5F93C 2ATKB 3V5HA 3L3IA 4Q97A 2VWEC 5D7JC 2P5EA 1AD0B 5JW5B 5F9JA 3OG4B 4JFZL 1AO7D 2B1AH 1Z9LA 3LS5H 3PQYB 4ODBD 3EO0B 2NX5B 4TULL 2D0GA 1Q1JL 3WUWB 3QCUL 2W59A 3OR6A 4OI8A 4HC1H 1A7OL 3NA9H 1XEDA 3QI9A 1CIUA 2DQCH 4R4NC 2QADB 4FQXB 3VXTA 3VDAA 4YHNB 2X44D 4LGSB 3V6OE 5LXGH 4R7NA 1OAQH 3BEVA 1J8HD 4H26B 3CLEL 1K2DA 4ZUUA 4G3YL 4P5TD 2AS5M 4ZUWA 4FFZH 3DURB 2E8YA 1UYWH 5C08D 4WO4B 1QBBA 2APFA 1I9IL 1RURH 5KW9H 3STLB 5GRVK 2W9LA 4O2FA 3WDIA 3MXWL 3TNMB 4XNQB 4HJGA 4JN1H 1L9NA 5TE4H 1HKLL 5CLTA 2BVQA 3T65B 2VXSH 1IAOA 4QYOB 1RUQH 4J4PC 2WLZA 2QKIA 4ZXBB 2AJUH 3TESA 5EU6D 5T1LD 3ARGB 3TO2B 4LCYA 4ZFOL 1ZHKB 3U36A 2YPKB 3QUXA 3S4SB 1ZLUK 1DE4A 4LCWD 5AZEH 5IIEA 5F6IB 2PW1B 3JWOH 3HG1A 2VXUH 4W6XB 1JMXA 4H8WH 1JNHA 4M61B 1AY1H 1KPRA 2R0WL 5L2KA 1KTRL 1IEAA 3FRPG 4OZGF 1T89A 3IFPA 3E6HB 5F8RC 4DN3H 4OUUB 4KFZC 5AWNL 4X6CF 1OWRM 1FPTL 4JKWA 3TZVA 4IDJL 2ZJSH 2CR6A 5HDQL 2X4NA 4LRIC 3LIZL 4E42A 3OV6A 3P3YA 1QKZH 5CBEA 5AD0A 3SKNB 4JKPH 1JGDB 1BM3H 3WDHA 4OD3L 1UWGH 1XAUA 3ULUL 1IGFL 4PRHE 3QISA 4XCYA 2B1AL 4Z9KB 4YBQC 2EYTA 3HI6L 3VXMB 4D8PA 1HINL 2MSPA 4M7JL 3B9KC 1BFVL 1FGVL 3W2DH 3NZHH 4P48A 1M05B 4N9OB 1CD0A 1CZ8L 1X5FA 3BDXA 1W72H 1CE6B 1EA9C 5D7LE 2A6IB 3MNZB 1OM3L 2DQCL 4FP8H 1AGFA 1J0ZA 3GI8H 1MNUH 4FQIH 1JPFB 4PRHB 1OAQL 2XQBH 4F9LC 1HSAA 2FX9H 3CDCA 4NRZB 4O5LL 4DK3A 1Q9OA 1I4FA 3PIQB 4F37F 2YN5A 3O2DH 4GFTB 4K94H 5KSAC 1S7UA 1RURL 1A7RL 4YXLH 2WANA 3WKNA 2NR6C 1EEUA 2WQ8A 2EH7H 4LF3A 5E6IB 3NGBC 3ZYJA 1C5BL 5ICZB 2YC1A 4NQCE 5GS1C 4RGNB 4OZFH 3K1DA 2X4UA 1S7WA 3QFJB 4NUJB 4ODHL 4QRSA 5TQ2L 1MHHB 3CSYB 5SWZB 3CFEB 3QEQD 5E2VL 2GTZB 1QBMH 3GMNA 2QEJA 3LZFH 5HYQA 2AJUL 4PJAA 2LU7A 3WFCL 5IG7A 4G6FB 2KL6A 5IW1A 3DVNA 5CINL 4X98B 5KVFH 4PGDA 5AZEL 3RY6A 5JPMA 5F9OL 4HUXA 3VRJA 3THML 4XVTH 3GFUA 4LNVA 5ISZB 1QFUL 4X6EA 3FQNA 4G6AD 1G7JB 5FKPB 3DX7B 1B4JL 3MLYH 3OPZH 3WFDH 1A4JB 4Z7NF 5GS2H 4UIKH 3R4DA 5F7DA 3QDAA 3UJIL 4GXVL 4O4YH 3GMOB 4NO3A 1ES0A 1F2XK 1IAKB 2RBLA 3DYPA 2VQTA 4C4KO 1C5DB 4P23B 1OGAE 4DN4L 4JFXA 5I30L 4WW2C 1WC7B 4LLUB 2JE8A 4U4BA 1SYSB 3IRPX 4WUUE 1YEHL 2LU4A 4MNHB 4ZUVA 1UWGL 9CGTA 2CPCA 4QO1A 1S9YA 1W72B 5GRJL 1V7NL 4ODTH 3SE3A 5EUKB 3L3JB 2R0KL 4LLQA 4Y0GA 5HHXH 1H3PL 5C08E 2HWZL 1HOCA 1FVEB 1UFUA 3EFDL 4HIXL 1RY7B 4OBRA 4LLDA 4Z77B 3MXVH 1OGAB 1BP3B 1DVFB 5TFSL 4HS3B 3JV0A 4KJQC 4MXQC 4ZFOA 1D5ZB 4N5EC 2VDOL 2OTWA 1MLCB 4P9MH 4RMQA 5A2LH 1NEZB 3T1FB 1WGOA 3L5JA 3T4AA 2UY7A 3SOBL 5GGQH 4D9QD 4QWWD 3V9FA 5FCUH 3RHWK 3LKPA 2F54A 2D0FA 4YPJA 4HWBA 3MA7A 4HEME 1J1OL 1N5YH 4PB9L 3SDAC 4L4VD 1NCWL 4GG6E 4PLOB 4FQPA 1TPXB 3ARWA 3EFFB 4I0PA 4YUEH 3MREA 5I8OL 3O6FD 1C16A 2XA8L 1I8LC 3RKPA 4P49A 4OI9A 3SKOA 1S7QA 4XVTL 5ITBL 1W0YT 4GRLD 3EHBC 4QHNA 1YNKH 1CR9H 1MCSA 3MOAL 5DTFB 3FQTA 4N9GB 5J6HA 3PWLA 2OI9B 2D9QB 1FORL 1OAZL 5HDBF 1CLYL 1MHCB 3NCYS 4K7PY 3GB7A 4DK6A 3BKCL 1OAUL 5D4QA 4ZTPH 3MBED 3P0VL 5H94A 3SDCA 1R5WA 1XGYH 4M1GH 3RTQA 5HPOA 3JTTA 1HEZB 1JPGB 4L5FH 2FJGB 3RL1A 5A1AA 5ID1B 5E24E 2NW3A 4D0CA 3AS0A 1FYHB 1OTTD 4AEIL 1OB1A 5BS0B 1S7XB 1VACA 2QQKH 3BDBA 3RL2B 4M7KL 1Z2KA 4HFUL 5IQ7L 1A2YB 1A6VL 4MQ7A 1RZJC 1JI2A 1VFAB 4Z7VB 3W9DA 3W39A 2H32H 4FQ1L 3MUGB 1GOGA 4PJBE 1U8OB 5JOPD 3MV8D 3HI5H 1ETZA 3RZCC 3W9EB 1KGCD 4NQDD 3SDXE 2DQDH 4ZTOH 5JMOC 1MSPA 4HGKC 4I3RL 2V5MA 1U8MA 1LO4H 4JQXA 3NFPA 5I1AA 5I1DB 1VENA 1IEBA 1DDHA 3LEYH 1AH1A 3T0AA 2R9HD 5D9SA 5FCUL 1C1EL 1T22A 4AEEA 1I85C 4Y16C 1EFXD 1SMAA 1A0QH 5IEHA 3SE4A 1EV2E 4L1DA 5D1XC 3L9RB 4ZODA 2BVYA 5CGYD 3FFDB 4L9LB 5IM7A 1W8NA 3N85H 4X4YA 4MD4B 3OKDB 4KZEL 5KANI 4DKAA 3SGDH 1KTLB 1Q9LB 5HGDA 4DVRL 4JZJC 4D94A 5SV4A 1MFDL 1EO8L 2VUYA 3K2UH 3ZSTA 1N59B 5KVEH 3DWTA 4BQ6A 4LFHD 4U1NB 1DQLL 4JO4H 1IT9L 3VG0L 1HQRA 2OJZH 5E99H 1ZLWH 3C6SB 2DWEB 4J6RH 4MX7B 3RAJL 3CAFA 3RBGA 1ZGLM 4ZTPL 3V6ZA 1GVIA 4P2OC 1HILB 2EE2A 2J7LA 5FB8A 4PJGA 4PJAF 4GUPA 4NNYA 1U8HA 5FF6B 1JN6A 3VFGH 3ZKSD 3IFLL 3OXSB 5DT1L 3MA9H 4U7MA 1I9EA 1FIGH 1FZMB 3PABA 1T66C 2A74A 5BJTA 2VDMH 5HHME 4J2XA 4U3CA 4GBXB 3BP6B 2H32B 3GJFA 3IDYB 1P7QB 5FXCH 5IBTL 2F74A 4JREC 5GSRB 3I6LD 4CMMA 3LPGA 4NZRL 5JO5A 5L8LB 4PRDB 4DEPB 4LASL 4BSJA 1N64L 3LRSB 1IAIM 2B1HL 4CNIA 4XT1C 3TO4B 5JUEH 4R26L 3K46A 3QPQC 5FAAA 3L5XL 4KAQH 5IJVB 5HHMB 2W1NA 1RV6X 4L4VE 3VFTA 1F4WH 2XN9D 1ACZA 3V52H 1WCBA 1UKTA 5IBLD 1LO4L 5D7SH 4LSSH 2UZIL 1FZKB 4NT6A 5BO1H 1UACH 2FATH 1A0QL 5D7JA 1CIDA 3LKRA 4YAQA 3EBAA 4DUWA 1U3YA 2VDLH 3UDWC 3PWJA 1JZ6A 3KPNB 1OD7A 3LN5A 4QRUA 1S9VA 5FOJA 5MEOB 3D85D 3HLAB 4S1DD 2X40A 3EO9L 3N85L 2VKWA 3FT3A 4YDIL 4XH2B 4JY6B 3MRMA 1JNLH 1ADQL 4RIRA 1NCBH 1MIMH 2F15A 4M3KB 4KVCH 2WBJC 1WJ3A 3JUYA 4KGJA 3VFUA 4RAVB 5F9AC 1MFEH 2YD6A 5KVEL 2NXZB 4JZNB 5GGSA 5T1KD 1NC2D 4KKCC 3WXWH 1PBYA 1VFOA 3IJHA 1KUMA 1ZV5A 3FRUB 1PYWB 2AJSH 2Z91A 3HKFA 2HFTA 3WN5C 1J11A 5T3XD 4NN7C 5B39A 1JGUL 1N6QH 3ULUF 3PGDB 5IVXA 3BO8B 4DKEH 3BQUB 3EIFA 4QT5A 4CADA 4IS6B 4HS6A 5LQBL 4HK3N 3TYFA 1PZ5A 1IM9B 1Q38A 4LDLB 4P3DB 3TN0A 3VFGL 2OP4L 3BZEA 5CILL 5JOPE 4J4PA 1FIGL 1H5BB 5JW3H 2V5RA 4BQ8A 3QAZC 3V0WH 5BRZD 4FZ8H 5IMLA 2JJVA 1ND0B 3OKKB 1HHKA 2B4CC 3U4BH 4BSVA 2FSEA 5I1GH 4Z7QE 1GGTA 3GJEA 2DRUA 2AGJL 4NYLA 5JQ6H 3C60B 5HYJA 4D9LL 1I1AD 5ALCH 4LSUL 3HAEH 4MJ5A 3Q5OA 1UH4A 4DZ8B 4WTXA 1NMCC 1JPST 5FUZH 1I3GL 1LP9E 2J8OA 1CICD 4OI7A 5MP6H 3GEWB 3KWWB 3UZVB 5IESH 3AUVA 3JWDC 5IBUB 3VFRB 1ZVYA 4R8WH 5EN2B 4AIXA 2P5WD 3TPUA 5T1DH 4FQLL 3V52L 2BVTA 2C3WA 4G8EB 1QO3B 4ALAH 1W0VB 4FRWA 4MB4A 3VXNB 4X9BA 1E6JH 5EU4B 1JNJA 1ITBB 4LRIA 2LABA 2AKRB 2YPLA 1LO2H 4GOSA 4WI4A 1EHXA 3TJHD 2Y06L 5BV7L 1A3RH 1A7QH 3D3VD 2I9TA 4RAHA 2HT3C 1CDUA 1LP9B 4B7IA 2A73B 3CCHA 5A2FA 3B9KA 1NFDE 4P46C 5I8EA 4AIOA 3SCMC 2P7TB 2IJ0C 5IOPB 3VFVA 3DMMC 4YHKL 1FL6B 4PJCA 2QSCH 5GRYA 3PV6B 5L8JB 2WIIB 3ARED 1JMZA 4U1KA 1RZGA 4GMTH 1A9EA 4D0DB 1QA9A 1YQVH 1WV7T 1YN7A 5I1HH 2IPUG 4YHZH 4ZDHA 5A16B 3FB7A 3H9SB 5C0RH 2ZSVB 2AQ1A 4U0RC 1R3JB 3DIFA 3FO0H 2BNQD 1MFEL 2VSDA 2XWJB 1UM5L 4F9LA 2A6KB 3WXWL 5FECB 1J5OL 2CO6B 3MODH 1NFDB 2AJ3A 3VG9C 4XI5D 3F6IA 5DS8A 5F7UA 4WCYL 2P5ED 1HN1A 5KSAA 4CN4A 2ADGA 4ONGH 3D9AL 2PYFA 2IBZY 5EBLA 5ITFB 3ZDZF 5KSUB 1S7SA 2EKJA 2GT9A 4FFVD 5GS1A 3Q2CA 1KLFA 3NH7L 2OTUA 2VAJA 3PHOA 5HPMB 4NKMB 4XPBL 3D0LA 3PF2A 2NY0D 4N90D 5MI0C 2AAVA 3QI9D 3TYGH 2PXYC 3HZYA 4MSWB 3DGGA 4NGHH 5F8QC 5J1AA 1R5IB 3HAEB 4IJ3B 3HZKA 3RDTB 4OZGE 3U4BL 1YJDL 4YNYB 4LKXB 3O6LH 2QHRL 5FA4B 3NIDE 1GJIA 5F7EL 3C5SB 1NGYA 1T0MA 5ALCL 43C9B 2FX7L 5FIEA 3AROA 2P49B 2OLDA 4PJGF 4U6HB 4JY4B 4LEXL 1BZ7B 2NTFA 3DTXB 1UA6L 3MNWA 3FQRA 4JM2D 4R8WL 1CG9B 1IBGL 1H15A 4ZNEA 2PYED 3ZKNC 1H3UA 3LV3B 3BYYA 4XAWH 1FSKC 3BIAX 1N2RA 1BIIB 1E6JL 1XGUB 2AJXH 1QEWA 5B39G 4HKBB 5C6WH 1G7QA 1FNLA 1V7MH 4WW2A 1LO2L 4MNQB 5C9KA 3MLWH 1NAMH 5AUMA 3KPOB 1F11B 1WBXB 3FKUS 4YFLI 1ULVA 4L3AA 4CW1B 2FECI 3DO7B 1XT5A 4C56A 4JLRB 3QUXD 4AH2B 3NCMA 2A1WL 5H2BA 3UTSA 2EYSA 2VDNH 3LRGA 4HS8L 1HHJB 3HG1D 4DFHA 2QSCL 2XZCH 4YHMH 2Q7YA 1LDPH 1DQDL 4XCCL 4PRPB 4GMTL 5B8CB 5L2KD 1XGRB 1YQVL 3KJ4B 3GHBH 4L8CA 4I4WA 3GSXB 2EDHA 3TZVD 1CGTA 2RFXA 1D5IH 4LHQB 5HVHC 1J9CT 3EOBA 1N5AB 3FO9B 1YNTA 5DD0L 1KCSH 1ZK9A 2WM0A 4DTGL 3KLAA 3CFIC 4PJDA 4QCIA 3QXDA 4G43A 4P2RD 2VLRA 3KPSA 4GAGH 3QIWD 4MD0B 5C0EB 3MRNB 1ZT1A 3DETD 4LLMA 2NW2B 1I1RA 4P5MA 4YDVB 3GI9L 2ZOKB 4JM4H 3ZT6A 3MTRA 1NBZB 4NBYB 5I8KL 5D6CB 1LK2A 3QWOA 2QQQA 3JV6B 3UTQA 4Z7NE 2NY5L 1FYTA 2EDDA 5DZLA 2EE9A 1I8LA 3O6LL 3MJ8B 2D0HA 4OKDA 5HDLA 4QXUL 4OFDA 3L7FA 2O5XH 2ZCKL 5IVXF 5IHZA 2WNGA 3U46A 1Z5LA 4A2MA 4HKXB 4QRQB 3ARPA 4XPGH 3CUPB 3GMPA 5EA0H 4KH2A 1JK8A 3ROOB 1L7TH 4WFHE 1T1YB 1NAMB 2A9ML 3S9DB 4F57H 3EYVB 5A3ID 4XAWL 1FRGL 1LWRA 5ILTH 3QNXA 4NM4H 4X99A 1ZVHA 3RJQB 1E4WH 2W0FA 3HB3D 4ZSOA 3OX8A 4F7CB 1R5VA 1WT5C 3ZDYF 1J0KA 3SGJC 2SEBA 2R1XB 4H20L 4KPHH 1ACYH 4JPWL 2EXYD 3WHXA 2HMIC 1T7YA 3QEGH 3NCCB 3BE1H 5F7MC 4C57C 3LKSA 4PV8B 43CAB 4YHML 3BIKB 4UMGA 1MY7A 2R29H 1D9KC 1IM3A 3P77B 1M7DB 3DGCR 4XTRC 3RZCA 2QADD 5CIPA 4OCNC 2J6EA 1MUJB 4XBGA 2FBJH 3WMSA 5E4IA 3CFCH 3L3IB 5DEZA 4Q0XH 2XIDA 2F19L 1UQSB 1QHOA 4QGYA 2ZUYA 5DGRA 4R4FL 1I85A 4NIKB 4QXTB 4PJCF 1P5VA 5I73C 4PTUB 1PG7X 1KG0B 5D1XA 4AT6B 2B4CL 4JM4L 4JPIA 5DRNB 4NCDA 3EUUA 4XVJH 3KJ6H 3MROB 4AMKL 4N8VB 3QBTB 1NMBH 3WNLA 2Q6WB 5F9WC 4XAKD 3G5ZA 1NGQH 3PGFH 1A6TB 1JGEA 5HDBE 4XBEH 1F8TH 3BW9A 1PSKH 4JZJA 2XT1B 2YWYA 5DC0A 4QY8A 2OYPA 4UTBH 4BFEA 2R1YB 2DMCA 2R1WB 4YHYC 4OF6A 3EOYG 1U95B 1SEQH 1OP9A 3MO1A 1FZOA 2F54D 1MIEH 2WZPD 4X8JB 4FXGB 4OV5B 4R96B 1RZKH 3C8KB 2AEWA 3HG1E 4PIRF 1YN6B 5EZJB 2OR7A 4NWTL 4P2OA 3DBXB 4V1DA 4XCEA 4P9HC 2X10A 1EHNA 4X0KB 5D72L 1BFOA 1C5CH 5AAWA 3ULUD 4WV1B 2QKIB 1NGXB 2I5YH 1R3LA 4MNGA 5LGHH 1GXEA 2CIKB 3TVMB 1AI1H 3QZWG 1VADB 5I66A 4IRSC 4X7CC 5HVGB 1DL7L 3PXJA 4KC3B 1OY3B 4W81A 3WSQL 4Q58C 2AXGB 4KI5D 5ERWB 4JFPA 3RWJB 4BJLA 3O6KH 1SHMA 3SKUD 4OD1L 2FH6A 1XF1A 5IEKB 3MV9A 1A1NA 1J8KA 4I5BB 2YD5A 4OCWL 4HCRL 3QUZB 4WW2F 3SDCD 2X4RA 4OCMC 4FTVB 4PJFB 2HLFC 3CC5A 3FO2B 3HMWL 2F53B 4UI2A 3QXWA 3SDDB 2A6DB 4XP1H 2CLRA 3VGAB 4NKIL 1GH7A 4IOFD 2IAMA 4XCYB 3MRLB 3EYUL 1S5HB 4KKBD 4YC2C 1U92B 5JXAH 1PW3A 3P9LA 3LMJL 1E27A 5FO7A 3I9GL 5F88B 1U58A 2Z8VC 3UDWA 2EDRA 4N8PA 3QULA 3DX9A 5DHYB 3WFHA 3Q1SH 3WIIH 2ZPKH 3RPIB 4YFDB 4RGND 4H1LA 2CLVB 3DYOA 2GY5A 1RUKH 1NMBL 3LQZA 2I25N 2IPKA 5SWZD 1G9NC 4PJ8C 1NPUA 2WBJA 3EO1A 4F3FB 2YZ8A 1FNSL 3BJLA 3H8NA 1XF3A 1T20B 3GSUB 4MA7H 4UTBL 4XNXL 4MDIB 1ZA3A 3B2UC 4PJDF 4PJAE 4Y4HC 5DQ9B 5IWLC 3K4ZA 3WN5A 2VH5L 4KJYA 2G60H 2F58L 3ILQC 2ZSWA 3SE9H 4P2YA 3V6BR 3MLZL 1I3RA 3U30C 2Q8AL 2BNRA 3TP4A 4GKZB 3O3BA 4IOSD 3NAAH 4QRSB 3MLVL 1C5CL 2AK1H 2D7TH 4U33A 1GC1C 2I5YL 1ZHNB 3HCVB 4HWBH 4TTGA 3QO1A 1LDSA 4P23D 5DVLA 1MCPL 5LGHL 3G5YA 3EAKA 1CT8B 1QSZA 4M7LH 2GK0A 5IW1B 3D2UB 4KTEH 4DZBA 2DL2A 2Y9RT 1RHFA 1DBBH 1MCOH 4F7PA 3L3HB 1J1PL 4GKNB 2IQAB 2BXYA 2Y36H 2CK2A 5DJ8B 4D2NA 2YK1H 1GGBH 3BN9C 3DARA 4RA0C 4ODUA 4NQEA 2AK4B 2DQTL 1KIRA 2AV7B 1DVFD 3LN4A 1RULL 1MREH 5IMOA 1DQTA 1FLTX 1CYGA 1PLGL 5I76A 4G5ZL 2EDBA 1U8KB 2K1MA 3VWKB 4AIZA 2ORBL 2OTPA 5L88L 2GW5A 4YK4C 2GJ6A 3BP5B 1ZA6A 4EOWH 1V5JA 4ZO6A 5E08L 5T33H 4NQXA 5C0CA 3UO1L 4HMDA 2IPTL 1OTUD 3OJVC 4WWKB 3TIDB 2ESVA 5FHAL 4BZ2H 2XFXA 2YD8A 4NC1C 5IK3A 2X1PA 4S1SH 4P46A 4XB8A 1MAML 2V5SA 5IQ9B 4ELKB 3QG6B 1LO5B 1U3HC 1CF8H 2Y5EA 5C92A 2F54E 2GSGA 4OLZH 5EU7C 4YGVA 5E95B 1UVQB 5KZCB 2QLVB 5BQ7A 2H2SD 3EKCA 4MVBC 2VXVH 4HUWA 4E0RA 2NXYC 1JPTH 2IADB 2W65B 3IU4H 4ERSH 4UZGA 2MTPA 3SE8L 3M17B 1JHKH 1CK0H 3T8XB 4C58B 4N68A 3D25A 4HCRA 4K71C 1EJOL 1CL7L 3BAEH 5D7JD 4MCYB 3BZFA 1Z0NA 4K7FB 4LVHB 4YIQB 3V6FB 4LNRA 1BF8A 1HDMB 1UXSB 1ZWIA 1Q94B 4L8SC 4H25A 4PFEA 2D7TL 1TJIH 1JF6A 1BGXH 4U31A 1A6WH 4LSQH 2E6PA 2PXYA 4R4ND 5MEQB 3FMGH 3NFNB 4KTEL 2HFFA 4UQ2B 1A14H 5GGTH 2DQFA 1AFVL 2UV3A 4H1LG 5F7FA 1JWUB 1IC5H 4Y8DC 3S98A 4WIQA 2Y25A 1DTUA 5BS0D 3GMLB 2JCCA 4KRNA 4RISH 3LN9A 5SX4H 5TF0A 3EJZC 5IJKC 4DVBA 3O8XB 3NTCL 5CMAA 1RMFH 2FHCA 4XWOC 3B43A 5BXFB 1HHGA 3WJJC 4ZFZA 3MFFB 2ZUVA 2MCG1 1OLLA 3KYOB 1CBVH 2K7PA 3TN0D 1EZVX 1U91A 1TQBB 3WIFA 4J4PD 2DAVA 4FQHA 4L8DA 1BOYA 3CDYA 3NCBB 4TUJA 3G6DH 4ZPVB 2B2XL 4JRYE 4PRIE 5D5MA 2DYPA 5DJXA 2FIKB 3ECBA 4XMLH 2ILLA 4HT1L 1CFVH 5HYJD 5C0ND 4U1JB 4X5XB 4U1LB 4K3EL 2C1PB 3CMOH 4EI5B 2AI0H 3GJFH 5CWSA 4O9HH 5JZ7C 1PVHA 3D69A 2EDKA 4IIQC 5EU3B 2UZYB 2GK2A 3KLSA 3ZDZE 1WTLA 3H2WA 4OLYH 3F7YB 4MA1B 4JRYB 1A4KA 1MRDL 4PRIB 1YY8B 1X44A 5F96L 4RGMC 4HFWA 4PJIA 1B0RA 1BPVA 3X13B 3BZ4A 1RU9H 5FYKU 2YPLD 1FVDA 1T3FB 3SDYL 3STBA 4EQ2A 4P59H 1A1OA 2DQUH 3B6SA 3GRWL 3TEUA 3RWGA 1LHZA 12E8H 4YBQD 1C7TA 1S7RB 2DKUA 3OJDB 35C8L 2WINA 3W0WA 4PLKC 3B9KD 1XF4B 2I24N 1JZ5A 2Y6SD 3UBXB 3GSVA 3ZTNH 3BJ91 2DLFH 1VEMA 3T77A 1HSBB 3MRBA 2ICWB 4OLVL 1YEDA 3IDNB 4UDUB 3E8UL 1OGTA 4PJGE 1A14L 4YHLL 5J57B 3U0PA 3CGTA 4Y4KA 4N0UB 2R69L 1KJVA 4LLYA 1FFOB 4LDOB 1NAKL 5JIPA 1EAPB 2WSKA 4JR9L 3R1GH 3JVGC 1VSCA 5CJQL 1QFWH 4RISL 4P5KB 4RMRA 2DQHH 5KSAD 1ORQB 1H0DA 3ESUF 3VFMB 2GITA 2HRLA 5MHSD 1F90H 2FJFA 2YD2A 4KDVA 3FT4B 3H9ZA 1UADC 5FB8B 4PJGB 3TO4D 3RVXC 1BFSA 3UC0H 1X4YA 4WTZA 4OKVB 1XZ0B 4QRTB 2VE6A 1B4RA 1U6AL 3ARDC 4YPGA 2ENYA 5D96B 3GIZH 1WT5A 4KVNL 5BJTB 5TDNB 4OZIA 3SGJA 3QQ9C 2G5BA 1M7IB 4ODSH 5I16A 1KELL 2K7QA 3KGRA 4YHIB 4JAMA 1MHEA 3MRPB 4ODVH 4X6DA 4XMLL 1Z9OA 3M8OL 4JPVH 1KTDA 1T21A 4YDLB 3V4VL 4R97C 2VWEE 3NN8B 2L7JA 2AI0L 4KQ3H 2XY1A 1GGIL 4BFIA 1IQWH 3PHQB 1D9KA 1RUMH 4DW2H 3NPSC 3GGWA 3TA3B 5IT2H 5KS9A 2JJSA 3IJYB 2XICA 1P7HL 1XF5B 3NZ8B 2MFNA 2YD9A 2ZOLB 1B0GB 1S3KH 4KRLB 1IGJA 2C9AA 4F33B 3K2MC 1S8DB 3D1MC 5DVOA 1T7WA 1TNMA 3VXUE 4QOKA 4XCNA 2XI9A 5CHNB 3RWFB 1GCFA 1FO0A 2XTJE 5F3BB 1T1ZB 2V7NB 1ZSDA 4NOFA 3OKOB 1SJHB 1GC1L 2WIMA 4C56D 1T83C 1U8NA 12E8L 4WY7H 4PGZA 4D9RE 4TSAH 1KJMA 4E41A 5DR5H 2VC2H 3OL2A 1PD6A 1K4DB 2DJUA 5HYFA 4HUUA 2YZ1A 4U1HA 2IFFH 4HWUA 4MJIE 3VXUB 4HK0B 4BSWB 2MMXA 1FFQA 1VEOA 5IVXE 4MXQD 2XTJB 3MRFB 5K9KA 5I18L 2DI7A 3LPFA 5CJ5A 3TV3L 4B7LA 4U6VL 4KMTH 1HHIB 5C8JA 2IQ9L 5C0GB 3MZGB 2BDNL 3IDGA 4M6MH 1EEZB 3WNNA 1G9MC 1MFBH 5HI5D 2ED7A 4HKJA 2YBRB 3TT1L 1FJ1B 2VR4A 1Y18B 2DQHL 2HTKC 4MJIB 2R2HA 2X5PA 2VITB 1UWXH 3RIAK 5HHOA 4TQEH 3LB6D 3AMKA 2VLRD 4ZUTA 1ZXQA 3KPSD 3U4EA 1MRCH 3RGVA 5GISH 5BMFH 2P48B 5HYJE 1T4KA 3K8KA 1HCVA 5DQDL 3UTTB 3RWIB 2D03H 3D39A 4G6KL 8CGTA 2ITCA 1J12A 1KT2B 5J9PB 5TDPB 3BGFB 3VXOB 1BOGA 3GRWA 4TSBH 2NY4B 4WTWA 3GIZL 3KLHC 1QFHA 1YYMH 2PCPA 5E2WL 2XXMB 4N5UA 2JCCF 1VGKA 3OHXB 1CFSB 1Z3GL 4IRSA 5KTEL 1SBSL 4U1MA 4HZLB 4P99A 2P8PA 3PXHA 3EHBD 3P9MA 1JF1A 4PTTB 4Y19A 4LQFL 4KQ3L 3VGEA 3B8YA 4R0LC 1BIHA 1SEBA 5CCKH 2F5BH 4HJ0D 5LKNA 3HUJA 2C7UA 4XMKH 5DJYA 1RUPL 1S3KL 1G7IA 2PO6B 4PJCE 3ARXA 5KN5A 1TVHA 5JLZA 5LAXA 3H9SD 4WFGE 4M8QA 2OS7A 1TNNA 3OXRB 4NO0B 3ZE0F 1RZ7L 1HCFX 5D5MF 3I2CH 5IHUH 2RJMA 1X7QA 5DYOB 4QTIH 2Q8BH 4KUZL 5E8NA 5C3LD 3RIAF 3QT2A 3I6KA 4TNVK 3C5ZC 4WTZG 3JSSA 3OJ2C 5T1MB 3FB5B 3OAYH 4NDMA 1A8JH 4PLJD 2YRZA 4FZEH 1F3DH 2D31A 1ZEAH 1WFUA 4HGMA 4WJ5B 4JY5H 2H9GB 3ET9F 3Q0HA 4KK9C 1KCVL 4JO1L 4M7ZC 3FONB 3GSNL 5J13B 3ULVC 4PJIF 4PJ8A 3RZCD 2JJUA 4XCFH 3ULSB 4XP4H 5ACZB 3EYFA 4M02A 4G9FA 2HT2D 3BWUC 4ODWB 5IB1B 3U9UB 4W6YB 3MMEA 5DD3L 5I1EH 1ZHBB 4Y4HA 1TZGH 4OB5H 1SMOA 5EZIL 5IWLA 5C0BA 2PYFB 3C6LC 4HMCA 4S10A 2BMKB 3DI2B 1Y6KR 4WI2A 2C1OA 4UB0L 5BMFL 3CZFA 1BZ9A 1P1ZB 5TH2A 1NMAH 1K5NA 4KK6C 2DS4A 1N8ZB 4X6FB 2FYYB 1BEYH 3TBYB 4TSBL 3K3QA 3UYRL 4EI6A 1CDYA 3BP4B 3J8F7 1RJYB 1VPOH 1AXSB 4Z7WB 2EIEA 1TJGL 4ZNEE 3P4OA 3UTOA 4S11A 3GHEH 3EOAB 4JANB 4TRPL 5I1CL 5FDWB 2ZG1A 1KEGL 4UNVA 3KHQA 5FV2A 3QEUB 1NGZB 4Q2ZB 4LLWA 4Z7OE 3BH9A 4XMKL 4RBPK 3UTSE 1CXHA 3MNWB 3I02A 2V2WA 1I9RH 4CKVX 4XNMB 4V1DD 5CD3B 1UB6B 1V3MA 5EZOL 3R8QA 1SVZA 5BZWA 1QEWB 4OZIF 3PWUA 4I13B 2CMRH 1AQKL 1F6LL 1EJ6A 5IHUL 1PAMA 2BVEA 1XIWC 3G04A 1Q0XH 1T04A 1N6VA 3F7RA 1A7NL 1ZKAA 5M7QA 4OF0A 1FZJB 1ZS8A 2X1OA 3QDME 4AL8H 2F8VA 4XZUB 4FZEL 1WIPA 2CKBL 2Q7YB 1YDPA 2Q86A 5I9QC 1T5XA 2HFGH 3A6CL 4LSPL 3MV9D 3KPSE 5EWIH 4CRPA 3D0VA 5CUSL 4LLVB 3QPQD 2VERN 1BBJB 3HNVH 1P9MC 5DF0A 5I6XB 2M1KA 3P9WB 3OKMB 5CEYB 1CGUA 4EVNA 1JNNH 3RA7H 2IANA 4OQ1A 4MYWB 3QDJE 2GJZA 1ITCA 2MQ0A 3MLXH 2UUDH 5FGSA 3QDMB 4QNPF 4N0FA 4JDZB 2JK5A 2VABB 2CDFB 1DBKH 4OB5L 1QPXA 2IAMD 5J6GB 5BVPH 1FYTE 1AP2A 4QCIB 4J8RA 3KYNA 3WFEL 1AHWC 1NBVL 1NGPH 3LKOA 4LL9A 3HFMH 2BVOB 5I8CA 4LLMB 2P24A 2VL4A 2VOTA 1LE9B 4L8SA 3SDAB 3ES6A 3F7VB 3QZWB 1I9JL 1NUFA 2NY1B 3QDJB 1G7HB 1JHLH 4H0GA 4KJPC 1E4XL 4L4TA 3RBSA 2ARJB 1U8PA 5FO9A 3OAZK 3NVQA 4R2GC 3U6RA 5DJZB 1QSFE 3SQBA 3EJJX 5FYKL 4C83B 2WBJD 2QTEA 2FLBT 1GRWA 2QQNH 2G2RB 4ZYKB 3VWJC 4NQSA 1YEFL 5I1JL 3S35H 2Z35A 4ZSOE 1JRHH 5INCB 1N7MH 2KQNA 1ZVSB 2W60B 1BJ8A 3GSNA 1Z5LB 2E6QA 3ALXA 3O3AA 4PGJA 1DBMH 5AYUL 1IKFL 1KB9K 5KSVA 5IJKA 3O4LA 3QYCA 4JRXA 1QSFB 2BNRD 1G9EA 2VXQL 1P4LB 1FE8L 1BWWA 3G6JF 1OAXH 2J5LB 7FABH 5DA0B 2QQLH 4DGYH 2W0FB 1M1SA 1OT1A 2RQ8A 2HVJA 5JPNB 4M93B 5JXED 3ARBB 3FN3A 4P2QD 3O11B 3MV7B 5D1QB 4YBHA 1QVOA 4B50A 3K74B 2WV3A 4QRPE 2OSLB 4NM8L 5DJ2A 3S96B 3HUJF 1RVFH 3A67L 2HT4C 2DBLL 3FB6B 3C8DA 1A5FH 1NCDH 1EK3A 2BZDA 5GGRA 4IHOA 3O2VL 3BXNA 2R2BB 4IIQA 1CU4H 2IH1B 4N0RA 4YDKH 3LVEA 3V8CA 3TIEB 5DWUH 4QRPB 3K4AA 1KLUA 1CGYA 1S7TA 4PYGA 2GJ6D 3WS3A 2HKHL 4R9HA 3RIFF 1FCGA 3VFNB 5JIHA 5DFVC 4NQVA 3AXLB 3TBVB 4Y16B 2H3NA 4LPYA 1IVLA 3AS3A 3S7GA 1DLHA 3MUZ1 2BVPA 2DLTA 1NUGA 5GGUA 5IB2A 4P46D 4ETQB 3UROR 4TOYH 4KWUA 4QHMA 4OZHB 5EC1A 5JORB 4F80A 1WWBX 1MFAH 5D6DC 5DJCB 5DSCA 4HIHA 3ARFC 4DKFL 4TTDC 4JQIL 3QJHA 4XGZA 5E03A 5L6YH 1A6ZB 4KHTH 4MAUL 5CBAB 2CKBA 1A1MA 1I7RB 4JZJB 4NRXB 2R4SL 4H1LH 3P4MA 1LILA 4J3VA 4OIAA 3TVMD 3VXRA 2ED9A 2WP3T 3HR6A 3BH8A 4MNGE 2VTFA 2BNUB 5EOCL 5E8DH 4NJ9L 3UZEA 3U7WL 3GMQA 2CKNA 4UOW1 5EDXA 5GHWH 3EYSL 4KHXL 4W4OC 4LARL 4K3DH 4JG0H 2VDRH 3PUCA 3Q6GL 1G0XA 3FN0H 5ESQA 1UXWB 1YMMA 4Z7UB 2N56A 3VA6A 3MV9E 4PRAB 4ZPTB 4FTVD 1MFCL 4TVPD 4S1RH 4QWWC 3ARDA 2AXFA 1TZHA 2PXYD 4U1SA 4URTB 5EC2B 3JXAA 3AB0C 3S36L 1JWSB 3L3GA 4MMZC 4WFFD 4P57A 2E7CA 3MRJA 3ULVL 5GJTH 2DOCA 3F12B 5D7KD 2OL3B 3UJTH 5C2BL 4Q74A 1DFBL 4JFDA 1F00I 1IRAY 1GPOL 1NCDL 4R90H 3T4YA 3GIVA 3T3MF 2YA1A 4WU7A 2H26A 4KRPC 4LOUC 4UAOC 3O6FC 4YDKL 2OL3L 2Z93B 5DRZB 5HGGS 1M4KA 5DWUL 3U2SA 3ZKND 3PWVB 5EO0A 1JI1A 2DQEL 1DBAH 4HH9B 1LMKA 4KTDH 5CS7A 3MLTA 2ZUQB 3IETB 2DIBA 1ZANH 3LEXA 4XP9L 1PY4A 5GGSY 3JWDH 5MEPB 1ZE3C 2MHAA 5SX5H 2WUBL 4PRNB 3LPWA 1T83A 2A77H 2DYPD 1EHAA 4OCRL 4W6WB 3OGCA 3CXDH 3MBEC 4Z18A 3DX9B 3V4PL 5C6TH 4LSVL 3VH8B 1FAIH 4O02L 1URLA 1VB9A 1MFAL 1QG3A 3LDBC 4Y5VB 2EDOA 3LY6A 5JMRA 1FGNL 1NH6A 3IXTA 4J3UA 5BOZG 1BMGA 4HWEH 1YPZA 4HPYH 4HV8B 1JWMA 2EDFA 4GAFB 3VE0A 4H5SB 4JFOB 2EC9U 1QRNE 3KLDA 3U82B 4RCAA 1V3KA 5E8DL 3DRQB 1IGIL 3OB0K 2BSED 1AIFB 3V0VA 4PB0L 4QRRE 2O5ZL 2VL5A 3C09C 3GK8L 4IMLA 2BHZA 5JR1H 2BRRH 3S37H 4XC3H 1MCKA 5DJ0A 3BPCB 2BHYA 3KHOA 2AK4D 1X4ZA 3VFSA 5TQ0L 2YUZA 5E2TL 4JDTH 1YEJH 2AEPH 3BPOC 3O9WB 1UCBH 2XWTA 4WEBL 2BC4A 3IFOB 1QRNB 4NQEE 3MQIA 5DRWB 4LSDA 2ZWLT 1T0NA 4JFQA 1WBYB 1CLOL 1FVCB 5F3HA 4ONHA 3LQAC 1CQYA 4ONFL 4QRRB 4Y4KD 1FNGB 2R2EB 2RGSA 3L6FA 1RK1B 2E8ZA 4TVPH 3BKJH 1AGCB 1CS6A 3QUMH 1ZLVK 3UPCA 5IFHH 3ARUA 4NNPL 5C0CE 2VAAA 1KXQE 1XR8A 4FQ2H 4GW1A 4WGWB 1LE5A 3NABL 2ESVE 4M03A 1S78D 3TJEL 1NC4B 4DFIA 3WLBA 4J12A 4WI3A 3VFWA 5FOBA 1PX3A 3KXFB 2X9WA 3OAYK 4TN9A 4Z76B 3QXAA 4KTDL 4WI5A 3V5DA 2ZCHL 4KKLD 4QXGL 4X9FA 1MLBB 2Q1EA 4GW4A 4KY1H 3F62A 4L3EA 3MGOB 1JPSH 4GQ9H 1IARB 1PY9A 1HQ4A 3KPPB 2P44B 3B9EA 4XPFL 2J12B 3C5ZA 2HMID 5IK3B 5DRXB 2JF1A 2NY6D 5C6TL 4POYA 4QF1B 1MCBA 3SCMB 1FAIL 3IDIA 3DMMB 3U1SH 4PS4L 1I7TA 3HR5B 1K85A 4QTHA 1BQLL 3IFNH 3MJ9A 4JCMA 5JNYA 1NLBH 2XZAH 4RNRA 1OARH 4LHUB 5J0BA 4RQQB 1CGWA 4XBPA 4OLXH 3CVHL 4FMKA 3SY0B 4MXWH 3MR9A 1VFUA 4XTRD 4PP2B 2VLJE 4WNQB 1DEEA 4QOKD 1QLRB 4TVPE 3VG9B 3FB8B 1BBDL 3K8MA 4JG1H 1CDCA 4AEFA 3CX5K 4GW5B 4WFFE 3REVB 4ZUSA 3D18A 3C6LA 1AKJB 5DK2A 2Z31B 4LSTH 5EBWB 4HWZB 2JCCE 2BSRB 4FQQA 2XPGB 3IAQA 8FABA 1YEJL 2AEPL 4IRJC 4E5XA 4EN3C 2VLJB 1UCBL 5IBLC 2G75B 3FQUA 5ANME 1AGDA 1DQQB 2WWKO 3QUMB 1A64A 3RI5K 1BECA 3QQ4A 4XPTH 1JFQH 3WKML 1RJZB 4PGCB 1VFBA 1KPVA 3B5GA 3SKMB 4UNTA 1KJ3L 2XWBA 3VRLE 3BKJL 2W9EH 4ISVA 2JB5H 2J88H 3MJ6A 4MD5B 4F15C 5DZNA 4AENB 4G42A 3V5KA 5JIIA 3R8BB 3GSOA 4GS7C 3ZE0E 5JDSB 5ANMB 3QNYA 2B39A 3VW3H 1QBLL 4NZUH 4PJ9C 4X4MA 5D5ME 3RVUC 3OKNB 5HHOD 1YEEH 4MQXD 3H42H 2VDQH 3RGVD 1WITA 4O2EA 3C8HA 2J8UA 4XWGL 3P30H 3DUHA 1QYGH 3ARTA 5GS0L 5CKGA 4HH8A 3QIUB 1F6AB 5J11C 5DLMH 1KBGL 4NO5A 1XIWA 3T2NH 5IGXH 1JPSL 2PW2A 5D5MB 4WHTB 4PJIE 4WU5B 3SN6N 3KPLB 2FWOA 2D9CA 4GKSA 3ZSSA 4JZOB 5EOQH 4UT6H 5T3ZL 4Y19D 5D71L 1ZT7B 2VLLA 3MRRB 1LEIA 5I75C 1GZQA 3KYKH 5DMIH 4YZFE 1SYVB 1RIVL 3KPQA 4UBDC 2X6MA 3GMRA 3M1BB 3F8UB 3W0WE 3G08A 4XHQA 4Y4FB 5F1IA 1OSZB 5EU6A 1LEKB 3N1FC 3MJ7A 2G9HA 4JFHE 5T1LA 3ZYIA 1J10A 1P9MA 3HZMA 4XNYH 4J3TA 5HHQA 4LCWA 3PNWA 1KB9J 1RUAH 2HLFD 4HXBH 4PV9A 1WQVT 4JDVA 3L95A 1KIPA 4S2SB 4A6YL 5JHDB 1T2JA 5INDB 5KANG 2YWZA 5J12B 3DRTA 2CDGA 4R3SA 2A6JB 1NL0L 1AHWA 4Y2OA 1FO0H 3E6FB 5F7NC 1B2WH 1NKRA 4N8CH 5LWYL 3F7PC 2GFBB 5EFIA 3TT3H 3PL6C 4UV7L 2XQYK 3DVGA 1RZIB 3DLQR 4DJMA 1JFQL 4I3SL 3TJHC 1N3NB 4PJ8D 1LEGB 4HX1B 1XCTB 4LLYB 3OSKA 4G9FD 3LKQB 1D5BB 1F4YH 3VWJA 1FG2A 2J88L 2YSSB 3TBWA 1CQKA 2ADFL 4P4KB 3KDMB 5E94B 1Q0YL 3CVHA 4I18C 4FG6C 1L6ZA 2YXFA 3MRCB 4NZTL 4KROD 5C0BD 3OAUH 5C86A 5EORL 3AREC 1YEEL 5D1ZC 1V3JA 3QUKA 3PGCB 2CK0H 5T5NG 1JGLL 1NUNB 1WZKA 2W9DL 3L1OH 3RWEB 2BHUA 2APBA 3BD5A 1G84A 1G7LA 3OBAA 1BVKA 1GHFL 2D7NA 3QSKB 1R3KA 2YXMA 3JWNC 4XI5C 5I2IB 5KBNC 3TWCL 1N4XH 5IGXL 5IB5B 5E8PA 1CDHA 1NCTA 2DKMA 2WWMC 3PDOA 4WENB 4QOKE 3TC9A 2CQVA 4P9HH 3WYRA 4I0KA 4U2ZA 5EOQL 4OJFH 1KJ2A 1SJEA 4UT6L 3SQOL 3IRZA 4BZ1L 5FO8B 4P4RA 1UM4L 4Y8AA 3QI9C 3MRGB 2AEQL 3BN9D 5MERB 1MHPH 4ZS7L 1TTUA 2FGWH 4E41E 3L3OA 1EO7A 5IMKB 1X5YA 4N0YH 4UINH 3HHRB 2X4OA 3CFBA 1RUAL 4HXBL 5I1IH 3VFPA 4MA3A 5JQHC 1ZSDB 1IC7L 1DN0A 5TE7H 2CLZA 1X6LA 4NP4H 4LMQI 3O41A 3SKJH 2QL1A 4JM2C 5I73B 1A6AA 3IT8D 1B2WL 2GUOA 3ULVF 1SM3L 4I3GA 4XVSH 5EIIA 1NGWB 3ESVF 3TT3L 1KCLA 5B38A 2FHFA 5D6DA 4PBWD 1OAYH 1F45A 3ARFA 3FJTA 5F9WB 5GZOD 4Z5RB 3D39E 3WE6A 5T5NF 1D5MA 4MVBD 1TCRA 5F71A 2NXYD 3FQWB 2EO9A 2PR4H 2UWEA 3IDGB 2IAND 3HRPA 3WNMA 1BJMA 2M2DA 3CU7A 1FFPA 1HNGA 3CPLB 3HE7A 3G6JE 4NFDA 5D70L 1CGSH 1A6UH 2IG2L 2RCSH 3HZVB 4K3GA 1G9NH 4K9EC 4GJTB 1FNHA 1INQB 4XNUH 4HBCH 4PLNC 3TBSA 2X70A 4RMWA 5DK0B 3CDGA 3E1F1 3O3EA 1RFDH 4MQTB 3WL9B 4CN6A 1UJ3B 4W4OA 4ELMA 3L1OL 3D39B 3S88L 5J1SC 2BSTB 5FYLH 2HJKA 3TZVC 3U83A 5CEXA 3QPXH 2A9NL 2WUCL 4A6YA 5C3TA 3G5XA 1IQDA 3LSOA 3CLFL 4OTXH 1NBYA 1MH5B 4L4TD 3DVIA 4CAGA 1N4XL 3G6JB 2XACC 2VZ1A 3MRQA 5KG9B 3RU8L 4D3CL 2DDQH 2XZQL 5L9DH 3ZKXC 1EEYB 4F7TB 2D2OA 4Q9RH 1T2QH 5CZVH 3H7BA 3QIWC 3I50H 2P8PB 2XKSA 4GLRH 32C2A 2X05A 4LVEA 1QR1B 1FIEA 1UG9A 1SEBB 2J8UF 5SWQA 1F13A 2HVKB 3RUGE 5F7LB 4JRXD 4XP5H 4CVXA 2B5IB 3BDYL 4XWOD 3I6GA 1AGBA 3BP7B 3O6FA 2EIZA 4AK1A 1YQ2A 1YYLL 4IOIB 3QDGB 5IFJB 2K9UA 3VD9A 3CH1B 2CIIA 1HYRC 5C0JB 3O2WL 3P11H 4LIQH 4MJ6B 2VQ1A 4L29A 4Y1AE 5C7XH 5DEFB 5HGAB 4M7LT 2ADJA 4S0TD 4BH7B 4PJEA 1HZHH 1I1YB 1P4IH 5CSZA 1G6VK 1W8OA 2CDEB 3RUGB 3GSQB 4Q7DA 5IVZA 3MBEA 2FIRT 1K8DB 1XH3B 3PV7A 5FYLE 2V17L 5DURB 1T1WB 3KPRA 3IJSA 2ERJB 4M48L 1UWEL 1QR4A 3HC4L 4F8QA 1GZPB 3BPNB 5BW7C 1R24B 4TYUA 4Y1AB 5DMKA 3FT2B 5D7IB 3RY6C 4N1CA 4GG8A 3ROLB 1QLFA 1DP0A 4GQPH 5FHBL 3G6AA 3DUUB 1CFQB 3DOSA 5IV2A 1FLRL 2VISB 3ZE1F 2XRAH 3WD5H 3CK0H 2LVEA 2ATPA 2ITDA 4YGAB 2BCKA 4WDIA 3QHTC 2OZ4H 2QADC 1K4CA 4FQXC 3DI3B 1M71A 1DBJH 3A6BL 2BK8A 4N0CC 5JTWA 4LIQE 2X4PB 2OXHA 1HI6A 2XNAB 1FL5B 5I0ZA 5KVGH 1BJ1J 3O45A 4WO4C 3MLUH 3T3ME 3HPLB 1LK3L 5TGBA 4U1IB 1T2QL 4K8RL 5CZVL 5B38G 4GRWH 1B9ZA 2BRQA 1JYXA 1I8KA 1O7VA 5A40E 3ZHKA 2HRPL 5E1HB 4PRBB 2AJZB 4L4JA 1CL7I 4NC1E 2DQGL 5C0IA 5E8OA 4ZAKB 4ZXBC 3RVXD 2DQJL 4XX1G 1YMMD 3ARGC 1Q72H 3GMMB 1YNLH 4HUKB 1NCCL 3CX5J 5EU7E 2VZ3A 3U0WH 3IVKB 1FH5L 5DQJA 1MQKH 4YK4B 2AXJA 4UQ3A 5F6IC 3ARDD 1VDGA 2RR3A 4LBEA 5HGHB 1VESA 5J89A 4GO6B 1P4IL 4YO0B 2Y5TB 1LD9A 1ONQB 2PF6A 3O6ML 1YY9C 2OK0H 5AZ2L 3WHE0 1GOHA 2R23A 4LLAA 1MRFL 2AJVH 3BWAA 5DMJB 4MGXA 1YDPB 2B20A 2O5YL 3B2VH 4JFDD 5DI8B 1U3HB 1OQXA 5EOTB 3G9VA 5FYKD 3PWPE 3D6GA 4MDJA 3L3DB 3EYOA 3RKDD 3MX0A 2NY1D 4DCQB 1NFIB 3QH3A 1PKQA 4NWUH 3PWNA 3U0TA 3H6JA 3KYMA 5C09A 5I1LB 5E9DE 4JGUA 5DD6B 5JOFB 3KG5A 4HGWA 1EHLL 3WIHH 4GRWE 3C5JA 3GBNH 3NFSL 3ARQA 4JFYB 4KI5C 4L3CA 3KNBA 2DICA 1YECL 4JFEE 1AP2B 1R3HA 3PWPB 1CFNB 3STZA 1IFHH 1INEL 3KAAA 2OZ4L 2UVFA 4I0CC 4NJAL 4UTAL 5IP4A 1G6RA 3MOBL 5E9DB 2I07A 2NLJB 5D93C 1RIHH 4IRJA 5TPWH 4EN3A 3VJ6A 2FO4A 4GRWB 3AAZA 2J1KA 4LQ1A 5EH1A 2HKFL 3O4LE 3BPLC 1T7VA 2UWEF 3S5LB 1XCQA 3C08H 4I9WD 4IOFC 1C08A 5F7KC 3L3KB 1MI5A 4RZCB 3RNQB 1VGEH 4JFEB 5DD1H 3MV7D 3WXVH 2VZVA 5IMMB 1FG9C 3OKEB 5E6IC 3X3GL 5K9QI 1NCNA 4DQOL 5F89A 5LGJA 1ZGLP 2GTWA 1RJLB 4ELMF 1YMHB 5GRWA 1YUHB 2YPVL 4RGNC 4UIMA 5JDJA 2X9XA 3ZL4L 2HTKD 1U8QA 3ZDXF 2DI9A 3VDCA 1YEKL 5ABDE 4PJ9A 1I1FA 1QZ1A 5C0AE 3JWOC 1M6OA 2A83A 4K7PL 2CRIA 1HIML 2Y23A 5DDHB 2FBOJ 3F5WA 4QHKJ 3X3FH 1C12B 4JQXC 4Q9BA 4CVZA 5C9JB 5DK3A 4YDJB 3L5WA 1S9XB 3PP3H 4G7VL 4LRNH 1XGTA 4ZS6C 3KLHD 3DV6B 1PEWA 3SJVD 1NLDL 4TUOA 4ZO8A 1ZGLB 4XC1L 5E1AB 1EGJL 4LPTA 5TDOB 4OM0H 5C0AB 5HI3C 3MRIA 4G9DA 4JB9H 4XPAL 3UBXI 2V2TB 2OJEA 2AJVL 5HY9A 5EOCJ 3QG7H 3QFDA 1WBZB 1S5IL 4GAYA 3EOTH 3MUJA 4K3JH 2ZCLL 4MAYA 4PPTA 1J0JA 3DYMA 4P23C 4HIIB 3RWCB 5CEZH 5GJSL 5MENE 5FGCB 3CSPA 5IF0A 1J05B 1L7IL 3D87B 4NWUL 5C0FB 3LS4H 4EEEA 2YUVA 3BSZH 4HQQL 5HI4D 5HYSA 3MLPA 2HJLB 2C3VA 4KZDH 4PJEF 1KULA 1U93B 4YE4H 4F58L 2FX8L 5LCVL 3TLRA 2X7LA 4JFFE 5F9DC 3JV5A 1BD2A 2V6HA 4PUBH 1EUUA 3BESR 2AABH 3DSFL 3B3IA 1Y0LB 1B6UA 4HKZB 3LH2H 2CR3A 2BVPB 3RVVC 4EUPA 5MENB 3VXRE 1DVFC 3BHBB 1GL4B 4LFHG 4BH8B 1IAIL 1FNEB 1MJ7H 1IGYB 1RIHL 2KBGA 2P5WA 3QUYA 5TPWL 3HC3H 2Y07L 2GAZA 3IS1X 1I8IA 2NNAA 1FNFA 2GCYA 4KK9D 3VA2C 1IL1B 2DI8A 4IMKC 2AEIT 4K2UH 5IKCA 3PL6A 1SY6A 1ORSB 1JZ4A 4JFFB 3ULVD 1PG7L 3P4NB 1OTUC 2V9RA 1YC8A 2LE9A 4AEHH 5D2LA 3SPVA 1YMME 4HULB 5BCAA 3T0WA 3D3VA 4OBSA 4UV4L 3WFBH 2JELH 2JIXA 1UZ8B 4ZD3L 2GIYA 3BVNA 1Z9MA 5C07E 3X14A 2RAMA 1WTGT 3GSRB 1ED3A 1CVSC 1DLFH 3GMQB 3P0YH 5F1NB 3O3DB 4XXDB 4LCUA 2GHWB 5CEZE 2WBKA 5D1ZA 1Q9KB 1CTNA 4NZJA 4EJ1C 1G9MH 4U6YA 5ESQB 5BVJA 4FMFA 3I3DA 4LU5L 3X3FL 2B0SH 2I27N 5FYJH 5C07B 4PJ7A 5H35B 1TZHB 4YWGL 3RWHA 2G5RA 2VLKA 3B9DA 5ALBL 5ICYB 1T80A 5SV3A 2WP3O 3DXAB 5T5FL 2CRYA 5HHPA 2E27H 1IGCH 2OI9C 4M5ZL 1MAKA 5BZDA 3QCVL 1DQMH 4R97B 5DC4B 1INDH 3QHFL 2VIRB 4CBPA 1QFWI 1OL0A 3PE9A 4OIIH 2WMPA 5E8EB 4M1DH 3S35X 5ETUB 1KYOK 4UUJB 2AVGA 1EVUA 3VGHA 1TCMA 3TBTB 3LS4L 3GUTA 1BX2A 5H37G 4O2CA 1T5WA 1JL8A 5CGMA 2GSIB 3L7EB 4YE4L 5BOPA 2R4RH 5EUOE 1D5XB 4I9WE 2YMXL 4N1HB 3MCLL 4GT7A 3EYQC 1XIWD 2IALA 2NY3D 5EU5A 3VCLA 4Y5XB 5KVDL 4OAWB 3OR7A 2DLIA 2HJFB 4JM2A 2DMBA 4RWYL 2BSSA 3WEXB 4OF8A 1MJJB 2PYEA 4MA8L 5EPMA 3HC3L 1L0YA 4XPHH 1II4E 2C3HA 3EDDA 3S36X 3TN0C 2OQJA 4FHBD 4KGLA 5FYJE 3EDKA 1KLGB 3N9GL 1CFTB 1EGJA 5EUOB 5SWSA 1E28B 3JTSB 3BKML 1EPFA 4PGBB 2FZ3B 3TNNB 3GBML 5E00A 4NHUB 1PDKA 2X09A 2H8PB 5C0NC 1KENL 5C1MB 15C8L 3CXHK 5GSVB 1CXLA 2DWDB 3V0VB 4GRMA 3V0AC 5HYSG 5A43C 4WW1A 2IGFL 4YR6A 3C9NA 3LHPH 2ID5A 3H9HA 5KJRH 4PJ5A 1MAJA 1OPGL 2CUHA 5CZXD 4PJHA 5DEGB 2BC4B 1NKOA 1X5XA 4HF5H 3BEWA 4PBXA 5DUBA 1L6XA 3QIBB 1YC7A 2B0SL 2C4FU 2FCBA 4Q6IA 4X9HA 2KH2B 4Z0XA 4EUPG 4KJPD 4RAUB 5ADPH 2W91A 1RZ8A 4PJXA 3DROA 4R2GD 2XKNA 3IDJB 2YKLH 1S9WA 5D8JH 5K93A 3LS5L 3HPJA 1GGCH 4P2RA 1UJTA 3X11B 3RWDA 3VWJD 1OF2A 1U36A 4I2XA 3VMOA 4EDXA 1A47A 3QIWA 4L3EE 2Y6SC 4WFED 1INDL 2FL5B 3DV4B 4HC1L 1QSEA 5EBMB 5L2JB 4R0LB 3NA9L 2AQ2A 4M1DL 1U8LB 5DJDA 1OP5H 4QHLA 2E7MA 1XGQA 4CU8A 3TFKD 5E4EC 5LXGL 4I1NB 4UOJA 1KCRH 1QRKA 4APQB 3IDYC 5ACMA 2Y7QB 4PGEB 3QEHB 4K07A 1IGTB 1R0AH 2P8LA 4FFZL 3EW3B 1EMTH 1UYWL 5C0DA 3F58H 4ZQKA 1W0WB 5FGBC 2HLAA 4JE4B 4LEOB 5DHVH 5K9OA 2DTMH 1NCAH 5KW9L 1G7PB 3F6LA 2ADIB 2Z4QA 5D7LB 4DEPC 1D6VH 2IF7A 4JN1L 3TO4C 4NN5B 1F58H 1MWAA 2Z31D 3MNVB 5TE4L 3BUYB 5DJAB 2HT4D 5EIQA 2VXSL 4JHWH 3SO3B 4FFWC 4JGJA 1RUQL 2QHLA 2FR4B 3EGSB 1U8IB 4XBPB 3LCYA 4OCYH 1P6AB 1Z0MA 4FQJH 2EYRA 5DHXB 4E9LA 5BW7A 4NKDB 3VXSE 4PY7A 1QHPA 1K3IA 2ATKA 2MPAH 4G8GE 5JW5A 3TCXA 3JWOL 2NZ9D 4NQCB 2VXUL 3PQYA 3EO0A 2NX5A 3BKYH 4H8WL 4R7DB 2ICEB 4C59B 2AJYH 5DFVD 1AY1L 1FFNB 2L7UA 3WUWA 1AO7E 3EDEA 1JVKA 2VJXA 1NDGB 4XRCB 4DN3L 5F6HJ 1WFOA 1NDMB 4OGAD 5FKAB 3VXSB 4FQXA 2MCPH 4G8GB 1AGDB 2ZJSL 2I9LB 4Y5YB 5CJOH 4YHNA 5D2LF 1D3CA 1QKZL 5CP7B 3QO0B 4JKPL 1U2C