2DD8H

Crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
VQLQQSGAEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGGITPILGIANYAQKFQGRVTITTDESTSTAYMELSSLRSEDTAVYYCARDTVMGGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords IGG Heavy Chain
publication title Structure of Severe Acute Respiratory Syndrome Coronavirus Receptor-binding Domain Complexed with Neutralizing Antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2006-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dd8H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dd8H01
2IH3A 3FFDA 3ULVH 2I26N 4XT1C 2PR4H 3MREA 5CILL 2VLRA 4WW1B 2C4FU 3VH8G 1F4HA 3S36H 1XCTB 4LHQB 5DUPL 3W5MA 4RGMB 2XNAB 4F9PC 4KK9C 1CXEA 4OSUH 1HXMA 5L2KA 3KXFB 4H5SA 4HWNA 3GMOB 1JI1A 2BCKB 2V9RA 2VAJA 5DEFB 5DUML 2B1HL 3VFMA 5BXFB 3N85H 4OZFH 2BVQA 4TUJB 5HYIA 1FO0A 4KI5D 5DK0B 2IPUG 3MLWL 4P2OB 5FOJA 2R2EB 3PIQB 2E7CA 3BGFC 4GS7C 4IRJC 5IMLA 4XBEL 3AREC 4LDOB 4X6DA 3VA2C 5MP6L 1AXSA 2AAVA 4P5TC 4AH2B 2R2HB 5HJ3B 5F88A 4XVSL 5KS9F 5JW5B 4LQ1A 4I0PC 1R3KB 5SWZE 1GC1L 3QBTB 5D6CA 3QQ3B 3PL6A 1AGBA 4KK8C 5C3TA 3RJQB 4M5ZL 4PJEE 3L3HB 1A1NA 3SGKC 5DR5H 1SM3L 2P43B 2VSCA 3C08L 2BRQA 4LVNC 1RZ7H 1OAKH 2EE3A 3RDTD 3CDYA 1MEXL 2Z31A 4YC2B 1WQVT 3TA3B 1BFOA 1Z5LB 5E8PA 4LHUA 3S3PA 2ZUYA 3DURB 1GJIA 3HPLA 4LCYA 1KYOJ 5FHAL 5C0AD 4ORGB 4JGUA 4JN1H 3BAEH 4PJHA 3VW3L 1XGUB 4KK9D 2G5RA 3SOBH 5C1MB 5CJOL 1NFIB 1NDMB 2Y36H 3RX5A 1J10A 4EZMA 3G6JB 5DRNB 3UTSB 4Z78A 5C0DB 1AQKH 5DRZB 2DQUL 2XTLA 3ULUC 3QWOB 5FYJU 1RFDL 3VWKC 4N0CC 5I0DA 4X4ME 1J8HA 1AH1A 1NLBH 5D9SB 1TZIB 2Z91B 4M6NL 4PJAF 3W5NA 4IRJD 2IBZY 4PYGA 4F7TA 3DVIA 1VFAB 4E5XA 2VZ3A 3MA9H 3IS0X 5SWSE 3MOBL 1U3HA 3HTLX 3LHPL 3H0TA 4LVOC 1T66D 4P5TD 5EIIB 3HG1B 1K6QL 4P9ML 1HKLH 2HN7B 4I0PD 3LMJH 2C7UB 3RA7L 1NC4A 5DJ8B 3HMXH 3PGFL 1S3KH 4ZXBA 2OZ4L 4P3CL 5IK3A 1K3IA 3MMEB 4CVXB 3EO1A 4F58L 5DD0H 3D25B 1K5NA 5F6HI 4QNPE 3I85A 3QHZH 3QNYA 1FORH 4LKCB 3O9WC 4YGAB 3UPRB 5I16A 3FZUC 4DW2H 3MRDA 4TQEH 3VGAC 1LO3H 2Z8RA 4ELMB 4YWGH 1CGSL 1U8PB 3HE7B 4P2OC 3MV01 5CIPH 4DFIA 4MAYD 1IGCL 5SX5H 4JM4H 1YPZE 3L5WB 4XB8A 3C87A 3GJFB 2XQBL 4QRSB 4F7PA 3VWKD 4N0CD 3QNZA 4NNYA 1FC2D 4NO0D 3BIKA 3G6AA 4WV1C 5BV7L 1ZMYA 3QUMA 4R96B 3JV6A 1BLNB 3JTSA 1CF8L 3SE4C 1MHHA 3KYKL 4U1MB 3F7YB 1C16A 4U1HA 3VFGL 1J5OH 2IANE 4HWBL 4U1KA 4YDJA 5CUSH 2VXUL 3LKRA 4KHXL 3RPIB 3CDGA 4U4BA 4G43B 3TA3C 1U2CA 3BZFA 3TBYB 2QR0A 3FO2A 3G9VA 1N2RB 5GSVA 4G9FD 4LSSH 3MPCA 3M17A 3QEGH 1Q9LB 3QJFA 3VWJB 4X6FB 3VG9B 5HY9B 4KTDL 4X6CA 3C6SA 1MH5B 1OW0A 3OHXA 5DHVB 5ISZE 4NRZA 3O9WD 3QIWA 4XBGB 1VFBB 1ZA3B 3ZYIA 1WC7A 1MIMH 4P2OD 2EDJA 1M4KA 2C4XA 4QXGH 4F80A 1FZMA 1A6PA 1LEIB 1MQ8A 1QSFA 4UIKL 1HCVA 3D9AH 4NO5B 3I6GB 4CVZA 1MFDL 4KUZH 2MSPA 3CU7A 3OWEA 4UILH 5GRJL 1S7RB 3L1OH 3VD3A 1N0XL 5HHQB 4LMQI 5FYJD 4DFHA 5HYSA 3O3AA 4GRMB 3CIQA 3NIDE 3QEQD 3OB0K 2B5IB 4WTXA 3IGAB 1LK2A 4TVPE 1AI1L 3WIHL 3WV0A 1A6TA 2Q3AA 1KPRA 3DXAE 1IJ9A 1TVHB 3LN5B 1MAML 3IAQA 1QYGH 1UJ3C 4ELMF 1X5GA 4ETQB 1IMHC 4FXKB 5EFIB 4MB3A 3HE6B 4UV7H 2NXZB 5D7LE 2Z4QA 1PW3A 3ESVF 5JHDB 4WO4B 2O5XL 3KJ6L 4NFDA 1CFQB 2LV4A 1JK8B 1S7SB 2YBRB 5KSUA 4ODVH 4QOKA 3QDJE 4MB5A 2CUHA 4HG4J 3CMOL 4XVTH 2XY1A 4LSRH 4OQTH 5SV3A 3C5JB 5CSGA 4JN2A 3RWHA 4LCCA 4EVNB 5GRWA 5EU3A 5GQBA 1U8LB 4TUKL 2DI8A 2EDLA 1KEGH 1B4JH 3ZZ1A 2ICWB 1UGNA 3L3DB 3ROLA 1C5DA 3IDNA 4Q6YA 3VXNB 4JJHA 5HXMA 5HGDB 1A14L 4MNQE 2CLRB 3ARBB 2VDQH 3T3PE 4FFYL 4M48L 1EXUB 1VADB 2GSIB 1YEFH 1GOGA 1U6AL 5F96H 4MDIA 2IADB 2A74B 4Y0GA 3F12B 5FV1L 5GGRY 3V6OA 5CJQL 1KJMA 4UNTA 2HVKA 2ZOKB 4PRNB 4XXDA 1ZT1B 4DVBA 3RWFA 3MGTA 3RWJB 1ZT4A 3QB7C 3VG9C 2JF1A 1JF5A 2X9YA 2BHYA 1FFOA 5IW6A 3OAUL 1DEEB 4NP4L 1J1OH 3SQOL 3EYSH 4Y4HC 4NGHL 4L5FL 5ITFA 5HYJD 3MBXH 2NY7L 5B21A 4L4VA 3MV8A 2P47B 5GGSA 1TTUA 3VXRE 3MROA 5I0ZA 1LEGA 4EUPG 2EECA 1CLCA 4JFFD 1T89A 3Q6FA 4K7PL 2GT9A 3I2CH 1X4XA 4PPTA 1JPSL 1D5BA 4XWGH 4FQIL 1PG7W 4FP8H 2YD2A 2BNQE 5K9JH 1PEWA 1OPGH 4ONHB 4XNUL 1R3IL 3PGCA 4LP4A 5AUMB 5DJ6A 4LNVA 1ONQA 3T1WA 1A7PL 3PNWA 5E2WL 4G6KH 5MEOB 2VL5A 3HE6C 4F2MB 4DZBA 2QEJA 5CEXA 3KPMB 5I1EH 2OJZL 3CC5B 3RUGE 2HT2C 3SKOB 4XGZB 3DV4B 5EZLA 5BRZA 1BQHA 3U9PH 1HKFA 2RAMA 1NAMA 1QFWL 5SWQA 4Q6IA 4I77L 3CSPA 4C54A 1QKZL 4CW1B 4JPKL 2FBJH 3FTGB 5DVLA 4YXLL 4Y4HD 5CHNA 4KRPB 3QCUH 1U2HA 1KTLB 3PG2A 4H8WC 1HK6A 4KY1H 1X5XA 4X5WA 3HAEA 3GHBL 3ARGA 3B3IB 4OLVH 3ARBC 4X7EC 1L7TH 5IVOA 3LEYL 2JIXA 1JZ5A 4J7RA 3HS0B 4U3CA 2E9BA 4CRPA 3EYFA 1GGIL 3PXHA 4UUJB 3VXUA 4JY4A 3RZCA 2WWKO 3G5YB 3NACH 2D7QA 4RBPK 4F7EA 1F42A 4ODXA 2ICEA 1EGJH 4I3SH 1A64A 3OG4B 4PJ5B 5ICXB 5BW7A 1T5XB 1I1FA 2SEBB 3BHBB 2BSSB 1QR1A 2D31B 3S97C 5EO0A 3HE6D 4OCYH 5IMOB 3D0LA 2QQKH 5CJXA 1N5AA 1OT2A 4UT6H 2B1AL 3P9MB 3JWOL 5CZKA 4CDHA 4DOHB 4I18A 4O5LH 3GSUA 3WUWA 2ADGB 3LPGA 4K23L 1P7QB 1SY6A 5H35A 1A4KA 1HIML 1B0RB 1S9VB 1F6AB 2DWEA 2OP4L 1NJ9B 4JRYA 4YXKH 3Q0HA 4KU1A 5C0JA 2AEIT 3TVMB 3WN5B 4G6JH 1OF2B 2F54A 4ONOA 4OIBA 2X10A 4DQOH 2AJUH 2FX8H 3ZT6A 2BSED 4NRXB 4XNYH 4YBQD 3IDXL 3WHXA 1YMMA 1JTTA 4OSUL 4PJ7F 1LP9B 5BJTA 4Y16C 4POUB 1JNLH 2R1XB 3KHQA 4LRIA 3D1MC 3ARBD 5CJBA 5TE7H 3Q48A 3NPSB 2GJZA 3EYOB 5TFSL 5C8JA 1JHTA 3N85L 3EUUA 2X7LB 2NMSA 3S4SG 1ZHBB 4XPAH 3VFNA 4BKLB 5KVDH 1EA9C 3GSQB 1SEQH 1T20B 1C7TA 3CK0L 1WBXA 3K2UH 1G9EA 3HNVH 5J6HB 5H37H 3T1FA 1NMAH 1U8OA 4NN6B 2KZ1B 2G2RB 2WBJC 4JZOA 2VE6A 5JOPE 3T0WA 5C0RH 4KRPC 3BP6B 4OUOA 2VN4A 4ZO8A 1DQMH 3SDDC 2W9LA 4M6AA 5EBLA 4XAKD 4ZFOB 4OLUL 4P99A 1CFTB 4UIMB 4U6TA 5DR5L 2ZUTA 4QYOA 4KMTL 5GGTA 1JN6B 1MCPH 2APBA 4N1EA 2OL3B 1IL1B 1RZ7L 4ZS7H 1OAKL 2Y7QB 1Q72L 3QFDB 4Q7DA 5E00A 1QEWA 5FO8B 2NCMA 4FQ1H 4APQB 1E4WL 2WINB 2HG5B 3OV6A 1YMHB 3KPLA 4JKLA 4O51A 5J56B 4NM4H 2B0SH 4JDZB 4M6ML 3I6KB 3BAEL 2NW3A 5HYEA 4FTVA 3SOBL 1WLHA 5HHOB 3MRJA 1UKTA 4Y16D 4FFVC 2Y36L 2EC9U 5IMMA 3HFMH 4MZ3A 3QIBA 2VKXA 1AQKL 2EIBA 3MLXH 2DJSA 4U49A 2FX7L 3CFKB 1A7OH 2VITA 1R3JB 1RI8A 3O3EA 2EICA 4WJ5A 2BSTA 1Q0XH 3FB6A 3MNWB 4WTZG 5EOQH 4EBQH 1DN0A 1S7WB 4HIHB 5D7IA 3MCKB 1KULA 5EBMB 5C0BE 1FE8H 4NC0B 2WBJD 4HKXB 1UB6B 3E1F1 1HKLL 3ARTA 5BZDA 4O00A 4XP4L 5CAYB 3H3PH 3HMXL 3EJYC 4WUUD 2YD3A 5DJ0B 5TE6H 3WDJA 5JXEA 2GK0A 3CZJA 3SDDD 4FXGA 5ACLA 2X4RB 3UROR 1ERNA 1D5IH 5C6WH 2H26A 3QIUC 1MELA 2W1NA 2MQCA 3QHZL 1YEGH 1MWAB 4JPVL 4XVUC 5HHNB 4DW2L 5B39A 2OJEB 4Z7NF 3FQNA 3TNNB 1LO3L 3BQUA 4QXUL 4K7FA 2NY1C 4LU5H 1EUUA 3LS4H 4KQ3H 3SGJC 4KVCH 4F7CA 1S78C 3G5ZA 5IIEA 2I07A 3C09B 4FFVD 4HWUA 5ELIA 2R0LH 1KCVH 5BS0B 4HAGA 3NTCH 3EDFA 4HJJH 5DJZB 3F5WB 3QQ9C 1MVUB 2VDKH 3T2QA 1MCEA 1A2YB 1BZ7B 3UDWC 2G60L 3BDYL 3IFOB 1JFQH 1PGRB 4PJBF 5KSVB 1NBZB 4OLZL 3PV6A 1P7QD 4K2UH 1CFNB 5DQDL 1J5OL 1KN2L 1ORSB 5EU5A 5GGVH 5SWZA 1PYWB 3BIAX 5CUSL 3V6BR 1DLHA 1HHIA 3DUSB 4APQC 5I2IB 4PJEA 1IM3B 3EJYD 3T0VA 1J7VR 1LE5A 1FGVH 4WW2B 4QRPB 3CZFA 3W9DB 4XPBL 3CFJA 5HI3D 4L4TE 3A6BL 4LSSL 1L9MA 3UPAA 3QEGL 2VTFA 1B6DA 3QIUD 5AZ2H 4U1LB 1GGYA 2BFVH 1G7PA 3BKJH 5DRWB 4X7FC 2ICWJ 5F89A 3LQMA 4XVUD 2EDTA 3MFFB 3ZSTA 5A16B 5I8OH 4NQCB 4X9BA 3V7MA 1QBBA 5ILTH 4OZHB 2NY1D 1MIML 2ZPKH 4OCXH 1YJDC 4GBXB 4MDJB 4L9LB 3P30L 1G0XA 1S78D 5IM7A 2MTPA 2EDWA 3MRBB 5D72H 5D7JC 3IFPA 1NCBL 2EYTB 4V1DD 1M7IA 2MCPH 4XNMB 2H3NB 3B8SA 3ZKXC 4LP5A 4X4MA 4MJ6A 4XNXL 4UILL 1YECH 2XQYK 2NPLX 3L1OL 3M1BA 3QQ9D 5EWIL 2F74A 4XVJH 2QSCL 2J8HA 3OMZA 3AXLB 1F58H 1FHGA 5SWSA 2M2DA 1H3UA 4TTGA 2OZ4A 1U8HB 5GJTH 1BBDH 4FZ8H 5J11B 2UWEE 4MJ5B 1A4JA 5EDXA 1KGCD 1FV1B 5GS2H 2E5EA 1PQZB 3O81A 1BZ9B 4JE4B 1AD9A 3H9HB 4MD0B 4GW5A 5C0IA 3KLHC 4EOWL 4FQHA 4UV7L 1R5VA 5IGXH 1JGLL 1V7NH 1YYLH 1Z9SA 4X9IA 4ZYKA 4U1IB 4E41D 3GK8H 1MIEL 4D8PA 2BNRE 4YGVB 4C55A 2AK1H 1ES0B 4LSRL 1WWWX 4OQTL 1RZFH 3KNBB 1ZHLB 1J0KA 4ERSL 1KEGL 5C0CD 1YPZA 1A7QH 1B4JL 4I48B 1H5BA 5CSZA 1NCWH 3K7UA 3OL2A 4H26B 1OP5K 4MYWB 2VLJD 4AEIL 4Y2DC 5D7JD 4HS8H 5JIPA 3DJ9A 4HUXA 3GIZL 3SCMB 2A6KA 1ZOXA 4J3SA 3NCJL 2VDQL 4NT6B 3ARDD 3FN3A 1YEDA 4F37F 5D70H 4MMXC 3CLFH 3WFEH 5BVJA 4LGRB 1YEFL 5F96L 4UNVA 4QWWC 3FT2B 1C12A 5E6IB 2IANA 4S1QH 5HYQA 2IGFH 3IF1A 3ULUH 3GUTB 1I7TA 1ZTXL 3O6KH 2AJVH 3CVHH 2KPNA 3CDCA 1ZSDA 2AJXH 2AQ1A 4LASH 4ZUUB 4OLXH 4OZHF 4HS6A 5I1GH 2BDNH 1X5HA 3KLHD 2OR9H 5DURB 4NKDB 2Q6WB 1HHJB 2A6IA 2JLLA 4ZPTA 1XH3A 1QP1A 3QUZB 3SDXE 3QXDB 2X44D 3DVFA 1W72B 1LE9B 5ISZA 2X1OA 2QTEA 4TULH 5L9DH 5LAXB 3T2NH 1I1AA 2FZ3A 3LKOB 1NKOA 3OR7A 3LD8C 1IGTA 4JFQA 1A22B 3FMGH 4FQPA 3KPSB 1U93B 4AZ8A 1I3GH 4Z7WB 4XWGL 4JPIA 3S5LA 3O6MH 3EO9L 5LBSH 4ELKB 3HZVA 4MJID 5K9JL 1OPGL 1T80A 5D2LE 1LEKA 1FL5B 4Y2DD 5HHME 1PBYA 4GKNB 4JO4H 1YDPA 4UZGA 4LNRA 2D7NA 3I75B 4HFWA 3LV3A 3O2VL 3WIHA 4PGBB 1AXIB 2XTJC 3T04D 1G7QB 5DDHB 4Y4KB 4QWWD 4N5EC 3TC9A 1ED3B 3UTZB 3DXAA 4JO2H 5AAMA 4LSUH 5JOFB 5CKAA 2ITCB 2F53D 4PJDB 4H20L 1FDLH 2DI7A 3U9PL 4OV5A 3REVA 4J3XA 2QJDA 1JJUA 4FQXA 3OKOB 1KPUA 5D7LA 4OFKA 5I9QC 3EGSB 4OGAC 3KAAA 3T0DA 4LCWD 3QCUL 5FHBL 4YR6A 1ZHKB 2VWEC 4XCNB 4PY7A 1F4YH 3QDJA 2NNAA 2C3HA 4I9WD 4WI5A 4Y5YB 1MCHA 2BHZA 5MHSD 3P4LA 4NQXB 3MRMA 1AGCB 3FFCD 4I3RH 4WIQA 4AEHH 4LLMB 2NY0B 3SCMC 5C0NC 1E4KA 5JPNA 3WNOA 4OLVL 2X41A 1LDSA 5CGYC 1L7TL 3C5SB 1FP5A 2A77H 1YNLH 2CMRL 4LLUA 4N9GA 1IAIL 4HIEB 2BNUA 4G8GE 1MFCL 1P7KB 1Q8MA 5IF0B 1FYTD 1IEBA 5E6IC 4N8CL 3D39B 4MNQA 5F9WB 3GBMH 3NACL 3QG6A 4QHUB 4NO2B 4IRSA 1A9EA 1C5BL 4O4YH 1D5XB 4NCC1 1TFHA 4XMLL 4ACPA 2Y4SA 1ODAA 2XTJD 4Y5VB 5D6DA 4GAGL 4IOSD 1HH9A 3MLVH 4N5ED 3PUCA 5JPMA 1TQBC 2FGWH 3FOLB 2JJUA 3HI6H 4QRQA 4JFEE 4PRID 4HX1A 3BFOA 5EOCH 4YXKL 1DN2A 4PRHB 1Q9OB 4CU7A 5I1AA 1NANI 4P5MB 2FL5A 3TBSB 4FQLH 2UY7A 3DVNB 4HQQH 1CGYA 5IVXF 4GKSB 5KG9B 4ZG1A 2AJUL 1PEZA 2FX8L 3VXRA 1A6WH 1KJ2B 2LFGA 4X7SH 3MOAH 4AT6B 4ZUSA 5HHPB 5EPMB 3MO1A 3UTTE 1JNLL 3OGCB 3O11B 3MLRH 2FECL 5TE7L 4MCZA 5CGYD 3UAJC 4FZEH 3PDOA 2BNQA 5SX5K 4TPRH 5K59F 4E0RA 3CVIH 4Y4KC 1EAPA 3FB7A 3MX0A 5E5MA 3L5JA 1KIQB 3T09A 5KVDL 5F1IA 3AGVA 2PXYC 1CDUA 4EDXB 3K2UL 3HNVL 3TYGH 2DL2A 3PWUA 1YUHA 2KH2B 3RUGA 1WFNA 3OGOE 1D5ZA 2F5AH 5ESQB 5IQ9A 3CXDL 1ETZB 2AXGA 4BSJA 5GIRB 1R0AH 3VXQA 5JW4M 1VGKB 2APVA 5CEYA 3FCTA 2WWKT 3A67H 1P2CB 2J88H 2NY0C 2E7HA 1MCPL 3P3YA 4ZS7L 3QXWA 4AIZA 1L6XA 1KT2A 4GG8B 1BOGB 1UQSA 5ANMB 4FQ1L 4OZGF 5IHUH 3IJSA 5CBEA 1V7MH 2XZCL 1RZKC 1ULVA 5BQ7B 2YUZA 5AG9A 3W39B 4NM4L 1Q9KB 5DHVH 2B0SL 1KLUB 3EYUH 1FLTX 1T1ZB 4MX7B 4YXHH 3HFML 1KLGA 5A2IH 1G7JA 3UAJD 5I75B 4MXVE 1Y0LB 5EUOB 5F7DA 4LMQE 4X5XB 1A7OL 4Y5VC 5EC2A 1FLRH 3TBTB 1DLFL 2G75B 3P0VL 5A1AA 4LDEB 4CNIB 3DYPA 4J6RL 1Q0XL 5EOQL 2XWBA 1J1XH 1QNZH 2P5EB 5D8JH 2PXYD 4EBQL 5GGUB 1JGUH 5B3JE 4O2FA 2ZCHH 4P46B 1GPOH 3F65A 4POZC 4YDVA 4ZFFA 3O6FA 3H3PL 3MRHA 2ATPA 5TE6L 5DQJA 2MHAA 3GKWL 4KZEL 3RTQD 3JSSA 3ABZA 5IFJA 4A2MA 4PLKC 2HLAA 2NY0D 4K3JH 2WM0A 5I1CL 5EBWA 3BPCB 5FECA 3QPXH 2UV3A 3D5OF 3S34H 1BIIA 5FEBA 3VMOA 4LU5L 4OZFA 1SJHA 2ADIB 4KQ3L 3OKKA 4KVCL 2W60B 4XZUB 2Y07H 4G3YH 3NCYS 1GGTA 2R0LL 1A0QL 2NY2C 3DYMA 3VG0L 1KCVL 3MFGB 5DC0A 2DL9A 4QY8B 3NTCL 1K4CA 3IJHA 4HJJL 4C58B 3D85B 5KW9H 2VDKL 2E3VA 1DL7L 2A6DB 2X1PA 2Z8WC 2Q87A 1ZLVH 2VYRE 4UB0L 1MHCB 4GG6E 4KI5E 2XFXB 2V2WB 5I8EB 3DBXB 2FHCA 4K2UL 2DQGH 4LOUC 2HJKB 5SV4A 5DD6B 1XZ0B 2ZCLH 4HPOL 5EZIH 4POZD 4R2GB 4GKZA 1QZ1A 3JV4B 4PRPE 1FGVL 5L8JB 2V5MA 2XN9B 3OG6B 3S96A 5FB8B 1QA9A 3WLBA 4OB5H 2NW2B 4KKBC 3GJEA 1KCKA 3IU4H 4PLKD 5AZ2L 1H0DB 1U3HC 4FQ2H 5F6HJ 2N1KA 2JJTA 3BKJL 2EDKA 3WL9A 3PWJA 4OD3H 5IOPB 1YY9D 3MRGA 2P8PA 5MENB 3WXWL 2O61A 3PL6D 5ILTL 3DRTB 4RFEA 1BHGA 3B2VH 1BQUA 4NRYA 1NC2B 3DTXB 4AL8H 4W6XB 2FIRT 3QXAA 3LKSB 3DX8B 5D72L 5JW3H 2VL4A 4G8EB 3QDME 2NY2D 3SKNB 1IEAA 2Z92A 1UA6L 4X4YB 1YECL 3RAJL 2HFEB 4P46C 1MI5B 1OAXH 4LHUD 5MEPB 4JPWL 1CXHA 1PLGL 4IOFD 3UTQB 4JKMA 1F58L 2DRUA 1AGEB 3BN9C 3HMXA 5C0BA 3PHOB 1YQ2A 3BD3A 4KKCC 4FZ8L 5KVFH 4PGZA 3T77B 4LOUD 1ZGLM 3QUYA 5HDQH 1KB5B 3P73A 3QEUB 1YN7A 5KSBF 3MRKA 5JIKA 1SJEA 1J8HD 4NHUB 4A6YL 5IGXL 4Z7OF 1K4DA 1N6VA 1HH6B 1YYLL 2NTFA 5DZLA 3IDYC 1MHPH 3UYOD 4HGWB 3QFJE 2W38A 3RWGB 4KKBD 3GM0A 1VKXB 1U3HD 4HC1L 5CIPA 2J2ZA 4YHIB 5T3ZL 3V5DA 4Z95H 1YN6B 3ZDYF 2QQQA 3O2WH 1NC4D 2FWOA 2Y5TB 4ZXBD 3MCG1 2ZNWA 5C08B 2UVEA 1ZVSB 5INCB 1B0GB 5FYKL 1AP2A 4QHNB 1DQLH 4AQOA 3LKQA 5A2KH 2HKFH 4TOYH 1KNOB 3TO2A 2I24N 2V7HB 2YPVH 2J4WH 4R2GC 3CLFL 3ULUE 2CKNA 4LSVH 2IQ9H 3FN0H 4GH7B 5EN2A 1ZS8A 2X4NB 4JR9L 1S9YA 3BN9D 1P1ZB 5HGHB 4S1QL 1BAFL 3U4BH 4KKCD 3IRPX 3ULUL 3MRRA 3EFDH 3PGDB 5IWLA 4NQVB 4HK3N 1EEZA 1CD8A 4LASL 5HGBB 4OLXL 4M1DH 5I1GL 2AERT 4L4TA 3RNKB 5GZOD 3PWLB 3OPZH 4X7TB 3DSNA 1T1XA 4IDJH 1XGRA 4H88H 1T21B 3C5ZB 2BRRH 3DSFH 3TBWB 1UM6H 4TULL 1IGYB 4G9FE 4KMQA 5L9DL 2FEEL 2CDFA 3T2NL 5A2LH 3B43A 1RMFH 2ZG2A 2IMNA 3KXFE 1WT5A 4OZ4B 5FCSH 3FMGL 2YPLB 3JUYA 3D48R 4LVHB 1T1WA 4UQ2A 2BVEA 3O6ML 1E4JA 5LBSL 3O3BB 2WK2A 4PLOB 4G6MH 1XF4A 1PZ5B 4XPHH 5H8DA 2XZZA 1P4IL 5ADPH 1MAKA 4G5ZH 5B38B 4LCCC 4PJCF 4AENB 1ACZA 5E5RB 4NUGH 4R2GD 5FKAB 4ZODA 2DQCL 3LKPB 3STZA 2UWEA 3DUUA 5E8DH 3TCXA 1QSFD 3RGVA 4JO2L 4YK4B 4LSUL 2OTUA 5E1AA 4DTGL 4WWKB 3HPJA 4HUKB 4ZPVA 1FDLL 4Z76B 2MKWA 3VXSB 4M7LH 5ID1B 3IXAB 5LQBH 1UM4H 1A3QA 1OT1A 5GPRA 5TGBA 3MUGA 2D03H 3ILPA 5M95B 4OQTA 1ZWIA 2F58L 3PP4H 1AY1L 4KJQC 5D1ZB 4M7KH 4NQTA 2BNRA 4PRAB 3UEZA 2XT1B 5AEAA 4R26L 1NC2D 2APWA 3DO7B 3MXVH 5AWNH 2V17H 3EO0B 1NUFA 1IZJA 4HEME 2FHBA 3B9KA 2A0LC 5CCKL 4JFPA 5IP4A 3GZKA 1QACA 2HT4C 3QUXC 3BEVA 3G6JE 5FDWA 3UTSE 1IAKA 1NKRA 4J23A 1NCDL 4O02H 3PJSB 4XP9L 5KSAB 3U83A 4QOKD 1X5YA 2FYYB 4X9HA 1BGXH 4AEFA 3O8XA 4JAMA 2W9DL 3UO1H 3RVXC 5F7HA 3NA9L 4IIQB 2HVJB 4KROD 3L5HA 5CEZH 4HDIA 5LWYL 4HKBB 43C9A 3WEXB 3ARFA 3TH3T 1P5VA 2PYED 5C7XL 1GZQA 4YIQA 4MAUH 3ZE0E 4OBSA 5DC4B 2VXVL 1S9XA 1X5ZA 4AM0A 5EOCL 2IPTH 3SDXA 4PP2B 2X05A 3S88L 4FQLL 4HQQL 3U4AA 2BOBA 1WCBB 4YHZH 3KS0J 3O3UN 1SQ2N 1A6WL 4MXWL 2WMPA 1LNUB 1MWAH 4OBRA 3UYRL 3ZKMC 4BH8A 2GJ6D 4P57A 4JHAL 4Q6IC 3BMWA 2XWTB 3LY6A 1V8HA 3MLRL 4MQTB 4JDTL 2Y1VA 3FQUB 5E2JA 1A9BB 2EDDA 3M8OH 1SMOA 2EH8H 3FQTA 3PWVB 4FZEL 2HT4D 3BW9B 3QUXD 1AXTL 2PCPA 5D2LA 4TPRL 4C57C 4NYLB 3VE0A 1CDJA 3CVIL 5JTWA 1XF5B 3ET9F 4L4VD 4JG1H 3MV8D 5E8OB 1UFUA 1IEHA 3MNZA 4RISH 2AEPL 2DN7A 3QG7H 4X4ZA 2X09A 4MHHI 4Y19B 5HI4D 3O4LB 4ZD3H 4N0UB 3HI5H 1R0AL 3U0PA 5D1ZC 4DZ8B 3U7AA 4OZIF 3BH8B 1I8MB 3FHQA 1KTRL 1F5WA 2A83A 2FDBP 3LKNA 3MRLA 3A67L 1XIWA 4UT7H 4D9RE 2YMXH 4RAUB 4GAFB 1QVOB 4BYHA 2ED8A 3HZYA 5ETUB 5IHUL 4OFYD 1G6RB 3IFLH 1V7ML 4N0FA 3O41B 1S9WB 4QGTA 3WNMA 2HJFB 3P40A 1CTNA 3VMNA 5L88H 1O0VA 3P4OA 5BRZD 1QFUH 2XPGA 3BH9B 4UDTB 3EYUL 3EOTH 4NO3B 3RY6A 3ZE1F 1JZ3A 1U42A 4LCIL 1JWMA 4RGNC 1BBJA 4MB4A 2NY6B 3NCBB 4G8GA 1EGJA 4GAYA 3UJIL 4NBZB 4DGIH 2X4UA 4K07A 3BJLA 4IIQC 4LQFL 1WBYB 2EXYC 5DVNA 1T04B 4R6UA 1CFVH 4P23C 4PRBB 2H2PD 1T0MB 2D0FA 2ZJSL 4NZRL 3A6OA 1J1XL 3NFPB 5K9OA 2DTSA 4MSWA 1L4IA 3WS3A 3ARGD 2NLJB 3K2MC 3VDAA 1FPTL 2YD7A 3MRQA 2ATKA 1GPOL 1FH5H 2ZSWA 2LQRA 1A6ZB 1ZAGA 3VXUD 2K7QA 3C60B 4JFEA 3RZCD 4XC3L 2YSSA 5E8NB 1RUAH 2I9TA 3BP5A 2NYYC 4K3JL 3FO1B 1S7QB 1IILE 1NDGB 3I9GL 3PHQA 3QPXL 5I8KH 1CDIA 1DUZB 3WE6B 1T7WA 3S34L 3T0EC 3CFEA 4MVBC 1NFKA 4Q97A 3S37H 1JL8A 3UTTA 2WP3O 1MJ7H 5K9KB 2Y07L 2UYLA 4G3YL 43CAA 1T03L 5EB9A 2VLKB 2CO7B 2IAMB 2Y25A 1BVLB 4JRYD 4NPYA 2ENSA 1A6AA 4RGND 4E42A 1KACB 5ESVA 5I6XC 3VFUB 2ZUUA 5DD5L 2F54D 1IM9A 2CJUH 3RVUC 3BO8B 5DGRA 2EXYD 2XWJB 3WJLA 2DM2A 4P23D 4XP5H 1NLDL 4ZOEA 1VFOA 2VDNH 1WBZA 3A6CH 5DJAB 5T33H 1IARB 4JHZA 3QULB 2DQGL 1VGEL 3QIBC 3GBNH 1N6QL 1F4WH 5JUEH 1HDMB 4HBQA 5D1QA 2I5YH 4R4BA 1W0VB 5JNYB 2LU7A 1J05A 1F3JB 5KAQG 1T83C 4KGLA 5E4IA 3J7HA 3V7AG 4RFNB 2NYYD 2FJHB 1FVDA 4GMTH 2R4RL 3FHAA 4FQ2L 3IDUA 4XAKE 3DOSA 5D2NB 5IW1A 3KYMB 3BKMH 3SO3C 1W72H 4HZLB 3T0ED 6FABL 4OCNC 3TZVA 1LO5B 1NMCC 2XKNA 4KRLB 5KJRH 1AHWB 4L8BB 2J6EH 1CVSC 2VXQH 1RUPH 3OJDB 5FM4A 1U8MA 5JW3L 5DC9B 3L7EA 1HXYB 3LQAH 4FMKA 4X6EA 1INEH 2DMCA 4ZDHA 5TH2A 3FONB 3P4NB 3PQYB 2CLZB 2E27H 4PRDA 5K9QI 5AZEH 4N8VA 4CL7A 5HD8C 1QG3A 1HHKA 2VERN 5D93B 5ICZA 2FO4A 1EHNA 4Y1AB 3QIBD 1JWSB 4WRLA 4ZFGH 1DQDL 2FATH 1BFVH 2OR7A 2EIZB 3FQXB 2V2XB 4CADB 5FGCB 1ZANH 4DKDC 5CBAB 3LQZB 4U6YA 3LRSB 2B2XL 1SEBA 3MV9B 4PJIB 1MHPL 4WUUE 4YE4L 1TNMA 1YZZA 5FM8A 1XGPB 4LGPB 1A3RL 3U2SA 1MREH 4OKVA 4P4RB 2DQDH 3W2DL 4XNZB 3VJ6A 4BFEA 1U8KA 1I1CA 2I9LB 1CGXA 2A9ML 2XZQH 3VH8B 3L3OB 4XBPA 2DICA 4KGJA 1EEYA 1MQKH 3LPWA 4UBDD 2EYSA 5CP7A 3PABA 2VOTA 1DQLL 3E3QC 3F7RA 5JQ6H 4X98A 1RZKH 5M7QA 4TYUA 1U58A 5A2JH 2HKFL 4TOYL 4PJ5E 3H8NA 4X0KB 4PGEB 1WUNT 4GG6A 3P9WB 3KPQB 5DJCB 3BQUD 3I84A 4RA3A 2E7LC 1LO4H 2IQ9L 1G7MB 4KJWD 3O6LL 2IWGA 3NIGF 4MNHA 3ARUA 3EFDL 4C83B 1RIUL 4P2YA 2E9JA 4OUUA 1JWUA 4DGYH 1SYSA 2P7TA 4PRPA 2QQNH 1WEJL 3MJ6A 2QKIB 4M1DL 4RRPG 3GGWA 3R4DA 4UOW1 1OB1B 3RI5K 4NQEB 3SGEI 1L7IL 2EKSB 4U31A 3C8KB 4H88L 5E7BA 5FA3A 2BRRL 3DSFL 1RIHH 2VLKD 1IAOA 4PBVC 4N1CA 3RY4A 1DDHB 1RMFL 1LP9E 2HRPL 4YHML 3TM6A 1KJ2H 1QQDB 4MA1C 3D3VB 4Z7UF 4ODWB 5F1NA 1MCBA 2AJZB 3OBAA 4M7LT 3QDMA 3SDCB 4F9PA 1EO7A 4G6ML 3N0PB 1K9TA 5D93C 3O4OB 3T0AA 1S5HA 4UAOB 1REIA 4N0YH 4Q74A 1GGCH 4X99A 4KZDH 5ADPL 1R5WA 3Q3GA 4G5ZL 4JFYB 2PW2A 4V1DE 1UYWH 2EZ0C 3GJFK 2VXTH 4NZTL 4PJIF 4XCYB 4NUGL 4MD5B 5I71B 1QLFA 1SBBA 5E8DL 5B22A 1N8ZA 1I7ZB 1ROWA 2X4OB 1VACA 1VHPA 3AREA 1Q9WA 1VEPA 2EE6A 3U1SH 2CKBB 2IH1A 1UH2A 4WTWA 4DGVH 1OGAD 5BV7C 5JIHA 1R3LB 2ICES 2VXSH 4P5TA 4XNZC 3ARQA 5LVEA 3MUHL 5DD3L 3IDGA 5DQ9A 1KGCE 4HC1A 3DRQB 4MLSA 2EIDA 5IVZB 1BD2B 4ZFOL 3D18B 2BP3A 3B6SB 3QFJA 3KYOB 3P77A 2D03L 5BOZG 4H0GA 4NDMB 2E9WA 3PP4L 3VMPA 1B9ZA 1DQQB 2OL3L 3BP7B 4TNWF 1EMTL 4Y4FB 3MXVL 3SGKA 5KVMC 5AWNL 2OTPA 4PG9B 1JZ6A 5IESH 5E7FA 4BM7A 3O2DL 5L6YH 4OGXH 2WQRA 1QO3B 3OKEB 4E41E 3LAFA 2ZG1A 4YEFA 4RMTA 5INDA 2Y9RT 3H3BC 3GSNH 3RWCB 2AJ3B 3HRPA 2RCSL 4WU7A 4NHCH 4XCFL 3QR2A 5E94B 1RSFA 2NQCA 2J8UF 4DVRH 3MUZ1 4LKXA 3HI1A 3UTPD 5J3HC 2VLJE 3G04A 1BGXL 1RK1B 2DQIH 5CEZE 1JGDA 1RQ5A 3CVHA 4OF7A 2EZ0D 3UO1L 4ZUWB 1JNNH 1P9MC 1CG9A 2GQHA 4MS8C 4UTAH 3ZTJG 3QH3B 4FFWC 2HWZL 3BDXA 3BE1H 3UMTA 4NO0A 5CEZL 1HILB 2WUBL 1M7DB 5I18L 4YHKH 2FNBA 2NY3C 2CDEA 1YNKL 4I1NB 3SKUD 2DM3A 4JY6A 4MA8H 1K8DB 1ND0B 2AKRB 2LVEA 2WLZA 4LLVB 4F8TA 2CGRH 3OF6A 3W82A 3TJHC 1AO7D 3IKCB 4S10A 3DLQR 4WW1A 4XP1H 4G9FA 2IAND 3QPQC 1XCTA 1Z9MA 4OM0H 1UXSB 3SDCC 2XNAA 4XCCL 3SE9H 3V6FB 1MWAL 3O4OC 4NC1E 3KXFA 3KGRA 4HWEL 3U0TB 1CD1A 2DQEH 5A2FA 1OAUH 1DQTA 3ETBF 4OIIL 3T8XB 5DEFA 2VZSA 4WVRA 5BXFA 2BVYA 2WUCH 4IEFB 3AU1B 2EH8L 2VIRB 1CXLA 3MJ7B 4KKNA 3V0WL 15C8H 4P2OA 1QBMH 2R2EA 2FIKB 3PIQA 4D9LH 8FABB 4JM2B 1YEIL 2IF7A 5ISZD 3ZDXF 1NGQL 3FRPA 1YYML 4JQIL 3GRWL 4LSQL 12E8L 3QG7L 2R2HA 5J3HD 3E6FB 4WUKH 1MLBB 4LPTA 4M93B 3OKNA 5JW5A 1UCBH 4LIQH 4R0LB 1ZLVK 1MCNA 3S3SA 1LILA 3CFDB 4ZD3L 1MCLA 5DRXB 4WV1A 2VO5A 2XIDA 3MJ8B 3L3HA 4Y4FC 5HVFB 3SE4A 3B5TA 2NY3D 1FVEB 4QKXB 4QRPE 3OZ9H 2H2SD 3UBXI 2P5WD 2Q7YB 1LHZA 2PN5A 1MLCB 3TA3A 1CWVA 2DYPD 3IFLL 1JI2A 4P0DA 3TN0C 5FGRA 3DXAD 3QPQD 3HC3L 1P84J 4NQCE 4ORGA 5L88L 1XGUA 3WLWC 2X9XA 4OZHE 3P11L 2FLRT 1FQ9C 4FG6C 1NFIA 1NDMA 5IR1B 4FQXD 5D7LD 5DSCB 3G6JA 5DRNA 4ZS6C 3UTSA 5C0DA 5T1KD 5DRZA 1S7XB 2MKLC 4M3JA 1GAFH 3V52H 5D96B 3GEWB 5D9SA 3PWPD 1TZIA 2Z91A 1ZHNB 4HFUH 3QDJD 1JYXA 1C1EL 3IFNL 3VFSB 4CVWA 1ZGLA 1VFAA 3QZWG 4YFDB 3KJ4B 1FJ1B 5DFTA 4N8PA 1Q1JH 1FYTE 4LSTH 3TBVB 3HKFA 3V79C 2GITB 5EIIA 1QLRB 5JO5A 4DUXA 1G1YA 1KIPB 4U1SB 5DJ8A 1JF1B 5E9DB 3DIFA 1IKNA 5EZJA 1FH5L 2GUOB 4EN3C 1BREA 5EZOL 3MMEA 4CVXA 1WZLA 3KWWB 2P44B 5T1LB 3DO3A 5C6PB 3ROOA 3D25A 4OCMC 3PDDA 1RUAL 2CXGA 4CU8A 4NNXA 4JZJB 4BSVA 3RJDA 2DWDB 4YDIL 1RHHB 4L1DA 2VLRB 2VISB 2OLDA 4PJ9B 2KQNA 4JM2F 5HTSA 4JO3H 4PY8J 1U8PA 3DHJA 3TN0D 4JB9H 1J0ZA 3TF7C 2Y6SC 3WLWD 2CK0L 5T1DH 4OLEA 5L2KB 5EOTA 4EUPB 2VWEE 4FG6D 1MJ7L 2VN7A 3L5WA 1J88A 1BJ1H 2AEWA 3TT3L 3VFMB 3GJFA 4ZS6D 5IB1B 4QRSA 1FO0B 1V3LA 4R0LC 4L8CB 3N1QC 3VGBA 5IBTH 2Q8AH 5F9DC 4S1RH 4XP5L 3CFCL 4D0CA 1AXSB 1BLNA 5KN5B 4CGTA 5E56A 3F7YA 2VDNL 4BH7A 5KZCD 1JBJA 3F6IA 5C07B 1F4WL 4KWUA 1CBVH 2R2BB 5JUEL 3RPIA 3GO1H 3BSZL 1AGBB 3TBYA 4EN3D 2I5YL 2WANA 1JZ4A 2HTKC 3U0WH 4AJ0A 4NQDB 1Q9LA 3VRIB 3VWJA 4RMSA 5HY9A 1JHKH 2PW1B 2Z31B 1MH5A 5DHVA 1NUDA 5F1KC 4XBGA 1J86A 2IEPA 3B5HA 1VA9A 1VFBA 4Y4HA 5B4MC 1ZA3A 3OR6B 1T7VA 1UWGH 1W8NA 1W72L 3MRPA 4LCYB 4M03A 4PV8B 3QA3B 4LGSB 4GSDH 3KPSE 2Y6SD 2D9CA 4LVEA 1KBGL 5F7KC 1ACYH 3BPLC 4Z7WE 3HB3C 2J6EL 3P2TA 3I6GA 4Z78B 3PWNB 4GLRI 3K0WA 3LQAL 1B0WA 3DMMB 3X12A 3BEWA 5AD0A 5DFWH 5HHQA 3DGCR 3SKJL 4LEXL 4RIRB 3CXHJ 3AM8C 4GRMA 4U1JA 5AZEL 3ZT5A 4HIJA 1TJIH 2E8YA 1GVIA 3K1DA 1FAIH 3IGAA 1OARH 2CH8A 3H0TB 4X80H 1GHFL 1MUJB 3H2WA 2WP3T 1Z2KA 3LN5A 4BJLA 4ETQA 4PJDE 4FXKA 4W6WB 1QOKA 1F2QA 1MFAH 1BVZA 1MRDH 3HE6A 1BFVL 4PJ9C 4IDLA 4XP6H 1ZANL 2CSPA 2BOCB 1NUGA 3F7VB 1IC1A 2EO1A 5KVEL 4WO4A 2HTKD 1K5NB 2V5YA 1KCRL 4V2BA 1OTUC 4GRLB 4OGYH 3EBAA 5TJWK 1JMZA 1CFQA 1NFDB 1JK8A 4ODTL 5GHWH 1ADQL 1MREL 1NSNH 4UMGA 1RJLB 2XRAL 2JB5H 1CGTA 3CUPA 3C5JA 1KPVA 2XZQL 2ZWLT 5B4MD 1KIRB 4EVNA 4X6DF 1U8LA 5J8OA 3KPRB 2VB5A 3FT4B 1VESA 3LZFL 1MQKL 3L3DA 1I1RA 3HB3D 1F6FB 3TO4B 5JXAH 3VGFA 4L3EB 2GTWB 5HGDA 5JQ6L 3VFPB 3RIFF 2CLRA 3QNXB 3ARBA 3QNZB 3H42H 1AE6L 3TFKC 5T1MB 3K74B 1RULL 5E9DD 1VADA 2B7DT 4XC1H 2GSIA 4W4OA 1JHLL 3FOMB 1SY6H 4M1GH 2IADA 2A74A 4NKMB 3F12A 3HNSH 3JV6B 1CD9B 3QCVH 2NY4C 4PRNA 2ZOKA 3BIBX 1ZT1A 2WV3A 3RWJA 1YEJH 2AK4D 4U1KB 4YDJB 5MERB 3MYJB 2X89D 5HDBE 4Z7QE 2AJYH 4NJ9H 4RMUA 4PJHF 5DYOB 2QQNL 3FO2B 1D6VL 2AQ3A 4PRHE 3GFUA 3T08A 2DLIA 1XGQB 2J12B 2ESVB 3QJFB 1YEKH 5EO1A 1OTUD 5GGQL 1IGIH 1NGPL 3UZQA 1T2XA 3WNLA 2R69H 5JOPD 3QIWB 3QXUA 5E95B 1VFMA 2YKLH 1YQVH 3DMMC 4M6OH 1VPOH 2IC2A 2I60L 2A73B 1KJ2L 4Y2OA 3ZKSD 3T3MF 4CVZB 4X8XA 3SDAB 2YD4A 5AUMA 1KSRA 4NOFA 1OWRM 2RJMA 2DKUA 2FRGP 3DARA 3TIEA 4N0YL 5F7YC 1GGCL 5HYSB 4KZDL 5MEOA 4GUPB 2IALA 5DMIL 4JREB 2X4SB 3KPMA 2VXTL 2H41A 4U1GB 2ZUQB 4HHAB 3SKOA 4XGZA 3DV4A 2NY4D 3S9DB 1CDGA 1F3RB 2EDQA 4GRLC 1GZPB 5D5ME 3U1SL 2L7UA 2H9GB 2VXSL 4GFTB 4PJ8B 3RWDB 1UEMA 4CW1A 3FTGA 1SYVA 4N90E 5I17B 1P6FA 4Q9QL 4WUUA 6CGTA 4HLZG 3SDDA 4PIRF 3W0WB 5C0BD 5JR1H 1B4RA 2EYRB 4G7YH 4J8RB 3C6LB 4JY5H 4HF5H 3TO4C 2IJ0C 2PTUA 3ARPA 4DN4L 1G6RH 1UEYA 5IHBA 3RWHB 3I50H 3B3IA 1H8SA 3WKNA 3DMMD 3IB4A 1RIVH 5EORL 3UCRA 4Q0XH 2CLVB 3O3DB 4EDWH 3HS0A 3SGDI 1FIGH 3TT1L 5EUOE 2FGZA 3G5YA 3EFFB 3BRDA 2C4FT 3MUY1 3L3KB 4PJ5A 4F3FA 5JMOC 5ICXA 1T5XA 4NKQB 3BHBA 2BSSA 2P5EE 1HN1A 1WT5C 4IOIB 5IMOA 4MDIB 2DTML 1OAZL 4X6CF 5CILH 1BIHA 4UTAL 3IKKA 1KJMB 4U7MA 1JPFA 5IB2B 3P9MA 5DUPH 4HULB 1FFOB 2ADGA 4YHKL 1P7QA 1AC0A 4ONFL 1B0RA 1CL7L 1F6AA 2A1WL 1NJ9A 2BMKB 2CGRL 3MV7D 4WCYL 3V0VB 4YFLI 1JVKA 1OF2A 3ZHDA 3PP3H 1QPPA 3HC0B 3KPRD 4H1LG 4PLJC 5EO9B 5CZVH 1CU4H 1QRKA 2ARJQ 3SDYH 4NRXA 1T3FA 4OM0L 5GGSB 1RU9L 2H6PA 2XG4A 1LEGB 4NWUH 1LP9A 1D3CA 2DQEL 4WFHE 1OAUL 3RPKA 4OCRH 3Q6FB 2GT9B 3EYOA 5FFLA 2WUCL 5FUZL 4L4TD 1MFBH 3S35L 4JREC 1WF5A 2X7LA 1QFWI 15C8L 2QL1A 1ZHBA 2WBWB 4M5ZH 1QBML 5I76B 4L29A 4BKLA 4YDLB 3EDDA 3GSQA 1T20A 5C9JB 3C08H 4LIQE 3TCLB 4V1DA 3LH2H 4U6XB 1N59B 2CRZA 3MLYH 5J6HA 1ZT7B 2VL5B 4Q2ZB 5DMKB 1R5IB 4PJ8C 2AV7B 5CEXB 4ZUTB 2G2RA 1UCBL 3H9ZA 1AIFB 2GKIA 1LD9B 5C70A 1IBGL 1J18A 4ZFOA 1MHEB 4HH9B 4PJFB 1CFTA 4QF1A 3OZ9L 2XN9E 1JN6A 2ILLA 3G08B 4RBPH 5CHNB 3QFDA 5FO8A 1MPAH 1RFDH 4APQA 1CE6A 2HG5A 4XTRC 4L3CA 3AMKA 3ARFC 5MENE 4JDZA 4Z7VE 3I6KA 2I27N 3Q2CA 4HAFA 4RWYL 4R3SA 4E41A 3HAEB 4BFIB 2QQLL 1K6QH 2JIXB 4MGXA 4YO0A 4CMMB 3LVEA 5I30L 5FOBB 3KPPA 3CFKA 4NKIL 3V52L 4U6VH 1R3JA 1JGVL 4XX1E 2BNRD 4XH2B 4ODXB 1N64H 3MNWA 1MJUH 5DI8A 3L3JB 2VLJA 4NN5C 2J5LB 5D7JA 1S7WA 4F15B 2OXHA 3MV11 4P59L 3MCKA 1QR1B 5EBMA 5EO0B 1X9QA 1ORQA 4NQSA 2X4TB 4HKXA 1UB6A 4J1UA 1EFXB 3CU1A 2F15A 2L0DA 5F6IB 5DJ0A 1IGCH 3D2UD 4CJ1A 4I18B 4LBEB 5DJDB 4Y5XC 1A4KB 5F7FA 1KB5L 5IBLC 1PFCA 1Z6JT 2PYEE 2R0KH 1MWAA 4ONGH 5HHNA 2OJEA 3VA6A 3ULSA 2H1PH 5D7KE 3TV3H 1INQB 3ARFD 3I02B 4JB9L 3WHXB 1YMMB 5ERWB 2ENYA 3HR5B 5C08E 3KYKH 1PX4A 5CS7A 5T1DL 3B9AA 3AC0A 3X13B 4HWBH 4Z8FH 5HGGS 4FHBD 2VXUH 4KHXH 1DBKH 5HVHB 5C8JB 3VI4F 5E08L 4LLYB 5DJZA 2GJ6E 3LOWA 3O45B 1MVUA 3QAZC 2Y23A 4GRWH 1FC1A 3BKCL 1BZ7A 3HZKB 2GSGB 4DK3A 1J0IA 4FQQB 2Q8AL 4N5UA 3G6DL 5KSVA 1WBXB 1NBZA 4KTDH 32C2B 1CFNA 4HK0B 3RY6C 1ORSA 4OD2B 5ESAA 1NGYA 2F9BT 4CJ0A 1CT8B 1I7RB 1CBVL 3DUSA 5I2IA 3GO1L 1NPUA 4KH2A 5HHMD 4WW2A 4QRPA 5F9OH 4UIKH 3U0WL 3VRLE 4DN3L 4TSCH 3GSOB 5IBLD 3WFCH 4U1LA 4DK6A 1MFDH 4BUHA 2NZ9C 5IW3A 1QEWB 5ALCH 2DLTA 4WI3A 4R4NC 3KPLB 4ODHH 2YD9A 4P2QB 5IHLB 3HRZB 5A16A 4JJ5B 3CCHB 4NQCA 1UWEH 4DEPC 2YK1L 4FTVB 1WK0A 4MDJA 2YPLE 1PKOA 1BEYH 1RZGB 1ACYL 2H45A 3TPKA 3MRBA 3DX9B 1MAMH 3MXWL 2K3TA 4XNMA 1XIWD 5DEGA 4CKVX 1EIBA 2HA1A 1AGDB 1T0NA 5GS0L 1BOYA 3O3EB 1FL3A 4WJ5B 3IU3B 5J1AB 5F6IC 5I1IL 1EBPA 2O5XH 4WDIB 2CQVA 3KJ6H 2R1YB 1FYTA 1TJIL 2RHEA 4MJ5A 1Z9LA 4QT5B 1UB5B 1FV1A 5BZDB 3U46B 1ZLUH 4MD0A 3KPOA 2GK0B 3VXSE 4MWFB 4TUKH 4F9LA 4PREB 3OKMB 5J6GB 4UQ3A 4XP6L 2CKBH 2C1PB 5FO9B 1P6AB 4U1IA 1MCOL 5GHWL 2ZSVB 2NZ9D 3ZHLA 1A14H 4YGVA 1NSNL 5EU4B 1ES0A 5LGKA 2JB5L 3ZYJA 4R4ND 2VZTA 2D4DA 5FA4B 4EXPX 3WMSA 1T7ZA 1U6AH 5D1QC 4C56D 3KNBA 1CDYA 2Z93B 1ZHLA 3RY5A 4DKEL 4AIOA 4JFED 4QO1A 5L2JB 4I48A 4BK4A 1K85A 4H26A 2EKJA 1SMAA 4LL9A 3OAUH 3SCMA 5JXAL 4YBLB 3QDAA 4NP4H 1F11A 4PJXB 3H42L 1TNNA 4MNGE 1EFXD 2RQ8A 1FNGB 1F4XL 1IZKA 4HUNB 1YC8A 2YR3A 5C9KA 1KF9B 4M1GL 2NY7H 3HNSL 3GNML 1V3KA 5DJXB 3FT2A 5E6IA 1VENA 1R3HB 1RJYB 4W81A 4K7PY 5SWZB 1YEJL 1VDGA 4PB0L 3LSOB 3QQ4B 4NJ9L 4ZUUA 3K3QA 1LE5B 1IM9D 3GSXA 4NKDA 3STLB 1JPSH 1OD7A 2IQAB 5DF0A 2YPKB 2V6HA 3QI9C 3QXDA 4XNUH 2ZG3A 1PZUB 1W72A 1LE9A 2EE9A 4RQQB 3U6RA 3ORJA 3M45A 3RIAK 1IGIL 4I5BA 3VGGA 2JELL 2BC4B 3LKOA 2J6EA 2YKLL 4R4FH 1I9RL 3KPSA 5D7IF 5D1QD 1U93A 3DROB 3WFZA 4Z7WA 3TYFB 1MCFA 4ELKA 1EHAA 3IFPB 3T0EE 4HUUB 3F7QA 1M7IB 1FL5A 4KFZC 4PG2C 4GKNA 1QFWH 2VZ1A 3I75A 3DETD 2R2CA 2IFGA 3M1BB 3MBEB 2F74B 1MOEA 4PGBA 4NNPL 5GISH 1T22B 5FGSA 3V8OA 4JKPH 1W2KT 5SWSB 1MCWM 3TZVD 1NEZA 1G7QA 5KS9B 1CTOA 4Y4KA 5AYQA 4Y19E 1UG9A 1ED3A 3EJZD 3O4LE 3UTZA 1A4JB 4N0UE 5JOFA 4YPJA 2MJWA 2ITCA 4PJDA 2ID5A 1CN4A 2PXYA 1F02I 1CE1H 3GHBH 1OVZA 3PF2A 3OKOA 1GYAA 5C0IB 2IG2L 2UUDH 3EGSA 2GTZA 1R5VB 4F33B 5AG8A 1GGIH 1ZHKA 4HKJA 5IBUG 2NX5B 3ALPA 3QI9D 2D2OA 5JR1L 2NY5L 3MR9A 4NQXA 3QXVA 4G6AC 2VABB 4YBLC 1G6RL 3MNVA 5I19L 2VDLL 4Q0XL 4EDWL 2ICCA 1OTTC 4HIEA 1DCLA 5CSZB 2DBLH 1JRHH 5IF0A 1OSZB 4HUXB 4K23H 2A6KB 4PJEF 4NO2A 1HIMH 4L8SB 2OP4H 4HUMB 2F19H 1YEDB 4M62H 4GO6B 1BFSA 1D5XA 1OHQA 1NBYB 4Y5VA 3V2AR 2EDNA 4HIIB 1HQ4B 1I7TB 4ZO6A 3IDXH 3FOLA 2OSLA 2P1YA 4GW4B 5FK9B 3IAPA 4PRHA 4U7SA 5TFSH 5L7XL 4P5MA 1F90L 4Z5RB 2LU3A 3TBSA 1GGBH 4P2RB 4GKSA 3CSYB 4LK4A 5KG9A 5CZVL 1CU4L 3SDYL 3WDIA 4MLIA 1KJ2A 3CK0H 2VDML 5F1OB 2QHRL 1QSEB 5HHPA 4NWUL 4G6AD 1LO0L 5IQ7L 4M4PA 5FM5O 3OR7B 3OGCA 3O11A 2BVPA 4PRPD 3QCTH 4NWTH 3MBEC 1RJCA 1RY7B 4OCRL 2VLKE 1MFBL 4NJAL 4YDKH 1OTTD 4EUPH 4D0BB 4Q9BA 4OLUH 4U2ZA 2GIYA 2GFBB 1ZK9A 4KMTH 3BWUC 2YWZA 4EDXA 3LH2L 3QDGB 1Q72H 3MLYL 4QNPF 1KTKE 3VDCA 1N3NB 1E4WH 1M6OB 5ESQA 3E3QE 1PY9A 1UZ6E 2HYMA 5GIRA 4F57L 1HQRB 5LJYH 5D5MA 1VGKA 1TVDA 3QHFH 4M6MH 3QDMD 3REVB 3VXPB 1URLA 1KPUB 1IAII 1FFPA 4YHYB 1YPZF 2VR4A 5IV2B 2FX7H 4M00A 1MPAL 1BOGA 4GG8A 1OGAE 4YR6B 5GS2D 5D2NE 4HSQA 1JTOA 5BQ7A 1XAUA 4K3EL 4PP1C 3E0GA 3W39A 4JFZH 1Q9KA 1JTPA 3ARED 3MRFB 1KLUA 4EJ1C 1XF3A 1BP3B 3AS1A 5FYLH 3GSNA 1T1ZA 5JPNB 3K8MA 2NXYB 4LLUB 4XP4H 4P49A 3MRNB 5I8CB 5EUOA 3QFJD 4NKOA 3ZL4L 3GSWA 4U6VL 4KK8D 4MNQB 2G75A 1TTGA 2JJVA 3PQYE 4IRSB 1O7SA 1X3DA 1N64L 5HI5C 4RGMC 1MJUL 4ZOAA 1A9EB 2FB4L 1MCJA 4YBHA 5GGUA 4LF3B 1IC4H 5FYKD 4JPVH 3S7GA 3ALWA 3RGHA 4P46A 3PE9A 5I1LB 1A3LH 2PO6B 3L7FB 4QXUH 2UZXB 3UTPE 4IM8A 4G8FB 5E4EB 4TN9A 4OF5A 2NX5D 2FECI 2COQA 2MWCA 5FGCE 2BZDA 2O26U 3DI3B 1I3RB 4MXQC 3ALXA 3NFSL 2XKSA 2DLHA 5E2UH 5FO7A 3MV9E 3ULUD 3BPCA 4OGZA 2R0KL 4NUJB 5EG6C 4ONGL 4AK1A 1PG7X 4X6BA 4ZFZB 2G60H 1IRAY 3BDYH 4EI6A 4OD1L 2H1PL 3VXRB 4PP1D 1ZA6B 3TV3L 3H9SD 1AO7E 3QRFM 3NIDF 4OLZH 1IQWH 2G5BB 3CAFA 2W60A 1Q94B 1S7TB 3DX7B 2AW2A 5DQDH 1KN2H 2XYCA 2P24B 4KQ4L 4MCZB 25C8H 4GRWE 4Z8FL 3UZVB 1DBKL 2AABL 2BNQB 3OF6D 4QY8A 5JQHC 4TVSa 4YC2C 4F7MA 4E0RB 3Q5OA 4NZDA 1JPGB 4B0MM 3CSGA 1EAPB 3FB7B 4XPBH 5J7CC 3A6BH 1QFWM 4J4PC 1MHCA 5HI5D 2MCG1 4HV8B 1JV5B 2V2WA 4QRUB 3X3FH 3PWUB 2D9QB 1YUHB 3KXFD 5I8EA 3RUGB 1D5ZB 1CK0H 2HJKA 2BVOB 5DD6A 1XZ0A 3FZUD 3C8DA 4YZFF 1Z0NA 4EKXA 3JV4A 1KCSH 1QHOA 4BQ8A 4Z0XA 3P30H 2XN9A 5F9OL 4NQEE 4MXQD 2DF3A 2CDGB 3HUJE 4TSCL 3WFCL 5C92A 1NCBH 1FSKB 4G7VL 1KT2B 2OMNA 3BKYH 4XNXH 1MCWW 4RX4D 3IJSB 5ALCL 2V5TA 4LAQL 5BVPH 5EWIH 5IB5B 4ODHL 5FCUH 2P5WE 3KYAA 2QSCH 3T3PF 1IKNC 5MENA 4Z7VA 2AV1B 1UWEL 1X5AA 3DRTA 4H25A 3RHWK 5IEHA 1NC2A 3DTXA 5LKNA 1A6UL 4JG0H 4L9DA 1BEYL 3D3VE 3DX8A 3LKSA 2GAZB 1NAKH 1G7JB 4G8EA 3SKNA 4X4YA 5F7DB 2UVFA 3TA3D 2HFEA 3QRGL 4EOWH 1CGUA 4P9HC 2DLEA 2PO6C 5MEPA 3V0AC 3HE7C 1JGLH 3UTQA 2JJSA 1NEZG 1V5JA 1F6LL 2XWBB 5GS1B 4J4PD 1EERB 4BK5A 1MIEH 1Z3GL 3PWPE 5T3XL 4WWID 3T77A 3WXVL 4M8QB 3UTSD 4TNVK 3GHEL 3O6FB 4NIKB 2YS4A 3GMPA 5ALBH 1MJJA 5DQJB 4RWHA 4NHUA 5CD5C 2PYFB 3T4AA 4ERSH 2CKBL 1HH6A 4YFLF 1BD2E 4HGWA 2EEDA 4AEIH 5BO1H 1A5FH 2HLAB 2PYEA 3RWGA 3GIZH 1VKXA 1KB9K 5FECB 4YHIA 3NCJH 4D3CH 4CVUA 3HG1D 2YA0A 4EI5B 4K8RH 1FVCB 1YN6A 2Y5TA 4BFGA 4JRXB 4IS6B 4X7DC 2XKUA 5INCA 1I1YB 5DTFB 1HHHA 1B0GA 1IAMA 3RUGF 2ADJB 3VWJC 1ZTXH 1GIGL 3S98A 4QHNA 3VDBA 2GJ6A 2R15A 3N1FC 1JPST 2YZ1A 4JFHD 3X3GH 2BXYA 4WFGE 1TJGH 2AJSH 3QUXA 2PO6D 3IETA 1E27B 3HE7D 1FZOB 2X4NA 4JVWA 1WCQA 1I8KB 1P1ZA 5HGHA 5IB4B 3BGAA 4JO1L 3PGDA 4ZUVB 5HSFA 5JDSA 3SJVB 4NQVA 4DUVA 5HGBA 1L9NA 5CGTA 3BZ4B 4QTIL 5C09B 3GMMA 3RNKA 1L0XA 1INDL 3S96B 3EO9H 3PWLA 1WTLA 2B5IC 5TQ2L 4X7TA 1FZJA 1NGZB 3JWDL 1S5IH 1HEZA 4W70A 1T21A 4PUBL 3NN8B 2AP2A 3TBWA 3WL9B 3PWJB 5EC1A 3BGMB 4NFCA 2ZKHL 3O2VH 4GJTB 3PP3K 1MFEH 3WFDL 4PJ7B 4Y8AA 1E28B 4R4FL 4DWHA 4WFED 2NXZC 2YPLA 4OFYA 5C0GA 1N0LA 4WO4C 3QXAB 5C2BH 3W9EB 5GS1C 3O3BA 2EDRA 1DUYB 3MGOA 3VWJD 4D9RD 4H20H 3I3EA 1PZ5A 4MZ2A 2KDGA 2WIIA 7FABL 4MQ7A 3TNMB 3ULVF 1JZ2A 4MHHG 4HH8A 1A7RL 5GISL 3H7BB 3HZMA 3KPNB 3BWAB 4AENA 4ZNEE 5FHBH 4JKPL 3LKPA 3HC4H 2DQTL 4LHUG 3WFBL 1FNSL 1A1MA 4EQ2A 1KCLA 1OM3L 4WWKA 4XWOC 1NCUA 3QUYB 4GAJL 4Z76A 2AQ2A 3P73B 4PS4H 1CE1L 3VXSA 5ID1A 3IXAA 3MRKB 1HI6A 3N9GH 1HOCA 4EI5C 2X4QB 2CMRH 1YNTB 1K4DB 4OM1H 1IAIH 4W4OC 3L3IB 1IKFH 1MFCH 1RURH 4M7JH 4JCLA 1N7MH 5B8CB 5D1ZA 2GYSA 4N8CH 3ZLQC 5CIPB 3DO7A 3D6GA 4P3DA 3RL2B 3EO0A 3NFNB 3R0MA 5IG7A 1C5BH 5IKCB 3DWTA 4I4WB 4XMLH 1CFSB 3AS0A 2NXZD 5FM5M 1KC5L 4GAGH 2HT2D 4K94L 1CLYH 4NSKB 5JHDD 3TJEL 4WO4D 2H8PB 2DBLL 5JW4R 1JRHL 3PJSA 5L8KB 5KSAA 3OXSB 4YPGB 1NCCH 3ZKNC 4MNGA 4FQCH 2F19L 4M62L 2YRZA 1X4ZA 1T6WA 4IIQA 2HVJA 3TPUA 4P4KB 2FEEI 5F72S 3BT2H 4HKBA 4P23A 1ZGLP 2X1WL 1G6VK 5E9DE 4BELD 4XWOD 4BZ2L 3RVTC 1QUNA 2RGSA 4OF3A 5CFHA 1F45A 5J89A 3QP3A 3VFRB 2AK4E 3NIFE 4PTUA 2JKXA 2BY2A 2IBZX 4PP2A 4CMHB 5F7EL 3BPOB 1GGBL 1T1XB 1XGRB 1WCBA 4HMEA 3WIFB 2C3VA 3HA0A 3SE3C 4KV5E 1LNUA 1F3DJ 4KAQL 2IPKB 2XWTA 3BXNB 3FQUA 3QCTL 4NWTL 1A9BA 3VD9A 3CXDH 4BSWB 3PWVA 3BW9A 4UQ2B 4MA3A 3T0EA 1FZKA 4YDKL 4NYLA 3B5GA 4M43L 4RGOL 1XF5A 1MF2H 3SKMB 1KG0B 4M1CC 5E8OA 1EO5A 2FJGB 1FO0L 3ZKND 3ZMRA 4PJBB 3SJVD 4Y19A 3O4LA 2XZCH 3ILQC 2UWEB 5C07E 4N0UA 4KTEH 2IPUK 3RGVB 2K9UA 1MCQA 2OTUB 5B8CC 1CS6A 4DZ8A 3HPJB 2VAAB 3QHFL 3GSRA 3U79A 3BH8A 5EUKA 1E4XH 3UBXA 2YZ8A 5ICYB 3RVTD 3ZE2E 4IHOB 3MGAA 3GMLB 3FB8B 4NQDE 5TDPB 4D9QE 4OJFH 5TGBB 2X40A 2YUWA 4BQ9A 1U8JA 3MUGB 4LLQB 4RAUA 4UV4H 1QVOA 3K81A 4HPYH 1G6RA 2VRAA 1DLFH 1FL6B 5HYSG 5I73B 3O41A 3P0VH 1S9WA 4NZUH 5FKPB 4UI2A 4J6RH 5FYLE 2HJFA 2H32B 1L6ZA 1T83A 1G9NH 4JFZL 3VFWB 1NGWB 4PGCB 3B9KB 4UDTA 1JPTL 2BY0A 4NO3A 5FYLL 5TF1L 1BJMA 4X8JA 5F44A 2O5YH 5FDWB 3TVMC 1I85C 2VDPL 3WN5C 1IAKB 4DKFH 2ZUVA 4D0DB 5K9QG 4KRPD 1WBYA 1M71A 1S7VA 2AXJA 1LGVA 1MNUL 1R24B 3GKWH 1T04A 4KZEH 3MA7A 4KRMB 4PRBA 3ZHKA 1T0MA 4M1CD 3NFPA 5JLZB 5I1CH 3E8UH 5KAQF 4FNLH 1IT9H 1CICB 2NLJA 3X14B 1JUFB 1IC4L 5GGRB 3NPSC 3T3ME 3ILQD 4JQVC 1A3LL 4CMHC 1A6ZA 4XPFL 3C60A 4M8VA 4MCYA 4YIQB 5E8NA 5F3HB 3VI3E 5GJSL 2EDEA 1U8QB 3P4MB 1EZVY 1ZLUK 4PJ5D 1A0QH 5E2UL 3VG0H 1NFDE 1ZVHA 4NN6C 3NZ8B 4TTDC 2DS4A 3WE6A 4DUWA 1DL7H 2W9EL 3EDKA 5D1XB 2YA1A 1IC5H 2R56H 5GGVY 1UKSA 3MV7E 4X9GA 4UB0H 3N1GC 5A40E 4LLWB 2FEDC 1IQWL 3KPRE 3MLZH 4U7KA 3X11B 4YEEA 5K9KA 4PD4K 3KLAA 2VLKA 2UWEF 4S2SB 2IAMA 3FQTB 1BVLA 25C8L 2HJLA 2M1KA 2W07A 3V5KA 4HZAA 3TVMD 3UP1A 2PCPB 1H15A 4HPOH 3VFUA 4L3EE 3VE0B 3BO8A 2OI9B 3OAYH 4RDQF 4G6FB 2Q76B 3MRCB 3RU8L 3X3FL 3BYTA 4OF8A 3QULA 1BVKA 1CK0L 2YN3A 2Q86B 1HDMA 1KFAH 1HSAB 5ENWB 1J8KA 4BQBA 3WXWH 3C9NB 1RUKL 2E7LA 4A2LA 1W0VA 4P5KA 1KCSL 5JNYA 4HUVB 2GK2A 3LKNB 1TQCB 1NCAH 3T4YB 5IFAH 4R8WH 4MQSB 2ESVE 3V4VH 2FJHA 1OGAA 1UA6H 2FO1A 2QSVA 3BKYL 1IAIM 3HZYB 4LPXA 5D2NA 3RAJH 1DVFB 4TTDD 5BVPL 4N0FB 3KYMA 4JPWH 2D7TH 5FCUL 4HZLA 1PLGH 3P4OB 1LO5A 4IMLB 4MD4A 5GRVL 1FAKT 2F8OA 2FEDD 4L8BA 4JG0L 3V9FA 1BQHG 2ZNXA 4PJGE 1NAKL 1UWXH 4G8GB 1HXYA 1CICC 4UINH 4QRTB 3T65B 5DD1H 3MZGB 4APQD 5F9JB 3FONA 3P4NA 4WI8A 5JHLH 3QQNA 1OP3H 3PQYA 2CLZA 4A6YH 2DBJA 3ZKQD 1S7UB 2HTLC 3G9AB 1QBLH 2C1OA 4NC1C 3OAZH 2Q1EA 5HHOD 1XFPA 1OGTB 3C09C 3SDXF 4HC1H 2JK5B 5J12B 5T3ZH 1BX2A 3V5HB 2WBKA 3HAEG 5C0EB 5ALBL 2EIZA 2V2XA 4CADA 5D1XC 1EK3A 2YD5A 2YSSB 5CBAA 3LQZA 1D6EA 4U3XA 3LRSA 3MV9A 3DVGB 5FYKH 5BO1L 3LPFA 1A5FL 2UUDK 2GCYB 2ICWI 1XGPA 5CEZD 3WSQH 1GCFA 5D2LF 2DD8H 3OXRB 2HP4A 3W0WE 3PHQB 4S0TD 4D3CL 2Y06H 4YFEA 5AAWA 2I9LA 4K8RL 3VH8A 3JTTA 1AO7A 4HWBA 2XY2A 3VXMB 2R0ZH 1ZLWK 4WW2C 2KUTA 4JR9H 3KG5A 4JFOB 1BAFH 2UYLB 3ARXA 1BM3L 4QTHB 5SX4I 3WUWG 1BFTA 3WFHA 3MRIB 4OFDA 3X3GL 3G5XB 4X0KA 1JGEA 1TJGL 2AJSL 4PGEA 1UENA 3KPQA 1DE4B 2OTWB 3VCLB 2HTLD 4WI6A 4JQXC 3WO4B 4GBXC 1QRNB 4L9LC 1TQCC 3CH8A 3EHBC 4GXVL 2BY3A 4ORZC 3CMGA 2P8LB 4Q9CA 3JV5A 5BS0D 1FBIH 2QKIA 1P9MA 3U30B 1F8TL 1OB1A 1LDPL 3VFTB 3UC0H 4NQEA 5D1XD 3HUJA 1OY3B 1OOAA 5FUCC 3C8KA 1S5IL 5IVXB 5KTEL 5J11C 1KOAA 2P5WA 1HWGB 1P4IH 3A0OA 3GM8A 2P49B 1U0QA 1MFEL 2WW8A 1YEEH 4F9LC 2DQCH 2DYPA 2W0FB 4I13B 4QRPD 3D3VA 4ODWA 3UX9B 5C2BL 3ZDZE 2AJZA 1B3JA 2VQUA 3SDCA 4DTGH 4PR5B 2DLGA 1NEUA 5E5UB 4UU9A 4GQ9L 3PDGA 3GMRB 5T1KA 4JFYA 4NQCD 4XCYA 2PETA 4RAVB 2F58H 3QZWB 1AY1H 4OCLC 2ARWA 1T1YB 1HHKB 3HC4L 2VQ1B 4GBXD 3PWPA 4R26H 5IJKC 3EHBD 4WEBL 1D9KB 5EU6B 3UBXG 2OQJA 2CKBA 1PG7H 1AKJB 4PS4L 5CCKH 4PJFE 2WSKA 3N9GL 2CIIB 4MJ4A 5CJ5A 2IBGA 2R4SL 3DRQA 1DBMH 5CSBA 1BD2A 4KHTH 1NCDH 4OM1L 1WIPA 1GRWA 3KYOA 3NPZB 3RVVC 1IKFL 4HXAL 1RURL 4M7JL 4NDMA 3W11C 1OAYH 1N7ML 1Y6NR 4OZGB 1QLEH 3U2SB 1DQQA 3RIFK 4Y4FA 4XP9H 1E0OB 4OKVB 3VJ6B 4HKZA 5F70A 3OB8A 1D5MB 2V5SA 1AFVH 1QO3A 1MRFL 2W9DH 4M5YH 1DANT 4O2CA 3NA9H 3IYLW 3CNKA 4R7NA 3SY0B 2BVTA 1X5KA 5LWYH 1CLYL 3RWCA 3TN0A 1GOHA 4LPYA 3WO4C 2V2TA 3QUZC 1WFOA 2AJ3A 3HCVB 5C7XH 1IC7H 4C56E 5IEKB 5E94A 4OCSH 2ORBH 2VXVH 4CBPA 1NCCL 4NCC2 4XPTL 5I1JL 5BZWA 2N7AA 1EO8L 4FQCL 5E6ZA 4OGAD 4GG6B 1G7HB 4IRZH 5E0QA 2AXHA 1XR9A 3S88H 3PHSA 5L8LB 3U30C 5B39G 3LQAC 3QH3A 1OQXA 1U95B 5KANI 1HILA 1KTDB 3BT2L 4RZCA 2KBGA 4MXWH 3UYRH 1JWUB 2BSRA 2W0KA 3Q5TA 4JEGB 4JHAH 4P9HH 2P7TB 5C0ND 3SCMD 4FA8A 2LTQB 1K8DA 1ND0A 2AKRA 4JDTH 4LLVA 1HSBB 1AXTH 3IKCA 4MXVF 4XPGH 3RVVD 2VDRH 4EN3A 3HMWL 4FRWA 2PF6A 5E6ID 4L8DB 3GJFH 3CH1A 1A7NH 1UXSA 2OYPA 2B4CH 4MMZC 5JW4N 3U7WH 1N4XL 4OI7A 1OTSC 2AEPH 1FNEA 3LCYA 2ERJB 3CX5K 1YMME 3U0TA 3RDTB 2P46B 2YRLA 5DURD 3AU1A 5B3JF 4QGYA 2VIRA 4PGDB 3MJ7A 1PAMA 2M26A 3OJ2C 3MSPA 5C0AB 3KYNB 3QUZD 2FIKA 3U7YL 8FABA 2OM5A 4Y5YC 3K4ZA 2OMBA 1MF2L 1X5FA 1XF2A 4HWZB 2VDOH 2CD0A 3Q3GB 2ADFH 5DUBB 2MFNA 2PW2B 4ZNEA 4KJPC 3E6FA 2C3WA 1MLBA 4R0LA 3KPSD 3BGFB 4IRJB 4KTEL 5LCVL 1VACB 1Q9WB 2A2QT 5FF6B 3NCYP 1DBAL 5F9WC 3TWCH 1E4XL 4P5TB 3OKDB 4GOSA 3N1PC 4ZSOE 1K8IB 1EVTC 4G9DB 4XRCB 5HBBA 3NH7H 3IDGB 4I0PB 4LCIH 5HHXL 2Q7YA 1NMBL 4OJFL 4XHJC 3UJIH 3LRGA 5IMKB 4O58L 3P77B 4LQFH 4UV4L 3OTTA 4GXUN 4F8QA 4HPYL 2YA2A 5J13B 4DCQB 3JWNC 4Y4KD 3F6LA 3IDIB 4M4RA 3WNPA 3P9LA 5JA9A 4NZUL 4P2QE 1H3VA 3LEXB 2ZJSH 4NZRH 4LRNL 1G9NL 4L1HA 4GG6F 1UT9A 4KI5F 2YXFA 5DSCA 1VB9A 2JCCE 4W6YB 4ZAKB 2O5YL 1FPTH 1ZLSH 2RFXA 1I8IB 4DKFL 5D4QA 5GRVK 4MAYB 2AXFA 4K55A 3JXAA 2YEZB 1BQLL 4XC3H 1ZHNA 5EU7C 4W68A 3OKLB 3VFSA 5F93C 1FJ1A 4WHYG 4ZQKB 5EU6D 3LN4B 2G9HB 3G04B 4QRRB 3TBVA 5J9PB 3E8UL 1JNHA 1R6VA 4FNLL 5JORB 2VC2L 2GITA 1IT9L 1QLRA 3CVHB 3I9GH 4ODSH 3VWKB 1XF1A 1CG9B 4KDWA 3TH4T 1KIPA 5E9DA 4NO0B 1HNFA 3AM8A 2GUOA 5KSBB 2HFFB 2CDEB 3D39D 3BYYA 5A3IC 4CU6A 4LVOB 1G7IB 2AK4A 4Y8DC 1DQJA 1T03H 2X89A 3R8BB 3L9RB 2ERJC 3RDTC 4JZJA 5EIVA 2DWDA 4XHJD 1M05B 1RHHA 4JRWA 4U6HB 2XG5A 5DD5H 2GW5A 1RD6A 2VISA 4PJ9A 1TVBA 4G9FB 4MJ2A 5HPMB 5I1KL 1IC5L 2R56L 1NLDH 4X4XB 1P69B 4QCIB 1CD1B 4EUPA 3EZ8A 3MLZL 4JHWH 1VGEH 3O9WB 1B2WL 1N6QH 2AVGA 3VGAB 1TJHL 1VEOA 4PRHD 5IB1A 5SX4H 2FX9L 4L8CA 4EXKA 4ZTOH 4RCAA 4PJXE 4ISVA 1X4YA 2EDYA 4XXCC 5KN5A 1WAAE 1T66C 2R4RH 4QHKI 3OKNB 5C07A 3HLAB 4R9HA 4TSAL 3T2PA 2R2BA 3EOYG 5I75C 1J9CT 3EOBB 1KFAL 1RK0B 3D0VA 6FABH 3QEQB 4QXTB 3V4UL 4WV1B 5J13C 3WYRA 3L95B 4JFDB 3S5LG 3NABL 1NCAL 3EDEA 4LPCA 5A3ID 4NQDA 1Z0MA 5ITBL 3VRIA 3BD5A 3VXTA 5IFAL 4R8WL 3V4VL 1BZQK 2PW1A 4ZAKC 2DQHH 2QSTA 3FRUB 4KKAC 3OR6A 2D7TL 4MAYC 3K1KC 4FQJH 3QO0B 1DFBL 4PV8A 3QA3A 2C26A 1C08B 3S35X 3ULUF 5JZ7C 1FG9C 1X5JA 2DDQL 3SE8H 3LDBB 3D87B 4NM8L 4YHNB 3THML 4B7IA 3PWNA 4N90D 4JLRA 3TH2T 1DQDH 3FO9B 4UINL 3DMMA 5DD1L 5JHLL 3BMVA 4OI8A 4RIRA 4WGVB 1LK3H 1ZGLB 2PTTA 4PJCB 2B2XH 5KOVC 1QBLL 2Z8SA 1C7SA 4YE4H 5T3ZE 1T2QL 2IBBA 5IVNA 1A3RH 5KS9E 3QWRD 5IB3B 1MUJA 1G0DA 2X6MA 5JO5B 5ADOH 3W2DH 1YY8A 4QHMB 4WI7A 2A9MH 3DIFB 4PTTB 5EZJB 3CFBB 5FYKE 2ITDB 3WBDA 2BOCA 3F7VA 3DGGB 1JNJA 1EAJA 3ROOB 4GRLA 1NFDA 4NNXB 2P5ED 2O5ZL 3WIIL 1UJ3B 4BSVB 1U3YA 2NX5E 2V7NB 3WSQL 2DD8L 2EDBA 1RJLA 5JMRA 4LARL 1X5IA 1H9VA 2Y06L 4ZAKD 4H1LB 1G7LA 4P46D 4KKAD 1U36A 3MV7A 1KIRA 3KR3L 3BPNB 4LSDA 5CD3B 5HYJB 2R0ZL 3KPRA 4PB9L 1HNGA 2YC1A 3O6LH 5DO2C 2VR9A 5EOTB 3AB0B 3FT4A 3GSVA 3NCFB 5JZ7D 3GMQB 2C9AA 4V2CB 4YUEL 3V4PL 3CLEL 1J0HA 3TO4A 2HLFC 1RIUH 4QRRD 3H9SE 4L3EA 4JFFB 3TIDB 2GTWA 3QYCA 3VFPA 1WEJH 3QNXA 4PJAE 5DJ2A 3S4SA 5T1MA 4WHCA 1HYSC 3LN9A 3W81A 1CR9L 1L7IH 3FOMA 1RJZA 3SPVB 2NZIA 4NKMA 4D0CB 4WFHD 4BH7B 4DAGL 4DKAA 5MERA 3Q1SL 2XQYG 3MYJA 2VLLB 3V6ZB 1X44A 4N1HB 2HRPH 2PKDA 5DYOA 5HHVH 1AC6A 3D85D 2PNDA 4YHMH 1FBIL 1U9KA 4G42B 4K3DL 1QD0A 1I4FA 3UC0L 2JJSC 3GB7A 2B20A 1XGQA 4YNYB 3G6JF 2ESVA 4B5EA 1DBJH 3FJTA 2FJFB 3DYOA 4GW1A 5C2UB 4ZMAT 4P2RE 1P4LA 3LDBC 4Y4HB 1RZ8B 3MRPB 2FCBA 1QSEE 4NZTH 5TE4L 3MZTA 1FNHA 4XMKH 1YEEL 2A73A 1KYOK 1PSKL 5DO2D 2HKHH 2XN9D 4PJGA 3RI5F 5D71H 4I2XB 1MCKA 4O2EB 1HINH 5KBNC 3SDAA 2HLFD 1CXKA 3VFVB 5F7WC 2DQFB 3X12B 3BEWB 5EH1A 5AD0B 2BHUA 3QJHA 1G1CA 2R29L 35C8H 5DD3H 3ZE0F 4GUPA 4U1JB 2X4SA 3QDGE 4HIJB 5MEND 1HYSD 4WTZA 3QEHA 4JFDD 4HHAA 1AD0B 1UVQB 2FBOJ 2OL3H 1EMTH 1JZ8A 1UH4A 3ECBB 4L4JA 1GZPA 1A1OA 3O2DH 4TVPL 5GSRA 1PG7L 1W0WB 2CR6A 1WFUA 2H9GA 4OZIB 5GXBB 4PJ8A 3RWDA 3IJYB 4LLDB 1EBAA 4HJ0C 3T0XA 1RVFH 1MI5D 1DBML 4Z0BH 3BPNC 4WEUD 3OX8B 4KHTL 4LCUA 5I15H 5I17A 3P0YL 4RMWA 3HN3A 5E1HB 3D2UA 5D7SL 1OAYL 2RCSH 3AB0C 3W0WA 4JFXB 5DT1L 1QLEL 4XCFH 2EYRA 1NGXB 3DV6B 4J8RA 3C6LA 5I66B 4BUGA 1U8NB 4YZFE 3CUPB 5DHYB 4ZOCA 1CZ8H 1P7HL 1KPVB 2DI9A 4PV9B 4Z18A 1AFVL 1H3PL 4M5YL 2H32H 2CLVA 3O3DA 1EHXA 2W65B 2HWZH 3HG1E 3RL1A 2DJUA 2WUBH 5IT2L 5I18H 2A6JB 3EFFA 3C2AL 1IC7L 3C5ZC 1YNKH 4OCSL 2ORBL 3L3KA 3NVQA 5D7KD 5DZOA 4OCWL 4IRZL 1U8IB 4IOIA 1XCQB 1OWWA 5C08D 4LVHC 4Y7MA 1U3JA 4JFHE 4KJQD 1X6LA 2ARJB 5IB2A 4WHTA 5GS0C 4ELME 2ZOLB 4OZFG 4XCCH 4S1SH 4TUOB 1SHMA 4ALAL 1HYRC 2YD6A 4HWEH 4P9HL 4OIIH 2A0LD 2HH0H 4HJ0D 2BMKA 5FV2A 3V0VA 5LGJA 3V0WH 5EO1B 5T5FL 4XPGL 3HC0A 2VDRL 1EJOH 5EO9A 2Z35B 1YEIH 4GMSL 1NGQH 4KPHH 1A7NL 4Y5XA 1YYMH 4YK4C 3T0BA 4JQIH 4Z77B 2B4CL 4WWKC 3GRWH 1RZIB 3U7WL 1JYVA 4LSQH 12E8H 5EA0L 3BUYB 2XI9A 3GMNB 4M61A 4KUCD 1NBQA 3UJJH 3RVXD 5F3BB 1H8NA 3L3GB 2EDOA 3OKYA 1QHPA 3ES6A 5H2BB 4BQ6A 5I76A 1UZ8B 4WFEE 3UJTL 1J87A 4Y16B 3CSBA 3C5ZD 1KIUA 2E6JA 3GI9L 5C9JA 2XACC 3TIEB 5KOMC 3TCLA 2VDOL 2ADFL 1N59A 4U6XA 2X1QA 2IALB 1ZT7A 4Q2ZA 5MI0B 5DMKA 1R5IA 2AV7A 1JP5A 4GKOA 4ZUTA 3WJJC 3OAYK 1OAQL 2YPLD 1AQDA 1AIFA 1LD9A 3V95A 4ODUA 1PD6A 3HC3H 5GS0D 3DX6B 1MHEA 3P11H 4HH9A 4PJFA 5TDOB 3TWCL 3ZKMD 5KSAC 4OLYH 4U3HA 2WBJB 2VLMD 2DLFH 3G08A 3NH7L 5E2TL 1SYVB 4U0RB 4WUUB 5F9AC 3CPLB 3SDDB 3UYPA 1T5WB 1DJSA 1C1EH 1I7UB 5HDLA 3VFOB 3IFNH 4ZNCD 4YBQC 4WWKD 1U92B 1YEHH 1RV6X 4HG4K 5CMAB 3OQ3B 1ZXQA 4BFIA 3VXSD 2HFGH 4JDVB 4LFHD 3QT2A 1FNLA 4CMMA 5FOBA 1ZLSL 1EEUA 3IDMB 4C56A 4OAWB 1CL7I 5EZOH 5D1ZD 4XNQB 4XH2A 1UWXK 3H6JA 3LB6C 4F