2DDAA

Crystal structure of pseudechetoxin from pseudechis australis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
b'KNYQKEIVDKHNALRRSVKPTARNMLQMKWNSRAAQNAKRWANRCTFAHSPPNKRTVGKLRCGENIFMSSQPFPWSGVVQAWYDEIKNFVYGIGAKPPGSVIGHYTQVVWYKSYLIGCASAKCSSSKYLYVCQYCPAGNIRGSIATPYKSGPPCADCPSACVNKLCTNPCKRNNDFSNCKSLAKKSKCQTEWIKKKCPASCFCHNKII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudechetoxin
publication title Structures of pseudechetoxin and pseudecin, two snake-venom cysteine-rich secretory proteins that target cyclic nucleotide-gated ion channels: implications for movement of the C-terminal cysteine-rich domain
pubmed doi rcsb
molecule tags Toxin
total genus 60
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 2ddaA02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 2ddaA01
4NUNA 3MZ8A 4G2UA 3S6VA 2DDBA 4LY5A 4NUIA 5JYSA 3U3UC 3Q2RA 1QNXA 4TPVA 1U53A 4IFAA 2GIZA 2DDAA 4NUKA 3NT8A 4AIWA 4NUOA 2CQ7A 4P27A 1CFEA 1SMBA 1XX5A 2EPFA 1RC9A 4H0AA 3U3LC 2A05A 5ETEA 4D53A 1XTAA 3U3NC 2VZNA 3S6UA 3Q2UA 3S6SA 1WVRA
chains in the Genus database with same CATH superfamily
5J47A 4YELA 2Q0OA 3A4CA 3K4CA 3M9AA 4CDGA 5IT9K 4IRHA 4XOTA 3V7CA 4B44A 4CCNA 1FMVA 4KMUX 3I56I 3S14J 2VC0A 2QVOA 3I53A 2K40A 1SVLA 5DCFA 4EGYA 4PDKA 2NS7A 2MABA 2ZKZA 4CGZA 1MJ9A 3NEUA 1J5YA 2ID3A 2W84A 5ED4A 2ID6A 3FXQA 3LAJA 3EDPA 4BEHA 1V54H 2UUZA 3K4NA 1RZ4A 2IJLA 2XSDC 1W7PA 3KZZA 5DM7F 2AS5F 3S93A 1SFXA 3CLQA 5IT3A 2R5YB 1X2NA 1QO0D 1XMKA 2GWRA 3TW7A 4NUNA 3NWSA 2BOLA 1YIJI 2OJED 3HSEA 3S15J 5C4JJ 2DMPA 4YFXF 2KQRA 1MJAA 5D8LB 2HVQA 2XC7A 1B9NA 3KLNA 3BTJA 1Q1HA 2HQNA 3NARA 2AQFA 4G6TB 3E97A 2B63J 1H8AC 2CW7A 3S3OA 2RQQA 4I09A 3OYIA 4R79A 1BC7C 2F5CA 3ONQA 4NNJA 1T2KA 4AUXA 1YFHA 1I3AA 2Y48A 3T8TA 4F7ZA 2DJNA 4KICA 3TKYA 1JJ8C 1QVUA 2A69F 4M73A 2HDCA 3VWBA 1STZA 1Y0NA 4N4OB 2R0QC 3Q5FA 3KEQA 3LSKA 5DDGA 2V7FA 1IN7A 1HLVA 4CHUA 1F9NA 3ABLH 1MMNA 2H6CA 5LGUA 1TT5B 2PMZA 2WB1N 2E5ZA 3ZPLA 1FYKA 2BHZA 2CUEA 2WAQA 3QODA 2P6TA 1MW7A 3RJPA 4B47A 2X6XA 1RRJA 2QWWA 2VZNA 1R5HA 5HDGA 1SFEA 4C9YA 3EETA 1MBFA 4D5CA 2ZFWA 4C2TA 1IN6A 1KGSA 3AG3H 2EH3A 4CCOA 1S3JA 4NQWB 4Y4RA 1JUMA 4ANJA 3P9CA 2K9NA 1E3PA 4XK4A 3UKGA 2LDUA 1KZHA 1W7PD 1QQIA 1ITYA 4C3HJ 1CFEA 3G1OA 2Y9YA 3F6OA 2QQBA 1MBJA 2VUMJ 3ERED 1VQ7I 3KETA 5GAHJ 1OR7A 4U7DA 1U78A 4R8HA 3CESA 2A6EF 2QQAA 3C2GA 3FHZA 3I54A 3FMQA 1IW7F 1ETWA 3LOCA 1TNSA 4HF0A 1Y1VJ 2DN0A 4XORA 1H89C 1A5JA 1Z67A 3KYDB 2RKHA 4J01A 3W2VA 2WAFA 3DV8A 3OSFA 4U0VA 3WTZA 1YO5C 3ROUA 1BW6A 5KVRA 2DLLA 1TT0A 4ITVA 2O3FA 1A35A 2KZGA 3BJAA 1FT9A 4UY8I 2K85A 4RDUA 2ZMEB 5J6XA 1USTA 2IVMA 2AHQA 3L2RA 4A3IJ 3RCOA 2NS8A 1WH5A 2Y2ZA 3FBIB 4BXUA 3AFHA 4XKCA 3HGYA 3E6BA 4UVBA 4IHVA 4A3JJ 4PSXA 3I64A 3ZMSA 4CSWA 3FWEA 1ZN2A 5DM6F 1HKSA 4MQVA 3TQNA 4BHCA 3VODA 1H9TA 5K7ZA 2KISA 4XSXF 3J7AO 1SMBA 1G8XA 3E5QA 2LY2A 3LSPA 1R7JA 1EA3A 5LGTA 2JUGA 1ORKA 4HX7A 3BG7A 3WU0A 1YJWI 2HYJA 2KL4A 3K4BA 2FRHA 2FU4A 3H1CA 4KJZA 5D8KB 1RESA 3A03A 4FETA 1OQYA 3U3UC 4G6QA 3RSNA 2ECCA 4XKWA 2OF7A 3CP2A 5L3DA 1P7IA 1SFUA 1DQUA 1IXCA 4LMYA 3BR0A 1P4WA 4HRIA 2E1MC 3TGNA 1FLIA 2X51A 4CZCA 4H0AA 1XMAA 4PJJA 5BMZA 5GTHC 3CCYA 5BOXA 1AWCA 2DMNA 4RB0A 3OYGA 1TQIA 5KCMA 1WVRA 3FX3A 3DEUA 3PO3J 3LL7A 1T56A 1DGWY 1Z05A 2O03A 1UB9A 2D1HA 2NVTJ 3FIWA 1YLFA 3O8GA 5CQEA 5KK1A 1DU0A 4GFBA 3AG2H 4F93B 4BUPA 4BQQA 2D45A 3WGHA 2E1OA 3ZGKA 2PQ8A 1LQ1A 4AIKA 2UXNA 4IHXA 1OYWA 1HDDC 4DQ2A 1HF0A 1ONVA 1D3YA 1P4AA 3HOVJ 2LYCA 2VE8A 1Z1DA 1WQ2A 2HEOA 3R0AA 4OAZA 4I7HA 2V6CA 3L2WA 4UUVA 1R9TJ 4BQOA 2Y0MA 1Z9CA 1PUFB 3OWTA 3WGGA 2OTJI 3QU6A 4GYIA 2Y0SN 3IWZA 1TWFJ 1HDPA 1JE8A 2XKPA 2JZYA 2BYVE 3JSOA 4IO9F 3J7AY 2R7VA 2UZKA 2DYRH 3HXLA 2P5VA 1BR2A 3OS1A 5A2QK 1D8KA 1KA8A 1Y0UA 3C1DA 4AIDA 2LSOA 4XBFA 2JA5J 3QYFA 2ESHA 5ETEA 3DQVC 3HC7A 3F0CA 3CC4I 4I6ZA 2GLOA 3ABUA 3HBLA 3QOPA 4RS8A 2QENA 4M6VA 3T1BA 3ZXSA 4ESJA 5E3MA 3KZIC 4IHYA 4RA2A 1K6YA 4BH9A 5IOYA 4HDUA 2XB5A 3E0JB 1ZYRF 1S5LC 4E4HA 1K79A 2BY0A 2JPCA 1NTCA 4NDLA 2IT0A 1JT6A 1X2MA 2DA1A 3RYPA 2DDAA 2Z1DA 4G9YA 2M3AA 1W0UA 2XGDA 3IKVA 4WXDA 2NAZA 4E7SA 3WE2A 3U3LC 3KIOA 3U9GA 4BE0A 2F4IA 5LHHA 1ODDA 1MBEA 3BQZA 4A3KJ 2BW3B 1U8RA 4KYWA 4ZTJA 4NC7A 3PIOF 1WZ2A 4OMZA 1APLC 2CV1A 1IV8A 1Y56A 3ULQB 2HS5A 2LG4A 2M45A 4ZC3A 1YJ9I 2LF8A 2PG4A 2DW4A 3FXMA 2VQLA 3H9JA 1HCRA 3H3VK 3MAJA 2QM3A 2BZTA 2EV0A 3FM3A 2R3SA 3I59B 3K2AA 4BBRJ 3PL8A 1J7KA 4ZYEA 1VQKI 2K9LA 3Q9VA 2XDVA 2FSWA 1DP7P 1QNTA 3OIQA 3CJRB 4HNVA 2MD5A 3W3CA 2R92J 4DGWB 1Y6IA 1G3WA 3MWMA 2R5YA 3FMSA 3CDLA 3MZ8A 1E0EA 1NK2P 2WADA 2L0KA 2JSPA 3BZ6A 1QZYA 3FXLA 5C3EJ 2EFWA 3ZP5A 3HPGA 1LE8B 5FLXZ 1UELB 4RM3A 4HLYA 2GXAA 4FT8A 2HXIA 4LITA 2CQXA 2M30A 2W7NA 1WKMA 1PDNC 5IYDJ 4L9NA 5EJCA 2M0CA 1T39A 1AHDP 3KEYA 5EGOB 4U0WA 2GM4A 1Z0XA 1XG1A 4LB5A 5LD2C 1NK3P 1I1SA 4FCYA 3PJRA 4DJAA 1ZGJA 1F36A 4M3FA 4PJLA 5FO5A 3SQNA 4KT5C 5H2FC 2W48A 3SZPA 4D53A 3BR5A 2HNHA 4P55A 5F27A 3IAS2 3H5AA 1KU9A 3D5LA 3R61A 2XAQA 1YX3A 4BU2A 2EV5A 2GXGA 3WHCA 3CO7C 5BPDA 2HKOA 5KAIC 3X2QH 5HS7A 3FKIJ 3SFIA 4DZPA 4A69C 2HWVA 1EKEA 1HQCA 3MKZA 3K70C 3BG9A 4B8XA 3OYLA 2VE9A 1VF9A 1BR4A 2PN6A 4MTEA 5E1WA 3VSKA 2M2EA 3RTRA 4ZDOA 2HVRA 2DMTA 3KYLA 1HSJA 2DA6A 5D4RA 4JBAA 3TL4X 1DP3A 1FBUA 1UG2A 3DBRB 3CUQB 5F04A 2R5ZB 1B72B 2JA6J 4XKVA 4AC0A 2HYFA 1Z21A 1XD7A 2BXZA 2EZKA 3FXJA 3GX4X 3MEXA 2NYXA 2VBWA 1DUXC 3TW6A 2QCOA 3KEOA 4B4CA 4Z6YA 3S3NA 1HC8A 2O8KA 3BY6A 3GFLA 4FE4A 3S2WA 1P9QC 1CQTA 2P8TA 3HOXJ 3KPHA 3OMYA 1S72I 2CQ7A 3U21A 2ACJA 2QSGX 3PO2J 4L0YB 2JVHA 4XKBA 1DPRA 2VC1A 3O8HA 4HQMA 1ZG5A 3ABTA 3HOTA 3W2AA 3J81Z 2FF4A 3C2HA 3S2HJ 2BV6A 3SFZA 4ZYDA 1XGMA 2WAEA 1SD4A 5H6RA 4JX6A 1D1AA 2CO5A 1QVTA 4PJNA 2B0LA 3DTEA 2DOFA 4P96A 3LA7A 4XOPA 3V8KA 3VSLA 2DCEA 2F4MB 4ENKA 3HSRA 3AL0B 2JTVA 3OYBA 2VJ5A 4M71A 4XR6A 3I4MJ 3VYSB 3H92A 2V1UA 1POGA 2CW8A 3FZVA 4G7OF 3OYHA 1R23A 1ZGWA 5KHDA 1N75A 1X4OA 2E5NA 2GA1A 2W00A 3S1MJ 3MKLA 4IOCF 2R93J 3OV8A 3FXOA 1FOYA 2ZMEA 4K2EA 5D6FA 3OYDA 2OTLI 4UNOA 2NOJB 3CQZJ 1R49A 2DBBA 2LBFB 4DNCA 3CO6C 1ZRCA 3IAM2 2DU9A 3GBGA 1GT0C 1WJDA 1KQ9A 1G3TA 4WWCA 5CVJA 5DUKA 2HYGD 2RDPA 4IXAA 1BI3A 1KQ0A 3OR2C 4YFNF 3VOEA 4IRIA 5LGNA 1OCCH 3GCMA 4RAYA 5F64A 2KJBA 1FJLA 2IPQX 4PFOA 2F5EA 1BOBA 1NG7A 4CZZA 3CCSI 3K4KA 1VNDA 5FKLA 2CS3A 3T0YA 5L3GA 1TW2A 4HNUA 2KMUA 4AYBA 2PI0A 1VI0A 5FROA 4GCVA 1SVOA 1UMQA 3DPLC 3I0TA 2CQNA 4G7HF 3P5JA 4J19A 2ZSIB 3WTVC 2LTPA 5FB2A 2W25A 2E35A 4IOAF 5AIPA 2H1LA 2XAFA 1Y1WJ 5L3BA 2CJJA 4LLLA 3CMMA 2RNGA 3QPSA 4KIBA 3H0DA 4D5FA 1ZLKA 1Z6RA 1J59A 1YG2A 4MQ9F 6PAXA 5DD4A 5EZHA 2DMQA 3LNQA 2DQRA 4XLAA 3GLXA 2JRTA 3U2RA 3O3KA 4ZYHA 4ASNA 2M5WA 4ZH4F 3K0LA 1R4NB 1T8IA 1UG0A 1G6NA 4PCQA 1OYYA 5IT9Z 2YU9J 1P6RA 3FKJA 1WJCA 2ZSHB 3E6CC 2VONA 3MZHA 1LDDA 1MDMA 2YX7A 2XHKA 4BQNA 4E7HA 2DTZA 1GXPA 1GVDA 2JN6A 3F3XA 1EJ9A 1A04A 3HEFA 2A05A 3K70D 2VODA 4I01A 5HVQC 1R1UA 3L2VA 4QIWN 2E1NA 2M7BA 3HOYJ 5FKMA 2A07F 5GAEJ 2ZFUA 2FEZA 3DLLF 5J8CA 2FBHA 1R5GA 4LG3A 3V4GA 2VT3A 2OZ6A 3IKTA 1GXQA 1X3WB 4BE1A 4IHWA 1VQ5I 1XCVA 3W6JB 2XF7A 1R58A 2DT5A 2M87A 2WV1A 3CCUI 1SD5A 1H0MA 2O5RA 3DPUA 2EFQA 2B7EA 1LEAA 2H6BA 4A5NA 4RB3C 1CF7B 3L2CA 1SEUA 3ESWB 2OUMA 1OPCA 4HX4A 4XIDA 3QRFF 3F72A 5GPCA 4XRMA 2RN7A 3DXJF 5E20A 1FOKA 3GW2A 4GYGA 4M72A 4RGSA 1FZPB 2XKOA 3SZTA 4S04A 4IQJA 2HDDA 3ZMUA 3HOWJ 2K4BA 1ZLJA 4ENJA 4Y7NJ 3BT9A 5E3NA 3BR3A 2K4JA 3EUKL 2FE3A 5FKOA 2FMLA 4A3BJ 2MLKA 4U87A 3PNVA 3OYMA 4Y15A 1DDNA 4V19K 4J00A 3KE2A 2XRLA 3PFYA 1WWXA 2EK5A 4HLXA 1I3QJ 3WG9A 3IWFA 3RPUA 1ERDA 1ZR2A 5EDNA 1HW5A 4I2OA 4DBQA 1HOMA 3KZYA 3T8RA 3VEPA 1VQOI 1ON1A 4GGGA 4LB6B 5DUIA 1TL8A 2E1MB 2VKHA 1AU7A 3W6KB 2D5VA 2MH9A 2CSOA 3BCBA 1U5TC 1UZCA 3I59A 2E2JJ 5HS8A 3K2ZA 4HBLA 4ZZDA 2JPBA 5CJ9A 5J4VA 4O3MA 4R1HA 5TGTA 3S6SA 1D5YA 4XLCA 3TO9A 4WXCA 2OC6A 2NXNB 3M8FA 3O2PE 3EUAA 3S6VA 5HLIA 2H09A 1JJ6C 1ETOA 1RIOH 2E7XA 5L3EA 1X1AA 1LE8A 1Z6TA 4C3IJ 4W1UA 2OD5A 2W1OA 1NH3A 5LHGA 2IGNA 1WJFA 3AL0C 4W97A 3SEQA 5EGOA 2E1CA 1BI1A 5FGMA 4A0XA 4KISA 1HXDA 2XRNA 2V79A 4UXNA 2HI3A 1OCOH 4WXHA 2I8DA 3A0BC 2JUCA 1B8IB 2IS4A 3BTLA 3OS2A 1S9HA 2FUG2 2E7WA 1TQPA 4EM2A 4KT6A 2HQ5A 1M1EB 2Q8KA 4OWRB 4D9JA 4M74A 2DFIA 1QPIA 2HPMA 1MIJA 4UB8C 3KX2A 4JX4A 2LKPA 4I02A 5J4YA 4D7NA 1Y39A 3N05A 1PYVA 1GVJA 2QYOA 5ILVA 4L5EA 2MH2A 4QTRA 1IXRC 3RPUD 2EFOA 2H8RA 4CCLA 3QWLA 3VYTB 4LOCA 1SMTA 1Z91A 2DOEA 3CCEI 4BYYA 2XV4S 2VOOA 1RNLA 3CUQA 2R5ZA 1U9NA 5E1ZB 1LEBA 3JAMK 4HF2A 3K1PA 4A3MJ 1UHWA 2DA2A 2EIJH 2EV6A 5EEGA 3CMYA 1G3YA 1OCPA 4XLHA 1V5FA 1QRYA 2LY1A 4YRVA 1N78A 4IJAA 2L7MP 1GUUA 2A6HF 4Q4ZF 3S3MA 1B6AA 2FBIA 2OBPA 4CXFA 3DBHB 3EQLF 4E70A 1YITI 1QHGA 1EH8A 2VL8A 1SC7A 1XCBA 1VQMI 2ELHA 4A5MA 5FKNA 2IRFG 2LF7A 1R1VA 5D4SA 1U53A 3SYTA 2QSHX 3AG4H 2IA1A 1UJ8A 2ZB9A 2ZXJA 1WI9A 2KFDA 4BACA 2V26A 1MNEA 3ASNH 1FSHA 2ESNA 5HNFA 1IF1A 1TBXA 1R71A 5K5QA 2XASA 2P5LC 2EILH 1R6RA 3E1SA 4KN4X 3HGGA 2LBFA 4NUIA 2L02A 3BJ6A 2I5UA 5H6QA 2ELJA 2FXAA 2DO7A 4L9TA 3RDIA 5FFXA 1K7AA 3DTIA 3KP2A 1IRFA 2FA5A 3TOBA 4F55A 1BL0A 4LIVA 3SDGA 1XX5A 1G2HA 2X6YA 5F08A 2ICWG 3ISPA 3QPTA 5A2QZ 1B59A 3JR9A 1TW3A 2DA7A 5H20A 1MJBA 2ADUA 2MD0A 2V1XA 2VASA 3HKZA 2IGOA 5LEJA 4MEXF 4L0ZB 2K3PA 2NVQJ 1SVMA 4IL6C 3QP5A 2VT2A 4ZJZA 1XSXA 4YFKF 1IDYA 1QBJA 4AM3A 3CCRI 1MZBA 3S1NJ 2DPUA 1MMDA 3B73A 3PQJA 2XROA 3MN2A 4G12A 2LVSA 1SAUA 3NRVA 3CLOA 1YRNA 3CDHA 5E8IA 4IKFA 1W0TA 1W5CC 4RB1A 1BC8C 2ISZA 2K9SA 3C18A 3FHNA 3CTAA 3S6UA 3BR6A 2P7CB 2OA4A 3ML6A 2Q2EA 1A36A 1ZKGA 2EWNA 1P2FA 1BOAA 3RKQA 2F5DA 2IS1A 2BY2A 2LRDA 2LFBA 3PM1A 3FXRA 4CCKA 3JRBA 3ZMTA 2X1EA 4GO1A 2NNNA 2OAZA 1MBHA 4MLOA 1X1PA 1QZZA 3NT8A 3I4PA 2R7OA 4II2A 5IPAA 2DMUA 2A3SA 5B1BH 3E6DA 3LA3A 2PFBA 3V8JA 4QLCU 2GIVA 3GWZA 4M3EA 4P1WA 4BDYA 3LFKA 4GDFA 4M3GA 3F8FA 3FF5A 1VFCA 5EG0B 4B43A 4FHTA 2P5KA 5LRRA 3M7GA 3IRRA 3QQAA 2MBFA 4MO7A 1RUNA 1KYWA 3SXYA 2VBXA 2K9QA 1RPWA 3KP7A 3G6EI 2VN2A 2YU3A 3DBLB 4KUMA 2L4MA 4OOIA 4EVIA 2H94A 3RI4A 1Z3XA 3OSGA 1ZH5A 4MGRA 5D5WB 2NVYJ 5TJJA 3LMMA 4BJ5C 2GAUA 4P9UA 1SFKA 2VJJA 2TCTA 5LRSA 1I5ZA 3WTXC 4ZDLA 1KU2A 1OFCX 4MFEA 4RMNA 5DS9A 3BG3A 5DD8A 3MKWB 3ZQQA 4E7IA 2W57A 5CQGA 1O3TA 1FX7A 1G4DA 3IP4B 4XNFA 3I71A 1YI2I 3DP7A 1IC8A 5DCMA 1GLNA 1TZLA 4RM2A 2L3DA 5EEAA 3U3NC 3GUDA 4LLNA 4OIPF 4N9HA 4XLPF 3GXOA 4BS9A 1SD6A 4GXOA 2M8EA 1D1BA 4O6JA 2LC2A 4A93J 1D0XA 1VQLI 1LUJB 3A02A 3QU3A 2P0WA 3FK6A 1TWCJ 3BDDA 4BXFA 2BHYA 3DLAA 3OOPA 1D1CA 5FFZA 1WJBA 5E3OA 3HTUA 2PBIA 4HYEA 1HW1A 2VQGA 3LSJA 3GTQJ 4X6AJ 2JSCA 4LG0B 5CYVA 1KU3A 3DCFA 2HDWA 3ERMA 2DA4A 1BM9A 4UB6C 4D0PA 1B1BA 2XIGA 2WY8Q 5CVVA 4HPQA 5LFAA 1IRZA 2PMZN 4BQAA 2HQAA 3VYUB 1OMIA 2LMDA 2CWEA 2WAQN 1J75A 2O8XA 3ASOH 2ETHA 2NS0A 4WCGA 5M3FJ 3OIPA 1TWHJ 3PNYA 5IP9J 4XN0A 1AKHB 1Y8RB 3WTUC 2RV8A 4IVNA 2BVMA 4II3A 2V1NA 3MZYA 1RI7A 2FQ4A 2KZVA 2JA7J 2L9RA 2X1CA 3RPQA 1B8IA 1S6LA 5ERIA 2P81A 1XGOA 3HM5A 2R7ZJ 2OPTA 2IP2A 3G3ZA 3LSIA 5K5RA 1JTYA 4HQEA 4QWQA 3CP8A 3HPHA 4U88A 1DPUA 2IXSA 5FD6A 5L3FA 4HDVA 1J9IA 3A01B 1U6GA 4RAZA 1YHQI 2EZHA 1ZQ3P 4DOZA 1AA7A 3EYYA 4CYCB 2MFZA 4E7ZA 3CZ6A 4Y33A 1YYVA 2E34A 4D1QA 2RREA 2OQGA 3CF2A 3K10A 3FISA 3F21A 1JUPA 2JJ7A 2ZNYA 2P7VB 3IC7A 4KNYA 1IRGA 5J8FA 1S7EA 4G6DA 4JK1X 3OYKA 1F5TA 3HOUJ 4OU0A 3C2BA 2GQQA 2EINH 3SHFA 4AIJA 3LSGA 3Q9SA 1A6QA 1K4SA 2R7DA 3TOAA 4RAFA 2PX9A 2H8WA 5AIQA 3OYEA 3B6AA 2QKLB 3BTCA 3G4SI 1LFBA 1F4KA 3BOQA 1TWGJ 1ENHA 1IUFA 3WGIA 4AD9A 1IG7A 4TV7A 5D5UB 2XGEA 1LDKB 4CCJA 1RR8C 4B3AA 1SMYF 1LKXA 4B1RA 1KYZA 4B48A 4HA8A 3OYNA 2YR2A 3JRAA 2E19A 1ETVA 4NB5A 2XF5A 4HW0A 3S16J 2VQHA 2ZC2A 1UHSA 4NQWA 3EUHC 2L54A 4A2UA 3IHUA 2Z3YA 2J5OA 1KU7A 2IA0A 1U5TB 2O7OA 3G1LA 1D8JA 1YS7A 3BC8A 3ELKA 5E18F 2BVLA 3E6MA 1P4XA 5TISC 3CMAI 4M6YA 3RIRA 4EEFG 1MMGA 1XSDA 1XSVA 5CVRA 1OYIA 2L7FP 2O6GE 3UNGC 3OYAA 1T33A 4UVAA 2DA5A 1LNWA 4ON0A 5GP9A 1IGNA 2D1VA 4DIQA 1ZRFA 4P5OA 4WX9A 4HV6A 2O0YA 1GV5A 2R7FA 3GO5A 5HDNA 2X4HA 2EBIA 2E71A 3GVAA 1UAAA 1BA5A 1E2XA 2CH0A 2FJ1A 5JLWA 2EB7A 2K9MA 3ZQIA 2PJRB 4CA0A 2R7QA 1YIOA 2KLOA 1JKRC 1W36C 4ZZLA 4OAYA 4YIIA 4Q5SF 3BG5A 3L7WA 3OR1C 4S05A 1WSUA 1R22A 2HZDA 2CQKA 1XDUA 2WY7Q 3FXUA 1F43A 1LFUP 1XDSA 2IA2A 2HOEA 2C6YA 4BE2A 2QEXI 3TEDA 5EEHA 4PZJA 1QGPA 5JHUA 4M6XA 2LLKA 4OIOF 2DTRA 4KIFA 2QLZA 1TQMA 2ZJQF 2VKDA 1L0OC 4XRSA 1T0FC 3QAHA 2KP6A 3WTSC 3MFKA 2XGCA 3PUFA 2V6EA 1VTNC 2G0EA 2STWA 4IFAA 4ZDPA 5ILUA 3DKWA 3S17J 3F8MA 3K6GA 3LFUA 2YX4A 3HB9A 1O7FA 3SJMA 1Y8QB 5B66C 2WB1A 2R7RA 2L7KA 1V5GA 5CPRB 3HOZJ 3F22A 2X1DA 2ECBA 2L2OA 3S8PA 3L2QA 2CYYA 3IH2A 4M9XA 2H27A 1DGRM 5EG0A 1USSA 5GTIC 1YJNI 2VKVA 3ABMH 3GYHX 1IRXA 5HS9A 2G7UA 2ZXIA 2JQ7A 2OU2A 2QQ9A 4EATA 3E3VA 3QYBA 3JRHA 2R4GA 3J7ZI 4NUKA 3JRDA 2RGVA 2L7ZA 1VQ6I 1FWZA 3BTIA 1ZG3A 1NHAA 1X58A 1JT0A 2ZXHA 3GTKJ 1XN7A 2HR3A 4M3DA 3PIPF 2ZJRF 1HBXG 2LP0A 3BZCA 3ZMVA 1O4XA 3D0SA 1IN8A 5KAFC 3MCZA 4I98B 4UUSB 2WWYA 4E7LA 4LK0F 2WC2A 3V7RA 1QU3A 3JRGA 1VQ4I 1EH6A 5IY5H 1PUFA 3HG9A 1D0ZA 4I99C 3Q2RA 1UHMA 3WTWC 3ZOBA 5E17F 5K1YA 2KDOA 3G1MA 5E1XA 2DK8A 3R6SA 2F4OB 2DK5A 3ZRGA 2Z2SB 2HOTA 5F1JA 2L01A 3CUOA 2Y30A 1ZAOA 2OV7A 4ZTFA 1YW7A 3FDYA 2ELKA 3HYIA 4XRFA 2IGKA 1BIAA 5FRNA 1FP2A 3LA2A 3VDXA 4C2MJ 4ESBA 5HNHA 3DKYA 4EGZA 2FNAA 4A0ZA 5IOZA 3IUOA 1U3EM 2E60A 3HUGB 1VQNI 4XLNF 2DFHA 2VPRA 2M8GX 2NOGA 5GAGJ 2QA4I 3TDZC 3GZ5A 2G9WA 5E79C 1U0JA 4MTDA 4DYQA 1HA8A 1BIBA 3U1KA 2YPRA 1V4RA 2VI6A 1GV2A 1IN5A 3DEEA 3M3YJ 2M0MA 4PFPA 2CV2A 4LG0A 1FTZA 3HRUA 1JXSA 3HOSA 2BW3A 1JKPC 3E5UA 4BY1J 1ZELA 4E7KA 4QPOA 3EYIA 2AQEA 1PP8F 1WCMJ 3RKYA 1TLHB 5LBQA 1W36D 3LAPA 4MEYF 1HKQA 4IEJA 5ICFA 3OYCA 2PMHA 3H5RA 1K78B 3HRMA 2KIMA 3CC7I 2CUFA 2OCCH 2XVCA 4EJUA 2GOXB 2L9NA 1AKHA 1I39A 1FOWA 1MSFC 3W6VA 5CVIA 3H35A 5CLSA 3F8CA 1XS9A 2HZTA 2XPVA 5J1RA 1FEXA 4L5JA 3FM5A 2QGUA 2E2HJ 3J80K 3OL3A 2VPLA 3GEZA 2QQ8A 1IUYA 2XAGA 3ECHA 3A01A 4NC8A 2CGPA 4IHSA 3IRQA 1DU6A 3QOEA 1JGSA 3FXKA 3TO6A 4LD5A 2DPDA 3WE3A 2JRMA 3QPHA 3M4OJ 1PUEE 2KRCA 1RKTA 5HDKA 3ZN1A 3S2DJ 4B3XA 1N77A 2CRGA 4G8XA 3NAUA 5F0HA 2P6SA 3L1PA 2XAHA 5EZGA 2MG4A 3I58A 4FISA 4DZJA 2CUZA 2W82A 2HVSA 3OY9A 3RKWA 2Y0SA 5FD5A 4XRSG 2KIQA 3GTJJ 5FRMA 5J1UA 4NHJA 1Z3YA 2Z9OA 4X1EA 1L3LA 3BR2A 2DT6A 4V2GA 4ENNA 1OR7C 4KMFA 2VOPA 2I10A 2XUBA 3BPVA 3U1DA 2QKMB 1AOYA 1B72A 1BW5A 3EPZA 4Y52J 1WFXA 3G71I 5HODA 5F6FA 4AVZA 1ON2A 4FX0A 1WRJA 3S32A 4ETSA 1KONA 3E7LA 4AVPA 1ETYA 1S7OA 3DTKA 3FBNB 4FASD 1JGGA 5LHIA 3UR3C 3RKXA 2EIKH 3H36A 4OINF 5ICGA 2JT1A 1U5TA 4S0HB 2DOAA 1OJLA 2X0LA 2Z16A 3PSIA 3CCVI 1P92A 4YIRX 1YE9A 2MLGA 4AYBN 4HX8A 2F6CA 2Y75A 2BY1A 2WBMA 3HIFA 1WGXA 4PGHA 2RC4A 2R7TA 2DDBA 1OCZH 3OL4A 4BHPA 3I55I 2BXYA 2HOSA 4KIGA 4JX5A 5ICEA 2LR8A 3VYRB 3DEWA 3GTMJ 2Z99A 1A31A 2XB0X 2AXTC 3HRTA 4EJWA 3S1RJ 5FJ8J 3BJOA 4Y13A 3WG7H 4X0GA 3K9TA 4F52A 4H4KC 4EQQA 3VB2A 3WTYC 4BNCA 2Y69H 4IX7A 1J2XA 2AXLA 1EH7A 4RAGA 3IH4A 3TBIA 4EM1A 3HTSB 2JMWA 1PVEA 4AIHA 2PJRA 1VQ8I 5ILSA 5EYRA 3A2KA 2K5CA 2DFFA 2M4GA 2TRTA 5J40A 1W5SA 1D5VA 3ABKH 1W1WE 1QPMA 5CVUA 2MGQA 3CJQB 2XAUA 5IP6A 1B9MA 2GBYA 1IO2A 3NQOA 3H3UA 2V1DA 5CKTA 4F92B 5E8GA 1LVAA 1CGPA 2X85A 4A3FJ 5DEQA 2EZIA 4QPQA 1MSEC 3E5XA 3TO7A 2UXXA 2KPMA 1GDTA 2JVGA 5DTDA 2O61A 2FX0A 4XONA 1V55H 2HTJA 2A61A 3IV5A 3PNTA 4FTHA 1XGNA 3ZN0A 2M7AA 1S8NA 5B3SH 3Q0VA 3L09A 1OLTA 1SFOJ 4BJ6C 4NUOA 1FYLA 2R7XA 3BZKA 1MBGA 3MMYB 1YS6A 1LVKA 3GZ6A 1JUSA 3D1NI 1BI0A 3CCLI 4XM3A 1LFPA 3J7YJ 4CO8A 1PP7U 1RR7A 2F5VA 3B02A 3BQYA 3OYJA 4MHGA 4HV5A 4NUBA 4KITB 3HDDA 1R5ID 4CH7A 1A6IA 4A3LJ 1MGTA 4EMSA 2ME6A 2FOKA 3W2WA 1VQPI 4C30A 3S1QJ 5BNGA 1IAWA 1BI2A 1I6XA 4N4NB 4ESFA 2ZO4A 4EV0A 5JLXA 4I76A 2KKOA 2OQRA 3V7SA 1HKTA 2VKEA 1H88C 3Q3SA 4BGDA 4G7ZF 2QBYB 1ZHFA 3JREA 4Y3OA 3KP5A 1Q1VA 4ENMA 2WV0A 2QZ8A 3KLOA 4Y17A 3CC2I 1ETXA 2ISYA 2CV0A 3QYEA 3JRCA 1J0RA 3IH3A 3KP4A 2K86A 1NG6A 4UUSA 2DYSH 4ZYAA 2KDZA 4IPAA 2XPUA 1BBYA 1S7AA 2ZXWH 4Q48A 3ZCOA 3OIOA 3I9V2 3A1YA 2UWMA 2HU9A 1T95A 5JI6A 1X19A 2GIZA 2E2IJ 2HQRA 1MMSA 3MKYB 5J3LA 4L9VA 3RQ4A 1U2WA 2GOMA 3SDBA 2RVCA 2COMA 4E6KG 4DBRA 3AAFA 1O3SA 3CD6I 2V4JC 2R7UA 4XLEA 2N8GA 1FOXA 4MIMA 3CCJI 1ZARA 1CF7A 3QPLA 4O5VA 1RETA 1E3HA 3GLLA 5IP7J 5LLQA 3CF5F 4EM0B 4KA4A 5J1YA 2IEKA 1ULYA 2DA3A 1R1TA 4E7JA 4RLFA 1QNXA 4V2FA 1JKOC 1OISA 2EFNA 1MDMB 3LQQA 3HUGA 3G2BA 3MVPA 4EJOA 3OS0A 3JSPA 5DV5A 4PUSA 3F6VA 5HOOA 4A3GJ 3DF8A 2HFHA 3L2UA 2D2WA 2DI3A 3CJTB 4BBSJ 3SEZA 2DODA 3WHBA 5JHFA 4AU7A 5TRDA 4N0BA 2JA2A 1E17A 1ETKA 1P7JA 2MA3A 4YIFA 3LSMA 4IQ4A 2Y31A 2MC3A 2JWTA 4PGGA 3GZNB 1ZG1A 2IAIA 1W5TA 4C3JJ 3DWLE 4WF2A 2CFXA 3RZDJ 2K7LA 1BR1A 5ICCA 5F1RA 4MFDA 2EA4A 1O7LA 5F0FA 4XN3A 3V42A 2MSYA 4M9SA 1K78A 1BJZA 1MNDA 5K7FA 1XB4A 1OCTC 4A3DJ 3P9KA 1MH4A 2QUFA 2VBZA 2DJIA 2NVUB 3HJEA 2BE5F 3BCAA 1QZEA 4Z2YA 3LSHA 1XTAA 3DKXA 3G73A 4UVCA 5M5XJ 3JTGA 1X3ZB 2MYSA 1T08B 3ZR8X 2RAEA 4A6DA 2DQLA 4Q47A 2STTA 2DFEA 2L9VA 4EJTA 2HOAA 1O3RA 2AO9A 1O3QA 4RLQA 3LQRA 3N97A 1G3SA 3HHGA 4LIUA 2HXOA 2K3FA 3BPXA 2X6WA 4NBQA 4PJ0C 4AIWA 3GF2A 3GFIA 1V3FA 2CQQA 4JYKA 4XSZF 3GTOJ 5B5EC 1Z7LA 1WI3A 2LNBA 3H3ZA 3D5SC 3F23A 5HLHA 4MNUA 2L4AA 3CMEI 1T6SA 3PSFA 5B1AH 2R7WA 1TC3C 5JVGF 1K4TA 4KN7X 3REOA 1FBSA 4LLGF 3I5UA 1F1ZA 2EQRA 1X1DA 4M3BA 1J09A 1S29A 4DYRA 5JYSA 1OCRH 3JCUC 3GMEA 3COAC 5F0CA 1K83J 2FMYA 2LKXA 2M1BA 2F48A 4FE7A 3F8BA 4U0YA 2BEOA 5EF6A 1T38A 4CCMA 2LOOA 5BPIA 4A3CJ 3QP6A 3ZQHA 1IV6A 2RQPA 3A0HC 2DAOA 2HGCA 2KHMA 4UUTA 4UV9A 1FNNA 1XGSA 2BY3A 3HSFA 4UV8A 1Z77A 3H5NA 2IGMA 4RB2C 4RBOA 2OCEA 4XL9A 2IW5A 4A6EA 1O57A 2LD5A 5FLMJ 1VZ0A 3R0JA 3ZQ7A 5IYCJ 1ZR4A 4F91B 2ZJPF 2Q1ZB 3AG1H 3ZQCA 1U9OA 5HLGA 3H9QA 3O6BB 1IN4A 1PJRA 5E3LA 1YQAA 4BEHB 4N9IA 1I27A 1BN5A 3HKZN 5KNLA 1W7PB 4WK8F 3KP6A 1ZTRA 2E36A 1LDJA 2ZMEC 1XPXA 2KRHA 1V5EA 4D7MA 1TNTA 3MQ0A 2ZBKA 2KRFA 5FKKA 3KP3A 2DT7B 3TP3A 3JTHA 2ZCWA 1XMXA 2W24A 2X9DA 3L00A 2FOWA 1ZK8A 2PEXA 3SZGA 3M8EA 3CCQI 1R4MB 4P27A 3HRSA 4LGWA 3TMOA 3RQIA 3GTLJ 1LPQA 3TP0A 2CU7A 4GRIA 4HSTA 1E3OC 3CCMI 1FC3A 2PMUA 1FMWA 2FQ3A 2VIXA 4FQGA 1RKWA 5LEKA 2B9SA 3JRFA 3FMRA 2ME0A 3RYRA 4LY5A 2VBYA 2COBA 3L9FA 2PJPA 4IRGA 3D5RC 1WPKA 2QSFX 1I6HJ 4U7BA 1FPQA 3H9GA 1FIPA 2UV1A 3M1CA 3HZJA 4XMYA 3VFZA 1RC9A 4IZZA 3R60A 4DW6A 4KFCA 2H1KA 1IZ1A 1TWAJ 3P9IA 1GHCA 2KJCA 3C3WA 1T98A 2EZLA 3ZQFA 2XGXA 1SAXA 2LH9A 1YW8A 2NVXJ 3PFIA 2RNJA 4H0EA 2A5YB 1FY7A 5D5VB 4HZFA 5GPAA 2X48A 3M8JA 4A0YA 4JOMA 3LSRA 3ZMDA 4HEA2 3BP8A 1JI8A 2V9VA 3RZOJ 2J5PA 1FBQA 3WTTC 4JP0A 2K02A 1QA6A 5M5YJ 3GTGJ 1BJAA 2GXBA 2KIFA 3WU1B 3LSTA 3BLYA 1IXSB 1EV7A 3K4MA 3JRIA 3Q2UA 5L3CA 2FNPA 1EF4A 3K4LA 4BDZA 1TP4A 2MW8A 1REPC 4BJTA 4G2UA 4XLFA 4YEJA 1JHHA 3C7JA 4F3QA 1SD7A 1FYMA 5FLXK 1YTYA 4HOBA 3EUHA 4TPVA 2A6TA 3HHHA 2BBYA 1WJEA 3ZMZA 3V8LA 2MC4A 2F2EA 4HAMA 4XQFA 4RGUA 3R4KA 2CW0F 4YG2F 4OMYA 5JVTA 2EPFA 4BY7J 3JW4A 4ZYGA 2R7SA 2WA0A 2QBYA 3T5XA 4M9ZA 4HNTA 1K61A 2M34A 2EJRA 4OIRF 5K7HA 4BXXJ 2HTSA 4CUGA 4LFUA 3I3LA 2FD5A 4HSRA 3F8NA 2IBDA 3ZQLA 3CDIA 5BQTA 1VQ9I 3CJNA 2Z5UA 2A5WA 4FX4A 3VPRA 1UCRA 2ZNZA 2YSRA 4AWXB 3DPTA 3PQKA 3J80Z 3GFMA 1YRNB 2WTEA 2V9PA 2EFPA 2M4KA 4BKXA 4RGRA 4A3EJ 1R36A 1YX5A 1X3UA 1WJAA 4NC6A 3B6CA 2G7HA 2W85A 2VQCA 2FBKA 4I0AA 4OIQF 5GADJ 2GA2A 2L9SA 2NNYA 5C44J 2IS6A 1FTTA 1I1GA 2Q2EB 1R00A 4ABZA 4JQFA 1W4MA 1UFMA 3DU5A 4DYCA 4CYDA 3BR1A 3M1EA 2CFOA 4I0BA 4QSHA 3K1NA 4IHTA 2X6OA 4XICA 2XPWA 1QHHD 4LK1F 3I4NJ 1RUOA 3N4MA 2YUSA 3GTPJ 1ETQA 3J81K 1OKRA 5DYMA 2IS2A 2YS9A 3BWGA 4B09A 2XF6A 4L5IA 4A12A 1T0FA 1ZGAA 5BS6A 1IDZA 3F9KA 2CUJA 1X1CA 2Y9ZA 2CG4A 3PUBA 4PSWA 5AONA 3JAMZ 3M07A 1FSEA 3NWTA 5D5XB 3DFGA 1MBKA 3K1MA 2LY9A 3H0GJ 1ACIA 1SANA 4HG2A 4G94A 1MH3A 1TTYA 4PK4A 3HL2A 2JK3A 2VJ4A 4BHBA 1MKMA 5HLTA 2GZWA 4UHTA 3FK7A 3LWFA 3ZQGA 2QF7A 1FP1D 2VLAA 3BROA 1K6OA 1HW2A 2JA8J 2XSJC 1WH7A 1X4PA 1ZRDA 2PLYA 1XC5A 1D0YA 5C4XJ 3MD2A 3OYFA 4LJZF 2V9KA 4P9FA 2DXIA 3Q0UA 2TDXA 2K27A 5IYBJ 1G59A 1C0WA 2O9LA 2VXZA 1IJWC 4L18B 1LJ9A 1LB2A 2P4WA 1MD0A 2LKSA 4IF4A 2OZUA 1Z7UA 4PJMA 5JFRA 1JTXA 2KT0A 1N25A 3OOUA 2LREA 4HF1A 1I50J 2ZJ2A 2Z33A 5FLVA 5DCMB 3KYCB 3TDUC 1MNMC 2BGCA 1H9GA 3ECOA 3WU2C 5JR3A 1U8BA 2EIMH 2NRAC 2L5QA 3P7NA 2VJIA 4BL0B 2HPIA 2LK2A 2HKXA 2VB6A 2CMPA 3CUQC 3GFJA 3IL2A 1JKQC 1ZREA 3KFWX 2XAJA 4BAYA 1B4AA 4KDPA 1KQ8A 2VXDA 2A68F 2F5FA 1YOVB 3BG6A 5D6EA 3WODF 4EJVA 3DU6A 1YW9A 1HSTA 3K7AJ 1JHFA 3AKZA 3KCCA 5M5WJ 1FIAA 3K69A 3K4JA 1X1BA 4C2UA 4CYCA 2M9HA 1WHUA 5M3MJ 4RGXA 9ANTA 1WJ5A 4CICA 2W4SA 3Q0WA 4L9JA 5K5OA 1MMAA 2EA2A 2KIUA
chains in the Genus database with same CATH topology
4NUNA 3MZ8A 4G2UA 3S6VA 2DDBA 4LY5A 4NUIA 5JYSA 3U3UC 3Q2RA 1QNXA 4TPVA 1U53A 4IFAA 2GIZA 2DDAA 4NUKA 3NT8A 4AIWA 4NUOA 2CQ7A 4P27A 1CFEA 1SMBA 1XX5A 2EPFA 1RC9A 4H0AA 3U3LC 2A05A 5ETEA 4D53A 1XTAA 3U3NC 2VZNA 3S6UA 3Q2UA 3S6SA 1WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUN A;  3MZ8 A;  4G2U A;  3S6V A;  2DDB A;  4LY5 A;  4NUI A;  5JYS A;  3U3U C;  3Q2R A;  1QNX A;  4TPV A;  1U53 A;  4IFA A;  2GIZ A;  2DDA A;  4NUK A;  3NT8 A;  4AIW A;  4NUO A;  2CQ7 A;  4P27 A;  1CFE A;  1SMB A;  1XX5 A;  2EPF A;  1RC9 A;  4H0A A;  3U3L C;  2A05 A;  5ETE A;  4D53 A;  1XTA A;  3U3N C;  2VZN A;  3S6U A;  3Q2U A;  3S6S A;  1WVR A; 
#chains in the Genus database with same CATH topology
 5J47 A;  4YEL A;  2Q0O A;  3A4C A;  3K4C A;  3M9A A;  4CDG A;  5IT9 K;  4IRH A;  4XOT A;  3V7C A;  4B44 A;  4CCN A;  1FMV A;  4KMU X;  3I56 I;  3S14 J;  2VC0 A;  2QVO A;  3I53 A;  2K40 A;  1SVL A;  5DCF A;  4EGY A;  4PDK A;  2NS7 A;  2MAB A;  2ZKZ A;  4CGZ A;  1MJ9 A;  3NEU A;  1J5Y A;  2ID3 A;  2W84 A;  5ED4 A;  2ID6 A;  3FXQ A;  3LAJ A;  3EDP A;  4BEH A;  1V54 H;  2UUZ A;  3K4N A;  1RZ4 A;  2IJL A;  2XSD C;  1W7P A;  3KZZ A;  5DM7 F;  2AS5 F;  3S93 A;  1SFX A;  3CLQ A;  5IT3 A;  2R5Y B;  1X2N A;  1QO0 D;  1XMK A;  2GWR A;  3TW7 A;  4NUN A;  3NWS A;  2BOL A;  1YIJ I;  2OJE D;  3HSE A;  3S15 J;  5C4J J;  2DMP A;  4YFX F;  2KQR A;  1MJA A;  5D8L B;  2HVQ A;  2XC7 A;  1B9N A;  3KLN A;  3BTJ A;  1Q1H A;  2HQN A;  3NAR A;  2AQF A;  4G6T B;  3E97 A;  2B63 J;  1H8A C;  2CW7 A;  3S3O A;  2RQQ A;  4I09 A;  3OYI A;  4R79 A;  1BC7 C;  2F5C A;  3ONQ A;  4NNJ A;  1T2K A;  4AUX A;  1YFH A;  1I3A A;  2Y48 A;  3T8T A;  4F7Z A;  2DJN A;  4KIC A;  3TKY A;  1JJ8 C;  1QVU A;  2A69 F;  4M73 A;  2HDC A;  3VWB A;  1STZ A;  1Y0N A;  4N4O B;  2R0Q C;  3Q5F A;  3KEQ A;  3LSK A;  5DDG A;  2V7F A;  1IN7 A;  1HLV A;  4CHU A;  1F9N A;  3ABL H;  1MMN A;  2H6C A;  5LGU A;  1TT5 B;  2PMZ A;  2WB1 N;  2E5Z A;  3ZPL A;  1FYK A;  2BHZ A;  2CUE A;  2WAQ A;  3QOD A;  2P6T A;  1MW7 A;  3RJP A;  4B47 A;  2X6X A;  1RRJ A;  2QWW A;  2VZN A;  1R5H A;  5HDG A;  1SFE A;  4C9Y A;  3EET A;  1MBF A;  4D5C A;  2ZFW A;  4C2T A;  1IN6 A;  1KGS A;  3AG3 H;  2EH3 A;  4CCO A;  1S3J A;  4NQW B;  4Y4R A;  1JUM A;  4ANJ A;  3P9C A;  2K9N A;  1E3P A;  4XK4 A;  3UKG A;  2LDU A;  1KZH A;  1W7P D;  1QQI A;  1ITY A;  4C3H J;  1CFE A;  3G1O A;  2Y9Y A;  3F6O A;  2QQB A;  1MBJ A;  2VUM J;  3ERE D;  1VQ7 I;  3KET A;  5GAH J;  1OR7 A;  4U7D A;  1U78 A;  4R8H A;  3CES A;  2A6E F;  2QQA A;  3C2G A;  3FHZ A;  3I54 A;  3FMQ A;  1IW7 F;  1ETW A;  3LOC A;  1TNS A;  4HF0 A;  1Y1V J;  2DN0 A;  4XOR A;  1H89 C;  1A5J A;  1Z67 A;  3KYD B;  2RKH A;  4J01 A;  3W2V A;  2WAF A;  3DV8 A;  3OSF A;  4U0V A;  3WTZ A;  1YO5 C;  3ROU A;  1BW6 A;  5KVR A;  2DLL A;  1TT0 A;  4ITV A;  2O3F A;  1A35 A;  2KZG A;  3BJA A;  1FT9 A;  4UY8 I;  2K85 A;  4RDU A;  2ZME B;  5J6X A;  1UST A;  2IVM A;  2AHQ A;  3L2R A;  4A3I J;  3RCO A;  2NS8 A;  1WH5 A;  2Y2Z A;  3FBI B;  4BXU A;  3AFH A;  4XKC A;  3HGY A;  3E6B A;  4UVB A;  4IHV A;  4A3J J;  4PSX A;  3I64 A;  3ZMS A;  4CSW A;  3FWE A;  1ZN2 A;  5DM6 F;  1HKS A;  4MQV A;  3TQN A;  4BHC A;  3VOD A;  1H9T A;  5K7Z A;  2KIS A;  4XSX F;  3J7A O;  1SMB A;  1G8X A;  3E5Q A;  2LY2 A;  3LSP A;  1R7J A;  1EA3 A;  5LGT A;  2JUG A;  1ORK A;  4HX7 A;  3BG7 A;  3WU0 A;  1YJW I;  2HYJ A;  2KL4 A;  3K4B A;  2FRH A;  2FU4 A;  3H1C A;  4KJZ A;  5D8K B;  1RES A;  3A03 A;  4FET A;  1OQY A;  3U3U C;  4G6Q A;  3RSN A;  2ECC A;  4XKW A;  2OF7 A;  3CP2 A;  5L3D A;  1P7I A;  1SFU A;  1DQU A;  1IXC A;  4LMY A;  3BR0 A;  1P4W A;  4HRI A;  2E1M C;  3TGN A;  1FLI A;  2X51 A;  4CZC A;  4H0A A;  1XMA A;  4PJJ A;  5BMZ A;  5GTH C;  3CCY A;  5BOX A;  1AWC A;  2DMN A;  4RB0 A;  3OYG A;  1TQI A;  5KCM A;  1WVR A;  3FX3 A;  3DEU A;  3PO3 J;  3LL7 A;  1T56 A;  1DGW Y;  1Z05 A;  2O03 A;  1UB9 A;  2D1H A;  2NVT J;  3FIW A;  1YLF A;  3O8G A;  5CQE A;  5KK1 A;  1DU0 A;  4GFB A;  3AG2 H;  4F93 B;  4BUP A;  4BQQ A;  2D45 A;  3WGH A;  2E1O A;  3ZGK A;  2PQ8 A;  1LQ1 A;  4AIK A;  2UXN A;  4IHX A;  1OYW A;  1HDD C;  4DQ2 A;  1HF0 A;  1ONV A;  1D3Y A;  1P4A A;  3HOV J;  2LYC A;  2VE8 A;  1Z1D A;  1WQ2 A;  2HEO A;  3R0A A;  4OAZ A;  4I7H A;  2V6C A;  3L2W A;  4UUV A;  1R9T J;  4BQO A;  2Y0M A;  1Z9C A;  1PUF B;  3OWT A;  3WGG A;  2OTJ I;  3QU6 A;  4GYI A;  2Y0S N;  3IWZ A;  1TWF J;  1HDP A;  1JE8 A;  2XKP A;  2JZY A;  2BYV E;  3JSO A;  4IO9 F;  3J7A Y;  2R7V A;  2UZK A;  2DYR H;  3HXL A;  2P5V A;  1BR2 A;  3OS1 A;  5A2Q K;  1D8K A;  1KA8 A;  1Y0U A;  3C1D A;  4AID A;  2LSO A;  4XBF A;  2JA5 J;  3QYF A;  2ESH A;  5ETE A;  3DQV C;  3HC7 A;  3F0C A;  3CC4 I;  4I6Z A;  2GLO A;  3ABU A;  3HBL A;  3QOP A;  4RS8 A;  2QEN A;  4M6V A;  3T1B A;  3ZXS A;  4ESJ A;  5E3M A;  3KZI C;  4IHY A;  4RA2 A;  1K6Y A;  4BH9 A;  5IOY A;  4HDU A;  2XB5 A;  3E0J B;  1ZYR F;  1S5L C;  4E4H A;  1K79 A;  2BY0 A;  2JPC A;  1NTC A;  4NDL A;  2IT0 A;  1JT6 A;  1X2M A;  2DA1 A;  3RYP A;  2DDA A;  2Z1D A;  4G9Y A;  2M3A A;  1W0U A;  2XGD A;  3IKV A;  4WXD A;  2NAZ A;  4E7S A;  3WE2 A;  3U3L C;  3KIO A;  3U9G A;  4BE0 A;  2F4I A;  5LHH A;  1ODD A;  1MBE A;  3BQZ A;  4A3K J;  2BW3 B;  1U8R A;  4KYW A;  4ZTJ A;  4NC7 A;  3PIO F;  1WZ2 A;  4OMZ A;  1APL C;  2CV1 A;  1IV8 A;  1Y56 A;  3ULQ B;  2HS5 A;  2LG4 A;  2M45 A;  4ZC3 A;  1YJ9 I;  2LF8 A;  2PG4 A;  2DW4 A;  3FXM A;  2VQL A;  3H9J A;  1HCR A;  3H3V K;  3MAJ A;  2QM3 A;  2BZT A;  2EV0 A;  3FM3 A;  2R3S A;  3I59 B;  3K2A A;  4BBR J;  3PL8 A;  1J7K A;  4ZYE A;  1VQK I;  2K9L A;  3Q9V A;  2XDV A;  2FSW A;  1DP7 P;  1QNT A;  3OIQ A;  3CJR B;  4HNV A;  2MD5 A;  3W3C A;  2R92 J;  4DGW B;  1Y6I A;  1G3W A;  3MWM A;  2R5Y A;  3FMS A;  3CDL A;  3MZ8 A;  1E0E A;  1NK2 P;  2WAD A;  2L0K A;  2JSP A;  3BZ6 A;  1QZY A;  3FXL A;  5C3E J;  2EFW A;  3ZP5 A;  3HPG A;  1LE8 B;  5FLX Z;  1UEL B;  4RM3 A;  4HLY A;  2GXA A;  4FT8 A;  2HXI A;  4LIT A;  2CQX A;  2M30 A;  2W7N A;  1WKM A;  1PDN C;  5IYD J;  4L9N A;  5EJC A;  2M0C A;  1T39 A;  1AHD P;  3KEY A;  5EGO B;  4U0W A;  2GM4 A;  1Z0X A;  1XG1 A;  4LB5 A;  5LD2 C;  1NK3 P;  1I1S A;  4FCY A;  3PJR A;  4DJA A;  1ZGJ A;  1F36 A;  4M3F A;  4PJL A;  5FO5 A;  3SQN A;  4KT5 C;  5H2F C;  2W48 A;  3SZP A;  4D53 A;  3BR5 A;  2HNH A;  4P55 A;  5F27 A;  3IAS 2;  3H5A A;  1KU9 A;  3D5L A;  3R61 A;  2XAQ A;  1YX3 A;  4BU2 A;  2EV5 A;  2GXG A;  3WHC A;  3CO7 C;  5BPD A;  2HKO A;  5KAI C;  3X2Q H;  5HS7 A;  3FKI J;  3SFI A;  4DZP A;  4A69 C;  2HWV A;  1EKE A;  1HQC A;  3MKZ A;  3K70 C;  3BG9 A;  4B8X A;  3OYL A;  2VE9 A;  1VF9 A;  1BR4 A;  2PN6 A;  4MTE A;  5E1W A;  3VSK A;  2M2E A;  3RTR A;  4ZDO A;  2HVR A;  2DMT A;  3KYL A;  1HSJ A;  2DA6 A;  5D4R A;  4JBA A;  3TL4 X;  1DP3 A;  1FBU A;  1UG2 A;  3DBR B;  3CUQ B;  5F04 A;  2R5Z B;  1B72 B;  2JA6 J;  4XKV A;  4AC0 A;  2HYF A;  1Z21 A;  1XD7 A;  2BXZ A;  2EZK A;  3FXJ A;  3GX4 X;  3MEX A;  2NYX A;  2VBW A;  1DUX C;  3TW6 A;  2QCO A;  3KEO A;  4B4C A;  4Z6Y A;  3S3N A;  1HC8 A;  2O8K A;  3BY6 A;  3GFL A;  4FE4 A;  3S2W A;  1P9Q C;  1CQT A;  2P8T A;  3HOX J;  3KPH A;  3OMY A;  1S72 I;  2CQ7 A;  3U21 A;  2ACJ A;  2QSG X;  3PO2 J;  4L0Y B;  2JVH A;  4XKB A;  1DPR A;  2VC1 A;  3O8H A;  4HQM A;  1ZG5 A;  3ABT A;  3HOT A;  3W2A A;  3J81 Z;  2FF4 A;  3C2H A;  3S2H J;  2BV6 A;  3SFZ A;  4ZYD A;  1XGM A;  2WAE A;  1SD4 A;  5H6R A;  4JX6 A;  1D1A A;  2CO5 A;  1QVT A;  4PJN A;  2B0L A;  3DTE A;  2DOF A;  4P96 A;  3LA7 A;  4XOP A;  3V8K A;  3VSL A;  2DCE A;  2F4M B;  4ENK A;  3HSR A;  3AL0 B;  2JTV A;  3OYB A;  2VJ5 A;  4M71 A;  4XR6 A;  3I4M J;  3VYS B;  3H92 A;  2V1U A;  1POG A;  2CW8 A;  3FZV A;  4G7O F;  3OYH A;  1R23 A;  1ZGW A;  5KHD A;  1N75 A;  1X4O A;  2E5N A;  2GA1 A;  2W00 A;  3S1M J;  3MKL A;  4IOC F;  2R93 J;  3OV8 A;  3FXO A;  1FOY A;  2ZME A;  4K2E A;  5D6F A;  3OYD A;  2OTL I;  4UNO A;  2NOJ B;  3CQZ J;  1R49 A;  2DBB A;  2LBF B;  4DNC A;  3CO6 C;  1ZRC A;  3IAM 2;  2DU9 A;  3GBG A;  1GT0 C;  1WJD A;  1KQ9 A;  1G3T A;  4WWC A;  5CVJ A;  5DUK A;  2HYG D;  2RDP A;  4IXA A;  1BI3 A;  1KQ0 A;  3OR2 C;  4YFN F;  3VOE A;  4IRI A;  5LGN A;  1OCC H;  3GCM A;  4RAY A;  5F64 A;  2KJB A;  1FJL A;  2IPQ X;  4PFO A;  2F5E A;  1BOB A;  1NG7 A;  4CZZ A;  3CCS I;  3K4K A;  1VND A;  5FKL A;  2CS3 A;  3T0Y A;  5L3G A;  1TW2 A;  4HNU A;  2KMU A;  4AYB A;  2PI0 A;  1VI0 A;  5FRO A;  4GCV A;  1SVO A;  1UMQ A;  3DPL C;  3I0T A;  2CQN A;  4G7H F;  3P5J A;  4J19 A;  2ZSI B;  3WTV C;  2LTP A;  5FB2 A;  2W25 A;  2E35 A;  4IOA F;  5AIP A;  2H1L A;  2XAF A;  1Y1W J;  5L3B A;  2CJJ A;  4LLL A;  3CMM A;  2RNG A;  3QPS A;  4KIB A;  3H0D A;  4D5F A;  1ZLK A;  1Z6R A;  1J59 A;  1YG2 A;  4MQ9 F;  6PAX A;  5DD4 A;  5EZH A;  2DMQ A;  3LNQ A;  2DQR A;  4XLA A;  3GLX A;  2JRT A;  3U2R A;  3O3K A;  4ZYH A;  4ASN A;  2M5W A;  4ZH4 F;  3K0L A;  1R4N B;  1T8I A;  1UG0 A;  1G6N A;  4PCQ A;  1OYY A;  5IT9 Z;  2YU9 J;  1P6R A;  3FKJ A;  1WJC A;  2ZSH B;  3E6C C;  2VON A;  3MZH A;  1LDD A;  1MDM A;  2YX7 A;  2XHK A;  4BQN A;  4E7H A;  2DTZ A;  1GXP A;  1GVD A;  2JN6 A;  3F3X A;  1EJ9 A;  1A04 A;  3HEF A;  2A05 A;  3K70 D;  2VOD A;  4I01 A;  5HVQ C;  1R1U A;  3L2V A;  4QIW N;  2E1N A;  2M7B A;  3HOY J;  5FKM A;  2A07 F;  5GAE J;  2ZFU A;  2FEZ A;  3DLL F;  5J8C A;  2FBH A;  1R5G A;  4LG3 A;  3V4G A;  2VT3 A;  2OZ6 A;  3IKT A;  1GXQ A;  1X3W B;  4BE1 A;  4IHW A;  1VQ5 I;  1XCV A;  3W6J B;  2XF7 A;  1R58 A;  2DT5 A;  2M87 A;  2WV1 A;  3CCU I;  1SD5 A;  1H0M A;  2O5R A;  3DPU A;  2EFQ A;  2B7E A;  1LEA A;  2H6B A;  4A5N A;  4RB3 C;  1CF7 B;  3L2C A;  1SEU A;  3ESW B;  2OUM A;  1OPC A;  4HX4 A;  4XID A;  3QRF F;  3F72 A;  5GPC A;  4XRM A;  2RN7 A;  3DXJ F;  5E20 A;  1FOK A;  3GW2 A;  4GYG A;  4M72 A;  4RGS A;  1FZP B;  2XKO A;  3SZT A;  4S04 A;  4IQJ A;  2HDD A;  3ZMU A;  3HOW J;  2K4B A;  1ZLJ A;  4ENJ A;  4Y7N J;  3BT9 A;  5E3N A;  3BR3 A;  2K4J A;  3EUK L;  2FE3 A;  5FKO A;  2FML A;  4A3B J;  2MLK A;  4U87 A;  3PNV A;  3OYM A;  4Y15 A;  1DDN A;  4V19 K;  4J00 A;  3KE2 A;  2XRL A;  3PFY A;  1WWX A;  2EK5 A;  4HLX A;  1I3Q J;  3WG9 A;  3IWF A;  3RPU A;  1ERD A;  1ZR2 A;  5EDN A;  1HW5 A;  4I2O A;  4DBQ A;  1HOM A;  3KZY A;  3T8R A;  3VEP A;  1VQO I;  1ON1 A;  4GGG A;  4LB6 B;  5DUI A;  1TL8 A;  2E1M B;  2VKH A;  1AU7 A;  3W6K B;  2D5V A;  2MH9 A;  2CSO A;  3BCB A;  1U5T C;  1UZC A;  3I59 A;  2E2J J;  5HS8 A;  3K2Z A;  4HBL A;  4ZZD A;  2JPB A;  5CJ9 A;  5J4V A;  4O3M A;  4R1H A;  5TGT A;  3S6S A;  1D5Y A;  4XLC A;  3TO9 A;  4WXC A;  2OC6 A;  2NXN B;  3M8F A;  3O2P E;  3EUA A;  3S6V A;  5HLI A;  2H09 A;  1JJ6 C;  1ETO A;  1RIO H;  2E7X A;  5L3E A;  1X1A A;  1LE8 A;  1Z6T A;  4C3I J;  4W1U A;  2OD5 A;  2W1O A;  1NH3 A;  5LHG A;  2IGN A;  1WJF A;  3AL0 C;  4W97 A;  3SEQ A;  5EGO A;  2E1C A;  1BI1 A;  5FGM A;  4A0X A;  4KIS A;  1HXD A;  2XRN A;  2V79 A;  4UXN A;  2HI3 A;  1OCO H;  4WXH A;  2I8D A;  3A0B C;  2JUC A;  1B8I B;  2IS4 A;  3BTL A;  3OS2 A;  1S9H A;  2FUG 2;  2E7W A;  1TQP A;  4EM2 A;  4KT6 A;  2HQ5 A;  1M1E B;  2Q8K A;  4OWR B;  4D9J A;  4M74 A;  2DFI A;  1QPI A;  2HPM A;  1MIJ A;  4UB8 C;  3KX2 A;  4JX4 A;  2LKP A;  4I02 A;  5J4Y A;  4D7N A;  1Y39 A;  3N05 A;  1PYV A;  1GVJ A;  2QYO A;  5ILV A;  4L5E A;  2MH2 A;  4QTR A;  1IXR C;  3RPU D;  2EFO A;  2H8R A;  4CCL A;  3QWL A;  3VYT B;  4LOC A;  1SMT A;  1Z91 A;  2DOE A;  3CCE I;  4BYY A;  2XV4 S;  2VOO A;  1RNL A;  3CUQ A;  2R5Z A;  1U9N A;  5E1Z B;  1LEB A;  3JAM K;  4HF2 A;  3K1P A;  4A3M J;  1UHW A;  2DA2 A;  2EIJ H;  2EV6 A;  5EEG A;  3CMY A;  1G3Y A;  1OCP A;  4XLH A;  1V5F A;  1QRY A;  2LY1 A;  4YRV A;  1N78 A;  4IJA A;  2L7M P;  1GUU A;  2A6H F;  4Q4Z F;  3S3M A;  1B6A A;  2FBI A;  2OBP A;  4CXF A;  3DBH B;  3EQL F;  4E70 A;  1YIT I;  1QHG A;  1EH8 A;  2VL8 A;  1SC7 A;  1XCB A;  1VQM I;  2ELH A;  4A5M A;  5FKN A;  2IRF G;  2LF7 A;  1R1V A;  5D4S A;  1U53 A;  3SYT A;  2QSH X;  3AG4 H;  2IA1 A;  1UJ8 A;  2ZB9 A;  2ZXJ A;  1WI9 A;  2KFD A;  4BAC A;  2V26 A;  1MNE A;  3ASN H;  1FSH A;  2ESN A;  5HNF A;  1IF1 A;  1TBX A;  1R71 A;  5K5Q A;  2XAS A;  2P5L C;  2EIL H;  1R6R A;  3E1S A;  4KN4 X;  3HGG A;  2LBF A;  4NUI A;  2L02 A;  3BJ6 A;  2I5U A;  5H6Q A;  2ELJ A;  2FXA A;  2DO7 A;  4L9T A;  3RDI A;  5FFX A;  1K7A A;  3DTI A;  3KP2 A;  1IRF A;  2FA5 A;  3TOB A;  4F55 A;  1BL0 A;  4LIV A;  3SDG A;  1XX5 A;  1G2H A;  2X6Y A;  5F08 A;  2ICW G;  3ISP A;  3QPT A;  5A2Q Z;  1B59 A;  3JR9 A;  1TW3 A;  2DA7 A;  5H20 A;  1MJB A;  2ADU A;  2MD0 A;  2V1X A;  2VAS A;  3HKZ A;  2IGO A;  5LEJ A;  4MEX F;  4L0Z B;  2K3P A;  2NVQ J;  1SVM A;  4IL6 C;  3QP5 A;  2VT2 A;  4ZJZ A;  1XSX A;  4YFK F;  1IDY A;  1QBJ A;  4AM3 A;  3CCR I;  1MZB A;  3S1N J;  2DPU A;  1MMD A;  3B73 A;  3PQJ A;  2XRO A;  3MN2 A;  4G12 A;  2LVS A;  1SAU A;  3NRV A;  3CLO A;  1YRN A;  3CDH A;  5E8I A;  4IKF A;  1W0T A;  1W5C C;  4RB1 A;  1BC8 C;  2ISZ A;  2K9S A;  3C18 A;  3FHN A;  3CTA A;  3S6U A;  3BR6 A;  2P7C B;  2OA4 A;  3ML6 A;  2Q2E A;  1A36 A;  1ZKG A;  2EWN A;  1P2F A;  1BOA A;  3RKQ A;  2F5D A;  2IS1 A;  2BY2 A;  2LRD A;  2LFB A;  3PM1 A;  3FXR A;  4CCK A;  3JRB A;  3ZMT A;  2X1E A;  4GO1 A;  2NNN A;  2OAZ A;  1MBH A;  4MLO A;  1X1P A;  1QZZ A;  3NT8 A;  3I4P A;  2R7O A;  4II2 A;  5IPA A;  2DMU A;  2A3S A;  5B1B H;  3E6D A;  3LA3 A;  2PFB A;  3V8J A;  4QLC U;  2GIV A;  3GWZ A;  4M3E A;  4P1W A;  4BDY A;  3LFK A;  4GDF A;  4M3G A;  3F8F A;  3FF5 A;  1VFC A;  5EG0 B;  4B43 A;  4FHT A;  2P5K A;  5LRR A;  3M7G A;  3IRR A;  3QQA A;  2MBF A;  4MO7 A;  1RUN A;  1KYW A;  3SXY A;  2VBX A;  2K9Q A;  1RPW A;  3KP7 A;  3G6E I;  2VN2 A;  2YU3 A;  3DBL B;  4KUM A;  2L4M A;  4OOI A;  4EVI A;  2H94 A;  3RI4 A;  1Z3X A;  3OSG A;  1ZH5 A;  4MGR A;  5D5W B;  2NVY J;  5TJJ A;  3LMM A;  4BJ5 C;  2GAU A;  4P9U A;  1SFK A;  2VJJ A;  2TCT A;  5LRS A;  1I5Z A;  3WTX C;  4ZDL A;  1KU2 A;  1OFC X;  4MFE A;  4RMN A;  5DS9 A;  3BG3 A;  5DD8 A;  3MKW B;  3ZQQ A;  4E7I A;  2W57 A;  5CQG A;  1O3T A;  1FX7 A;  1G4D A;  3IP4 B;  4XNF A;  3I71 A;  1YI2 I;  3DP7 A;  1IC8 A;  5DCM A;  1GLN A;  1TZL A;  4RM2 A;  2L3D A;  5EEA A;  3U3N C;  3GUD A;  4LLN A;  4OIP F;  4N9H A;  4XLP F;  3GXO A;  4BS9 A;  1SD6 A;  4GXO A;  2M8E A;  1D1B A;  4O6J A;  2LC2 A;  4A93 J;  1D0X A;  1VQL I;  1LUJ B;  3A02 A;  3QU3 A;  2P0W A;  3FK6 A;  1TWC J;  3BDD A;  4BXF A;  2BHY A;  3DLA A;  3OOP A;  1D1C A;  5FFZ A;  1WJB A;  5E3O A;  3HTU A;  2PBI A;  4HYE A;  1HW1 A;  2VQG A;  3LSJ A;  3GTQ J;  4X6A J;  2JSC A;  4LG0 B;  5CYV A;  1KU3 A;  3DCF A;  2HDW A;  3ERM A;  2DA4 A;  1BM9 A;  4UB6 C;  4D0P A;  1B1B A;  2XIG A;  2WY8 Q;  5CVV A;  4HPQ A;  5LFA A;  1IRZ A;  2PMZ N;  4BQA A;  2HQA A;  3VYU B;  1OMI A;  2LMD A;  2CWE A;  2WAQ N;  1J75 A;  2O8X A;  3ASO H;  2ETH A;  2NS0 A;  4WCG A;  5M3F J;  3OIP A;  1TWH J;  3PNY A;  5IP9 J;  4XN0 A;  1AKH B;  1Y8R B;  3WTU C;  2RV8 A;  4IVN A;  2BVM A;  4II3 A;  2V1N A;  3MZY A;  1RI7 A;  2FQ4 A;  2KZV A;  2JA7 J;  2L9R A;  2X1C A;  3RPQ A;  1B8I A;  1S6L A;  5ERI A;  2P81 A;  1XGO A;  3HM5 A;  2R7Z J;  2OPT A;  2IP2 A;  3G3Z A;  3LSI A;  5K5R A;  1JTY A;  4HQE A;  4QWQ A;  3CP8 A;  3HPH A;  4U88 A;  1DPU A;  2IXS A;  5FD6 A;  5L3F A;  4HDV A;  1J9I A;  3A01 B;  1U6G A;  4RAZ A;  1YHQ I;  2EZH A;  1ZQ3 P;  4DOZ A;  1AA7 A;  3EYY A;  4CYC B;  2MFZ A;  4E7Z A;  3CZ6 A;  4Y33 A;  1YYV A;  2E34 A;  4D1Q A;  2RRE A;  2OQG A;  3CF2 A;  3K10 A;  3FIS A;  3F21 A;  1JUP A;  2JJ7 A;  2ZNY A;  2P7V B;  3IC7 A;  4KNY A;  1IRG A;  5J8F A;  1S7E A;  4G6D A;  4JK1 X;  3OYK A;  1F5T A;  3HOU J;  4OU0 A;  3C2B A;  2GQQ A;  2EIN H;  3SHF A;  4AIJ A;  3LSG A;  3Q9S A;  1A6Q A;  1K4S A;  2R7D A;  3TOA A;  4RAF A;  2PX9 A;  2H8W A;  5AIQ A;  3OYE A;  3B6A A;  2QKL B;  3BTC A;  3G4S I;  1LFB A;  1F4K A;  3BOQ A;  1TWG J;  1ENH A;  1IUF A;  3WGI A;  4AD9 A;  1IG7 A;  4TV7 A;  5D5U B;  2XGE A;  1LDK B;  4CCJ A;  1RR8 C;  4B3A A;  1SMY F;  1LKX A;  4B1R A;  1KYZ A;  4B48 A;  4HA8 A;  3OYN A;  2YR2 A;  3JRA A;  2E19 A;  1ETV A;  4NB5 A;  2XF5 A;  4HW0 A;  3S16 J;  2VQH A;  2ZC2 A;  1UHS A;  4NQW A;  3EUH C;  2L54 A;  4A2U A;  3IHU A;  2Z3Y A;  2J5O A;  1KU7 A;  2IA0 A;  1U5T B;  2O7O A;  3G1L A;  1D8J A;  1YS7 A;  3BC8 A;  3ELK A;  5E18 F;  2BVL A;  3E6M A;  1P4X A;  5TIS C;  3CMA I;  4M6Y A;  3RIR A;  4EEF G;  1MMG A;  1XSD A;  1XSV A;  5CVR A;  1OYI A;  2L7F P;  2O6G E;  3UNG C;  3OYA A;  1T33 A;  4UVA A;  2DA5 A;  1LNW A;  4ON0 A;  5GP9 A;  1IGN A;  2D1V A;  4DIQ A;  1ZRF A;  4P5O A;  4WX9 A;  4HV6 A;  2O0Y A;  1GV5 A;  2R7F A;  3GO5 A;  5HDN A;  2X4H A;  2EBI A;  2E71 A;  3GVA A;  1UAA A;  1BA5 A;  1E2X A;  2CH0 A;  2FJ1 A;  5JLW A;  2EB7 A;  2K9M A;  3ZQI A;  2PJR B;  4CA0 A;  2R7Q A;  1YIO A;  2KLO A;  1JKR C;  1W36 C;  4ZZL A;  4OAY A;  4YII A;  4Q5S F;  3BG5 A;  3L7W A;  3OR1 C;  4S05 A;  1WSU A;  1R22 A;  2HZD A;  2CQK A;  1XDU A;  2WY7 Q;  3FXU A;  1F43 A;  1LFU P;  1XDS A;  2IA2 A;  2HOE A;  2C6Y A;  4BE2 A;  2QEX I;  3TED A;  5EEH A;  4PZJ A;  1QGP A;  5JHU A;  4M6X A;  2LLK A;  4OIO F;  2DTR A;  4KIF A;  2QLZ A;  1TQM A;  2ZJQ F;  2VKD A;  1L0O C;  4XRS A;  1T0F C;  3QAH A;  2KP6 A;  3WTS C;  3MFK A;  2XGC A;  3PUF A;  2V6E A;  1VTN C;  2G0E A;  2STW A;  4IFA A;  4ZDP A;  5ILU A;  3DKW A;  3S17 J;  3F8M A;  3K6G A;  3LFU A;  2YX4 A;  3HB9 A;  1O7F A;  3SJM A;  1Y8Q B;  5B66 C;  2WB1 A;  2R7R A;  2L7K A;  1V5G A;  5CPR B;  3HOZ J;  3F22 A;  2X1D A;  2ECB A;  2L2O A;  3S8P A;  3L2Q A;  2CYY A;  3IH2 A;  4M9X A;  2H27 A;  1DGR M;  5EG0 A;  1USS A;  5GTI C;  1YJN I;  2VKV A;  3ABM H;  3GYH X;  1IRX A;  5HS9 A;  2G7U A;  2ZXI A;  2JQ7 A;  2OU2 A;  2QQ9 A;  4EAT A;  3E3V A;  3QYB A;  3JRH A;  2R4G A;  3J7Z I;  4NUK A;  3JRD A;  2RGV A;  2L7Z A;  1VQ6 I;  1FWZ A;  3BTI A;  1ZG3 A;  1NHA A;  1X58 A;  1JT0 A;  2ZXH A;  3GTK J;  1XN7 A;  2HR3 A;  4M3D A;  3PIP F;  2ZJR F;  1HBX G;  2LP0 A;  3BZC A;  3ZMV A;  1O4X A;  3D0S A;  1IN8 A;  5KAF C;  3MCZ A;  4I98 B;  4UUS B;  2WWY A;  4E7L A;  4LK0 F;  2WC2 A;  3V7R A;  1QU3 A;  3JRG A;  1VQ4 I;  1EH6 A;  5IY5 H;  1PUF A;  3HG9 A;  1D0Z A;  4I99 C;  3Q2R A;  1UHM A;  3WTW C;  3ZOB A;  5E17 F;  5K1Y A;  2KDO A;  3G1M A;  5E1X A;  2DK8 A;  3R6S A;  2F4O B;  2DK5 A;  3ZRG A;  2Z2S B;  2HOT A;  5F1J A;  2L01 A;  3CUO A;  2Y30 A;  1ZAO A;  2OV7 A;  4ZTF A;  1YW7 A;  3FDY A;  2ELK A;  3HYI A;  4XRF A;  2IGK A;  1BIA A;  5FRN A;  1FP2 A;  3LA2 A;  3VDX A;  4C2M J;  4ESB A;  5HNH A;  3DKY A;  4EGZ A;  2FNA A;  4A0Z A;  5IOZ A;  3IUO A;  1U3E M;  2E60 A;  3HUG B;  1VQN I;  4XLN F;  2DFH A;  2VPR A;  2M8G X;  2NOG A;  5GAG J;  2QA4 I;  3TDZ C;  3GZ5 A;  2G9W A;  5E79 C;  1U0J A;  4MTD A;  4DYQ A;  1HA8 A;  1BIB A;  3U1K A;  2YPR A;  1V4R A;  2VI6 A;  1GV2 A;  1IN5 A;  3DEE A;  3M3Y J;  2M0M A;  4PFP A;  2CV2 A;  4LG0 A;  1FTZ A;  3HRU A;  1JXS A;  3HOS A;  2BW3 A;  1JKP C;  3E5U A;  4BY1 J;  1ZEL A;  4E7K A;  4QPO A;  3EYI A;  2AQE A;  1PP8 F;  1WCM J;  3RKY A;  1TLH B;  5LBQ A;  1W36 D;  3LAP A;  4MEY F;  1HKQ A;  4IEJ A;  5ICF A;  3OYC A;  2PMH A;  3H5R A;  1K78 B;  3HRM A;  2KIM A;  3CC7 I;  2CUF A;  2OCC H;  2XVC A;  4EJU A;  2GOX B;  2L9N A;  1AKH A;  1I39 A;  1FOW A;  1MSF C;  3W6V A;  5CVI A;  3H35 A;  5CLS A;  3F8C A;  1XS9 A;  2HZT A;  2XPV A;  5J1R A;  1FEX A;  4L5J A;  3FM5 A;  2QGU A;  2E2H J;  3J80 K;  3OL3 A;  2VPL A;  3GEZ A;  2QQ8 A;  1IUY A;  2XAG A;  3ECH A;  3A01 A;  4NC8 A;  2CGP A;  4IHS A;  3IRQ A;  1DU6 A;  3QOE A;  1JGS A;  3FXK A;  3TO6 A;  4LD5 A;  2DPD A;  3WE3 A;  2JRM A;  3QPH A;  3M4O J;  1PUE E;  2KRC A;  1RKT A;  5HDK A;  3ZN1 A;  3S2D J;  4B3X A;  1N77 A;  2CRG A;  4G8X A;  3NAU A;  5F0H A;  2P6S A;  3L1P A;  2XAH A;  5EZG A;  2MG4 A;  3I58 A;  4FIS A;  4DZJ A;  2CUZ A;  2W82 A;  2HVS A;  3OY9 A;  3RKW A;  2Y0S A;  5FD5 A;  4XRS G;  2KIQ A;  3GTJ J;  5FRM A;  5J1U A;  4NHJ A;  1Z3Y A;  2Z9O A;  4X1E A;  1L3L A;  3BR2 A;  2DT6 A;  4V2G A;  4ENN A;  1OR7 C;  4KMF A;  2VOP A;  2I10 A;  2XUB A;  3BPV A;  3U1D A;  2QKM B;  1AOY A;  1B72 A;  1BW5 A;  3EPZ A;  4Y52 J;  1WFX A;  3G71 I;  5HOD A;  5F6F A;  4AVZ A;  1ON2 A;  4FX0 A;  1WRJ A;  3S32 A;  4ETS A;  1KON A;  3E7L A;  4AVP A;  1ETY A;  1S7O A;  3DTK A;  3FBN B;  4FAS D;  1JGG A;  5LHI A;  3UR3 C;  3RKX A;  2EIK H;  3H36 A;  4OIN F;  5ICG A;  2JT1 A;  1U5T A;  4S0H B;  2DOA A;  1OJL A;  2X0L A;  2Z16 A;  3PSI A;  3CCV I;  1P92 A;  4YIR X;  1YE9 A;  2MLG A;  4AYB N;  4HX8 A;  2F6C A;  2Y75 A;  2BY1 A;  2WBM A;  3HIF A;  1WGX A;  4PGH A;  2RC4 A;  2R7T A;  2DDB A;  1OCZ H;  3OL4 A;  4BHP A;  3I55 I;  2BXY A;  2HOS A;  4KIG A;  4JX5 A;  5ICE A;  2LR8 A;  3VYR B;  3DEW A;  3GTM J;  2Z99 A;  1A31 A;  2XB0 X;  2AXT C;  3HRT A;  4EJW A;  3S1R J;  5FJ8 J;  3BJO A;  4Y13 A;  3WG7 H;  4X0G A;  3K9T A;  4F52 A;  4H4K C;  4EQQ A;  3VB2 A;  3WTY C;  4BNC A;  2Y69 H;  4IX7 A;  1J2X A;  2AXL A;  1EH7 A;  4RAG A;  3IH4 A;  3TBI A;  4EM1 A;  3HTS B;  2JMW A;  1PVE A;  4AIH A;  2PJR A;  1VQ8 I;  5ILS A;  5EYR A;  3A2K A;  2K5C A;  2DFF A;  2M4G A;  2TRT A;  5J40 A;  1W5S A;  1D5V A;  3ABK H;  1W1W E;  1QPM A;  5CVU A;  2MGQ A;  3CJQ B;  2XAU A;  5IP6 A;  1B9M A;  2GBY A;  1IO2 A;  3NQO A;  3H3U A;  2V1D A;  5CKT A;  4F92 B;  5E8G A;  1LVA A;  1CGP A;  2X85 A;  4A3F J;  5DEQ A;  2EZI A;  4QPQ A;  1MSE C;  3E5X A;  3TO7 A;  2UXX A;  2KPM A;  1GDT A;  2JVG A;  5DTD A;  2O61 A;  2FX0 A;  4XON A;  1V55 H;  2HTJ A;  2A61 A;  3IV5 A;  3PNT A;  4FTH A;  1XGN A;  3ZN0 A;  2M7A A;  1S8N A;  5B3S H;  3Q0V A;  3L09 A;  1OLT A;  1SFO J;  4BJ6 C;  4NUO A;  1FYL A;  2R7X A;  3BZK A;  1MBG A;  3MMY B;  1YS6 A;  1LVK A;  3GZ6 A;  1JUS A;  3D1N I;  1BI0 A;  3CCL I;  4XM3 A;  1LFP A;  3J7Y J;  4CO8 A;  1PP7 U;  1RR7 A;  2F5V A;  3B02 A;  3BQY A;  3OYJ A;  4MHG A;  4HV5 A;  4NUB A;  4KIT B;  3HDD A;  1R5I D;  4CH7 A;  1A6I A;  4A3L J;  1MGT A;  4EMS A;  2ME6 A;  2FOK A;  3W2W A;  1VQP I;  4C30 A;  3S1Q J;  5BNG A;  1IAW A;  1BI2 A;  1I6X A;  4N4N B;  4ESF A;  2ZO4 A;  4EV0 A;  5JLX A;  4I76 A;  2KKO A;  2OQR A;  3V7S A;  1HKT A;  2VKE A;  1H88 C;  3Q3S A;  4BGD A;  4G7Z F;  2QBY B;  1ZHF A;  3JRE A;  4Y3O A;  3KP5 A;  1Q1V A;  4ENM A;  2WV0 A;  2QZ8 A;  3KLO A;  4Y17 A;  3CC2 I;  1ETX A;  2ISY A;  2CV0 A;  3QYE A;  3JRC A;  1J0R A;  3IH3 A;  3KP4 A;  2K86 A;  1NG6 A;  4UUS A;  2DYS H;  4ZYA A;  2KDZ A;  4IPA A;  2XPU A;  1BBY A;  1S7A A;  2ZXW H;  4Q48 A;  3ZCO A;  3OIO A;  3I9V 2;  3A1Y A;  2UWM A;  2HU9 A;  1T95 A;  5JI6 A;  1X19 A;  2GIZ A;  2E2I J;  2HQR A;  1MMS A;  3MKY B;  5J3L A;  4L9V A;  3RQ4 A;  1U2W A;  2GOM A;  3SDB A;  2RVC A;  2COM A;  4E6K G;  4DBR A;  3AAF A;  1O3S A;  3CD6 I;  2V4J C;  2R7U A;  4XLE A;  2N8G A;  1FOX A;  4MIM A;  3CCJ I;  1ZAR A;  1CF7 A;  3QPL A;  4O5V A;  1RET A;  1E3H A;  3GLL A;  5IP7 J;  5LLQ A;  3CF5 F;  4EM0 B;  4KA4 A;  5J1Y A;  2IEK A;  1ULY A;  2DA3 A;  1R1T A;  4E7J A;  4RLF A;  1QNX A;  4V2F A;  1JKO C;  1OIS A;  2EFN A;  1MDM B;  3LQQ A;  3HUG A;  3G2B A;  3MVP A;  4EJO A;  3OS0 A;  3JSP A;  5DV5 A;  4PUS A;  3F6V A;  5HOO A;  4A3G J;  3DF8 A;  2HFH A;  3L2U A;  2D2W A;  2DI3 A;  3CJT B;  4BBS J;  3SEZ A;  2DOD A;  3WHB A;  5JHF A;  4AU7 A;  5TRD A;  4N0B A;  2JA2 A;  1E17 A;  1ETK A;  1P7J A;  2MA3 A;  4YIF A;  3LSM A;  4IQ4 A;  2Y31 A;  2MC3 A;  2JWT A;  4PGG A;  3GZN B;  1ZG1 A;  2IAI A;  1W5T A;  4C3J J;  3DWL E;  4WF2 A;  2CFX A;  3RZD J;  2K7L A;  1BR1 A;  5ICC A;  5F1R A;  4MFD A;  2EA4 A;  1O7L A;  5F0F A;  4XN3 A;  3V42 A;  2MSY A;  4M9S A;  1K78 A;  1BJZ A;  1MND A;  5K7F A;  1XB4 A;  1OCT C;  4A3D J;  3P9K A;  1MH4 A;  2QUF A;  2VBZ A;  2DJI A;  2NVU B;  3HJE A;  2BE5 F;  3BCA A;  1QZE A;  4Z2Y A;  3LSH A;  1XTA A;  3DKX A;  3G73 A;  4UVC A;  5M5X J;  3JTG A;  1X3Z B;  2MYS A;  1T08 B;  3ZR8 X;  2RAE A;  4A6D A;  2DQL A;  4Q47 A;  2STT A;  2DFE A;  2L9V A;  4EJT A;  2HOA A;  1O3R A;  2AO9 A;  1O3Q A;  4RLQ A;  3LQR A;  3N97 A;  1G3S A;  3HHG A;  4LIU A;  2HXO A;  2K3F A;  3BPX A;  2X6W A;  4NBQ A;  4PJ0 C;  4AIW A;  3GF2 A;  3GFI A;  1V3F A;  2CQQ A;  4JYK A;  4XSZ F;  3GTO J;  5B5E C;  1Z7L A;  1WI3 A;  2LNB A;  3H3Z A;  3D5S C;  3F23 A;  5HLH A;  4MNU A;  2L4A A;  3CME I;  1T6S A;  3PSF A;  5B1A H;  2R7W A;  1TC3 C;  5JVG F;  1K4T A;  4KN7 X;  3REO A;  1FBS A;  4LLG F;  3I5U A;  1F1Z A;  2EQR A;  1X1D A;  4M3B A;  1J09 A;  1S29 A;  4DYR A;  5JYS A;  1OCR H;  3JCU C;  3GME A;  3COA C;  5F0C A;  1K83 J;  2FMY A;  2LKX A;  2M1B A;  2F48 A;  4FE7 A;  3F8B A;  4U0Y A;  2BEO A;  5EF6 A;  1T38 A;  4CCM A;  2LOO A;  5BPI A;  4A3C J;  3QP6 A;  3ZQH A;  1IV6 A;  2RQP A;  3A0H C;  2DAO A;  2HGC A;  2KHM A;  4UUT A;  4UV9 A;  1FNN A;  1XGS A;  2BY3 A;  3HSF A;  4UV8 A;  1Z77 A;  3H5N A;  2IGM A;  4RB2 C;  4RBO A;  2OCE A;  4XL9 A;  2IW5 A;  4A6E A;  1O57 A;  2LD5 A;  5FLM J;  1VZ0 A;  3R0J A;  3ZQ7 A;  5IYC J;  1ZR4 A;  4F91 B;  2ZJP F;  2Q1Z B;  3AG1 H;  3ZQC A;  1U9O A;  5HLG A;  3H9Q A;  3O6B B;  1IN4 A;  1PJR A;  5E3L A;  1YQA A;  4BEH B;  4N9I A;  1I27 A;  1BN5 A;  3HKZ N;  5KNL A;  1W7P B;  4WK8 F;  3KP6 A;  1ZTR A;  2E36 A;  1LDJ A;  2ZME C;  1XPX A;  2KRH A;  1V5E A;  4D7M A;  1TNT A;  3MQ0 A;  2ZBK A;  2KRF A;  5FKK A;  3KP3 A;  2DT7 B;  3TP3 A;  3JTH A;  2ZCW A;  1XMX A;  2W24 A;  2X9D A;  3L00 A;  2FOW A;  1ZK8 A;  2PEX A;  3SZG A;  3M8E A;  3CCQ I;  1R4M B;  4P27 A;  3HRS A;  4LGW A;  3TMO A;  3RQI A;  3GTL J;  1LPQ A;  3TP0 A;  2CU7 A;  4GRI A;  4HST A;  1E3O C;  3CCM I;  1FC3 A;  2PMU A;  1FMW A;  2FQ3 A;  2VIX A;  4FQG A;  1RKW A;  5LEK A;  2B9S A;  3JRF A;  3FMR A;  2ME0 A;  3RYR A;  4LY5 A;  2VBY A;  2COB A;  3L9F A;  2PJP A;  4IRG A;  3D5R C;  1WPK A;  2QSF X;  1I6H J;  4U7B A;  1FPQ A;  3H9G A;  1FIP A;  2UV1 A;  3M1C A;  3HZJ A;  4XMY A;  3VFZ A;  1RC9 A;  4IZZ A;  3R60 A;  4DW6 A;  4KFC A;  2H1K A;  1IZ1 A;  1TWA J;  3P9I A;  1GHC A;  2KJC A;  3C3W A;  1T98 A;  2EZL A;  3ZQF A;  2XGX A;  1SAX A;  2LH9 A;  1YW8 A;  2NVX J;  3PFI A;  2RNJ A;  4H0E A;  2A5Y B;  1FY7 A;  5D5V B;  4HZF A;  5GPA A;  2X48 A;  3M8J A;  4A0Y A;  4JOM A;  3LSR A;  3ZMD A;  4HEA 2;  3BP8 A;  1JI8 A;  2V9V A;  3RZO J;  2J5P A;  1FBQ A;  3WTT C;  4JP0 A;  2K02 A;  1QA6 A;  5M5Y J;  3GTG J;  1BJA A;  2GXB A;  2KIF A;  3WU1 B;  3LST A;  3BLY A;  1IXS B;  1EV7 A;  3K4M A;  3JRI A;  3Q2U A;  5L3C A;  2FNP A;  1EF4 A;  3K4L A;  4BDZ A;  1TP4 A;  2MW8 A;  1REP C;  4BJT A;  4G2U A;  4XLF A;  4YEJ A;  1JHH A;  3C7J A;  4F3Q A;  1SD7 A;  1FYM A;  5FLX K;  1YTY A;  4HOB A;  3EUH A;  4TPV A;  2A6T A;  3HHH A;  2BBY A;  1WJE A;  3ZMZ A;  3V8L A;  2MC4 A;  2F2E A;  4HAM A;  4XQF A;  4RGU A;  3R4K A;  2CW0 F;  4YG2 F;  4OMY A;  5JVT A;  2EPF A;  4BY7 J;  3JW4 A;  4ZYG A;  2R7S A;  2WA0 A;  2QBY A;  3T5X A;  4M9Z A;  4HNT A;  1K61 A;  2M34 A;  2EJR A;  4OIR F;  5K7H A;  4BXX J;  2HTS A;  4CUG A;  4LFU A;  3I3L A;  2FD5 A;  4HSR A;  3F8N A;  2IBD A;  3ZQL A;  3CDI A;  5BQT A;  1VQ9 I;  3CJN A;  2Z5U A;  2A5W A;  4FX4 A;  3VPR A;  1UCR A;  2ZNZ A;  2YSR A;  4AWX B;  3DPT A;  3PQK A;  3J80 Z;  3GFM A;  1YRN B;  2WTE A;  2V9P A;  2EFP A;  2M4K A;  4BKX A;  4RGR A;  4A3E J;  1R36 A;  1YX5 A;  1X3U A;  1WJA A;  4NC6 A;  3B6C A;  2G7H A;  2W85 A;  2VQC A;  2FBK A;  4I0A A;  4OIQ F;  5GAD J;  2GA2 A;  2L9S A;  2NNY A;  5C44 J;  2IS6 A;  1FTT A;  1I1G A;  2Q2E B;  1R00 A;  4ABZ A;  4JQF A;  1W4M A;  1UFM A;  3DU5 A;  4DYC A;  4CYD A;  3BR1 A;  3M1E A;  2CFO A;  4I0B A;  4QSH A;  3K1N A;  4IHT A;  2X6O A;  4XIC A;  2XPW A;  1QHH D;  4LK1 F;  3I4N J;  1RUO A;  3N4M A;  2YUS A;  3GTP J;  1ETQ A;  3J81 K;  1OKR A;  5DYM A;  2IS2 A;  2YS9 A;  3BWG A;  4B09 A;  2XF6 A;  4L5I A;  4A12 A;  1T0F A;  1ZGA A;  5BS6 A;  1IDZ A;  3F9K A;  2CUJ A;  1X1C A;  2Y9Z A;  2CG4 A;  3PUB A;  4PSW A;  5AON A;  3JAM Z;  3M07 A;  1FSE A;  3NWT A;  5D5X B;  3DFG A;  1MBK A;  3K1M A;  2LY9 A;  3H0G J;  1ACI A;  1SAN A;  4HG2 A;  4G94 A;  1MH3 A;  1TTY A;  4PK4 A;  3HL2 A;  2JK3 A;  2VJ4 A;  4BHB A;  1MKM A;  5HLT A;  2GZW A;  4UHT A;  3FK7 A;  3LWF A;  3ZQG A;  2QF7 A;  1FP1 D;  2VLA A;  3BRO A;  1K6O A;  1HW2 A;  2JA8 J;  2XSJ C;  1WH7 A;  1X4P A;  1ZRD A;  2PLY A;  1XC5 A;  1D0Y A;  5C4X J;  3MD2 A;  3OYF A;  4LJZ F;  2V9K A;  4P9F A;  2DXI A;  3Q0U A;  2TDX A;  2K27 A;  5IYB J;  1G59 A;  1C0W A;  2O9L A;  2VXZ A;  1IJW C;  4L18 B;  1LJ9 A;  1LB2 A;  2P4W A;  1MD0 A;  2LKS A;  4IF4 A;  2OZU A;  1Z7U A;  4PJM A;  5JFR A;  1JTX A;  2KT0 A;  1N25 A;  3OOU A;  2LRE A;  4HF1 A;  1I50 J;  2ZJ2 A;  2Z33 A;  5FLV A;  5DCM B;  3KYC B;  3TDU C;  1MNM C;  2BGC A;  1H9G A;  3ECO A;  3WU2 C;  5JR3 A;  1U8B A;  2EIM H;  2NRA C;  2L5Q A;  3P7N A;  2VJI A;  4BL0 B;  2HPI A;  2LK2 A;  2HKX A;  2VB6 A;  2CMP A;  3CUQ C;  3GFJ A;  3IL2 A;  1JKQ C;  1ZRE A;  3KFW X;  2XAJ A;  4BAY A;  1B4A A;  4KDP A;  1KQ8 A;  2VXD A;  2A68 F;  2F5F A;  1YOV B;  3BG6 A;  5D6E A;  3WOD F;  4EJV A;  3DU6 A;  1YW9 A;  1HST A;  3K7A J;  1JHF A;  3AKZ A;  3KCC A;  5M5W J;  1FIA A;  3K69 A;  3K4J A;  1X1B A;  4C2U A;  4CYC A;  2M9H A;  1WHU A;  5M3M J;  4RGX A;  9ANT A;  1WJ5 A;  4CIC A;  2W4S A;  3Q0W A;  4L9J A;  5K5O A;  1MMA A;  2EA2 A;  2KIU A; 
#chains in the Genus database with same CATH homology
 4NUN A;  3MZ8 A;  4G2U A;  3S6V A;  2DDB A;  4LY5 A;  4NUI A;  5JYS A;  3U3U C;  3Q2R A;  1QNX A;  4TPV A;  1U53 A;  4IFA A;  2GIZ A;  2DDA A;  4NUK A;  3NT8 A;  4AIW A;  4NUO A;  2CQ7 A;  4P27 A;  1CFE A;  1SMB A;  1XX5 A;  2EPF A;  1RC9 A;  4H0A A;  3U3L C;  2A05 A;  5ETE A;  4D53 A;  1XTA A;  3U3N C;  2VZN A;  3S6U A;  3Q2U A;  3S6S A;  1WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...