2DDAA

Crystal structure of pseudechetoxin from pseudechis australis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
KNYQKEIVDKHNALRRSVKPTARNMLQMKWNSRAAQNAKRWANRCTFAHSPPNKRTVGKLRCGENIFMSSQPFPWSGVVQAWYDEIKNFVYGIGAKPPGSVIGHYTQVVWYKSYLIGCASAKCSSSKYLYVCQYCPAGNIRGSIATPYKSGPPCADCPSACVNKLCTNPCKRNNDFSNCKSLAKKSKCQTEWIKKKCPASCFCHNKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudechetoxin
publication title Structures of pseudechetoxin and pseudecin, two snake-venom cysteine-rich secretory proteins that target cyclic nucleotide-gated ion channels: implications for movement of the C-terminal cysteine-rich domain
pubmed doi rcsb
molecule tags Toxin
total genus 60
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 2ddaA02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 2ddaA01
4LY5A 3MZ8A 4NUIA 3S6VA 4H0AA 5ETEA 3NT8A 2VZNA 2A05A 3U3UC 5JYSA 2DDAA 1WVRA 4NUOA 1U53A 3Q2RA 1RC9A 1CFEA 3S6SA 2GIZA 1SMBA 4AIWA 2CQ7A 4TPVA 4D53A 4G2UA 1XX5A 4IFAA 4P27A 3S6UA 3Q2UA 3U3NC 4NUNA 1XTAA 4NUKA 2DDBA 2EPFA 3U3LC 1QNXA
chains in the Genus database with same CATH superfamily
3CF5F 5HODA 2MD5A 1Z7UA 1FBUA 4G7HF 5K5OA 5GPAA 5F6FA 3I9V2 3IUOA 5J3LA 1IF1A 2MLGA 3CCLI 2VBZA 1R49A 2O8XA 3HJEA 3S15J 1GDTA 4QIWN 1RC9A 1G3WA 4S04A 3S6SA 2DLLA 1Y0UA 5D6FA 3S14J 5K1YA 2IW5A 5D5XB 2DFIA 2V4JC 3MN2A 2NRAC 2JPCA 5E1WA 3LSPA 4M3BA 4CA0A 1S9HA 2BY3A 3H0GJ 3KEYA 2CW7A 3DXJF 4NUKA 1KQ8A 3CTAA 2P5KA 1YS7A 1B9MA 3BG3A 3IHUA 2E2IJ 2ID3A 3IWZA 4E7JA 2Y30A 2RAEA 3WTZA 3RI4A 3GF2A 3M7GA 1R1VA 3EDPA 1P4XA 2EFQA 4OAZA 1RESA 1X3UA 2OV7A 3TP3A 5GAGJ 3JRCA 3CCEI 4P96A 4U0WA 2EFOA 3OIPA 2XDVA 2LY1A 3MMYB 2Y9ZA 2ZMEB 3GO5A 1KYZA 5HVQC 5BMZA 2NVTJ 3V8KA 4MNUA 4H0AA 1ETOA 5AONA 4M72A 2W1OA 5IT9K 4HDVA 5FLVA 3W2AA 3GZ5A 3VYTB 2EIKH 3PUBA 3U1KA 4HPQA 1G2HA 5ERIA 1MMAA 2QZ8A 2KZGA 4WXHA 3D0SA 2R5YB 1E3OC 1I50J 2MH9A 1IO2A 4AU7A 1UHMA 3I55I 2WAQA 2F4IA 2L9SA 2WA0A 4I7HA 2VPLA 3GYHX 3L09A 1HC8A 4UB8C 1G6NA 3HYIA 4I2OA 4FE7A 4XLEA 2LD5A 5FLMJ 3CCRI 5JR3A 5LRRA 3CP2A 4IOCF 1MBFA 2RGVA 1USTA 5EZGA 5JLWA 1I3QJ 5LEKA 1Y1WJ 4UUSA 1W7PA 2X48A 1T8IA 1FIAA 2VE8A 3S1RJ 3KX2A 4KICA 1WFXA 4J19A 2NXNB 3K70D 1FTTA 2HGCA 1IXRC 1SC7A 4FCYA 2PG4A 4WK8F 2BVLA 3IH4A 4W97A 1HCRA 1K83J 5E18F 1FP1D 3BR0A 2F6CA 2JRMA 4ZDOA 5ICGA 5HDKA 2DDBA 1T08B 4RGRA 1S3JA 3P9IA 5HS7A 2DOEA 4XORA 2ELJA 5IYDJ 2X85A 3VFZA 3CJQB 3IAS2 1VI0A 3WGHA 3TEDA 2Z1DA 2PLYA 3FM5A 2XAUA 1R1TA 1ODDA 4RS8A 4KA4A 4BS9A 1DU0A 4PJMA 4A0YA 2K9MA 2VQHA 3K4CA 5EEGA 3SDBA 1VQOI 2KIQA 4Y17A 5EF6A 2BV6A 2PQ8A 2WY8Q 2HVQA 4Z2YA 2PMUA 2ZJ2A 3BJOA 1WI3A 3PO2J 4V2GA 2A68F 2PMHA 4GRIA 3OMYA 1X2MA 2FSWA 4XOTA 5EEAA 1QPMA 2QQ9A 3I3LA 3W6VA 2FNAA 2WB1A 4HNVA 1TC3C 3MQ0A 1D5VA 2V7FA 1D0YA 1X2NA 4P55A 1BI3A 3KP4A 4RAGA 2EV6A 2HNHA 1PUFA 5KNLA 1K61A 2KZVA 3FMQA 2R7FA 1T0FA 1TWFJ 1UG2A 5EEHA 3TO7A 2ECCA 1U5TB 1ITYA 3QYEA 2UXNA 1AU7A 3BG7A 3LFKA 2EV0A 1OPCA 4PSWA 3PNYA 3KP6A 4F52A 3DCFA 5GAEJ 3C2BA 3OOUA 3J7ZI 2DJNA 1ONVA 2IP2A 3RQIA 2Z33A 1ZGAA 2ME6A 4BEHA 1VTNC 3FXLA 2CFOA 2RREA 4IHSA 2BEOA 2RVCA 1IUYA 1MKMA 2RN7A 1KA8A 4D0PA 1WVRA 2W25A 4AYBA 1J7KA 2R7RA 3KP2A 4HW0A 3RKXA 2WC2A 1S5LC 1OR7A 2VJ5A 2STWA 2JA7J 1GLNA 2XF7A 1QVUA 2QBYB 4XKCA 2DU9A 3EPZA 1QNXA 4KT5C 4ZYAA 5BS6A 2QSFX 3O3KA 2M9HA 2P5LC 2A05A 5JFRA 3HM5A 3MWMA 2EZKA 4KITB 3K69A 3H3UA 4DJAA 3HPHA 3LA2A 1B8IB 1LE8B 3P7NA 4ON0A 2V9VA 2LF7A 4HX7A 1ZLKA 1IDYA 3X2QH 3JR9A 3Q0VA 2HZTA 2NOJB 4BAYA 4CO8A 4CCKA 2XVCA 1BW5A 1P9QC 1ENHA 4XICA 2KIFA 2RNGA 1ETVA 3HSRA 3R6SA 3S1MJ 4L5EA 2OUMA 2C6YA 2CGPA 1WCMJ 1MBKA 1BI1A 1Z05A 3DPLC 4BHCA 1YQAA 2XAGA 1VQ6I 1LNWA 1TTYA 1YFHA 3A01B 2H6CA 2XROA 1OCZH 5F1RA 2L9NA 4R1HA 1GV2A 2XGDA 3S1NJ 4AIWA 3S2HJ 1TT0A 2LY9A 5E3NA 1YRNB 4IXAA 2B7EA 1NH3A 4UVAA 4MIMA 1Y56A 1MBEA 2VJIA 1MH3A 4FTHA 1P4WA 5EGOA 3H5NA 2JWTA 3RPQA 2K9LA 5HDNA 2CV0A 3V42A 5ICEA 4DYRA 5ILUA 4AIKA 2ZKZA 4BKXA 1FYKA 3H92A 1XGNA 2R7VA 2DA7A 2DTZA 3WU0A 4A2UA 2IGNA 4RLFA 4BBRJ 2NVUB 4E7SA 4BBSJ 2L01A 3ABUA 1FBQA 1R4NB 1XGMA 1BC8C 2K85A 3ERMA 1Z7LA 2Y0SA 3IWFA 4HOBA 3F8NA 4G12A 1PP8F 1BBYA 2OA4A 1OCTC 5KCMA 1KU3A 1E3PA 4HV5A 1LPQA 4JBAA 4UVBA 2A61A 2XKOA 4GDFA 2EINH 3T8RA 5IP7J 3ZR8X 3E6CC 1BOAA 2P8TA 2IPQX 2LC2A 3U1DA 1KU2A 1JUMA 4WCGA 3OYEA 2GXGA 2VKVA 2F4MB 1YG2A 2DYRH 3ZOBA 3MKZA 4BQNA 3SJMA 4KN7X 5K5QA 1XDSA 1VQNI 1IDZA 4BE0A 2R7ZJ 1LEAA 2YU3A 4DGWB 2X51A 2OD5A 2OZ6A 2HDWA 2TCTA 1OJLA 3C2HA 2VODA 4X1EA 3RPUA 2IA0A 1YX5A 1SFUA 4FX0A 4Y52J 1YTYA 1GXQA 2Y0MA 1DDNA 1EJ9A 4LG3A 4LOCA 3DEUA 5J47A 1ZARA 2DW4A 2QQAA 2LSOA 4IRGA 4ITVA 3DQVC 2JN6A 4XRSG 1VQ5I 3WTUC 2ZNYA 2JVHA 4EJUA 5FKKA 4BGDA 2HZDA 1BIBA 2XRLA 5J4VA 2ISZA 2EA2A 3TW6A 1G59A 2OAZA 2XV4S 2QKLB 1X3ZB 1K79A 2OCCH 4JYKA 4UUTA 3HXLA 4I98B 3DFGA 3MKWB 3U3LC 4XN0A 4MEXF 2DCEA 1OCRH 4UHTA 2R7XA 3S93A 2DN0A 2QCOA 2IGMA 2CH0A 4BJ6C 4BQQA 1MJBA 4ZYDA 1LFBA 1QVTA 2M5WA 3KZYA 3U3UC 3BG5A 3K1PA 3GZNB 3KYCB 3FXRA 3CO7C 1E0EA 4AWXB 1T33A 2CQKA 3B73A 3H35A 2VBWA 1F1ZA 4PK4A 2IS1A 1LEBA 1IZ1A 1WGXA 1DP7P 3R61A 4DYCA 1JT0A 2CS3A 3QODA 4IX7A 1YIJI 4E7ZA 1LQ1A 1K78B 1F5TA 5H6RA 3VPRA 3HGYA 3PSFA 4UXNA 4X6AJ 1BI0A 1ZH5A 3S17J 4Y33A 5D5WB 5CKTA 2M87A 3GZ6A 3I4NJ 1XCBA 1HW1A 3OYCA 3VSKA 2VKDA 4EJVA 4P1WA 2X4HA 3C2GA 5D8KB 1IV8A 3GMEA 1QGPA 2QKMB 5L3GA 3CQZJ 3I58A 4CYDA 3I71A 3G4SI 3V7CA 2KRHA 2CQXA 3EUAA 3FM3A 3HPGA 5GTHC 5KHDA 2EIJH 4BDYA 5CJ9A 3GW2A 1O4XA 5F0HA 4Y13A 4ZYEA 2VC0A 2LLKA 2L54A 1FSHA 2A6TA 4GXOA 4HSTA 5BPDA 4D9JA 3KP5A 2L7FP 1ZAOA 2HVRA 3BTJA 4JK1X 2VT2A 2RV8A 1JXSA 4U7DA 3F8BA 1OYIA 5H20A 3A0HC 2STTA 5FLXK 1LVKA 1ZTRA 4Q47A 2Q2EA 2JA6J 3BQZA 2HQRA 5DTDA 4IRHA 4QWQA 3LA3A 1NG6A 4Y15A 2WAQN 4A93J 2CUFA 2BGCA 2LBFB 4YRVA 3H0DA 4LY5A 3R0AA 3VYSB 3GCMA 1WJCA 2O6GE 3EUHA 2R7TA 3Q5FA 5J1RA 3S3OA 3LQQA 1GHCA 5C44J 4JX4A 5FD5A 3FISA 3WTSC 2DPDA 2DO7A 1R6RA 4NBQA 1CF7B 2XKPA 4BY1J 4HZFA 3F22A 2PN6A 2GWRA 1OCCH 2M2EA 2R92J 1VQLI 3HUGA 1USSA 2OTJI 1S7OA 3CCVI 4ZJZA 4XKVA 2Q8KA 3O8HA 3KYLA 1YHQI 5HDGA 2JUCA 2L9RA 2P81A 4BE1A 3ISPA 3BG6A 1EH6A 3PFYA 1MD0A 3GTQJ 2YPRA 3FBNB 5FGMA 2FJ1A 4E4HA 2QUFA 4A0ZA 4CHUA 1RKTA 4F91B 3QP5A 3D5SC 4L18B 4BH9A 5IT3A 2ZFUA 3BCBA 5LFAA 5HOOA 1U8RA 1O57A 4M3FA 4A69C 2CUJA 2D2WA 3BP8A 3V7RA 2DK5A 2NAZA 2JT1A 3E5UA 3BY6A 5LGTA 4OIPF 2EFNA 3AG3H 1QZEA 3HKZN 4EGYA 3ASNH 3SFIA 2EWNA 1JKRC 2X6YA 1IN4A 4BXFA 3HDDA 1IRFA 3S1QJ 2GXAA 2AO9A 1JHFA 5GAHJ 4RDUA 4XLNF 4CZZA 2KPMA 1Z3XA 4F55A 2H1LA 1MW7A 4ZH4F 1YO5C 3HOXJ 3QPTA 1UHWA 2XF5A 2IAIA 4CCLA 4ESJA 5CPRB 1ZREA 1Z67A 5HLTA 1T38A 3CCMI 2R5ZB 1SVMA 1W0UA 3LFUA 4AM3A 2V6CA 1G3YA 3K1MA 3WE3A 2HR3A 3RQ4A 3GUDA 2VKHA 2NNNA 1ETYA 4CZCA 4CXFA 3AAFA 3CF2A 1LDKB 5F64A 1DUXC 5CVUA 4WX9A 2Y75A 1Z9CA 3A02A 1HKTA 3VDXA 1HKSA 3E6DA 3VWBA 3KP3A 1R00A 5B3SH 2JA8J 1EH7A 1Y0NA 3E5QA 1LFPA 3EYIA 4A3IJ 1PJRA 3PQJA 3Q3SA 4PZJA 1F43A 5KVRA 4XLCA 1MMGA 3DPTA 4A0XA 2HYFA 2EK5A 2R7OA 2NOGA 4BYYA 4LB5A 2BY1A 4A3GJ 2DA5A 3MVPA 4RM3A 4BU2A 5E3LA 3DTKA 5EYRA 2KFDA 4BUPA 3T8TA 4GYGA 3OR2C 3CP8A 2W24A 4HSRA 3BR5A 1H9TA 5DD4A 4E7IA 1T2KA 1KU9A 3TO6A 1ZR2A 1F4KA 4HQMA 2BYVE 3MKLA 1J75A 1T56A 3EUKL 4I76A 4IVNA 4IRIA 3R4KA 1XPXA 3AG4H 3LOCA 2GA2A 4HF0A 2F5VA 1KGSA 2X6OA 2KT0A 4ZYGA 4MQVA 2ZB9A 3E1SA 1X4OA 1H89C 2AXTC 4PFPA 3W2VA 3H9JA 2FQ4A 2DFEA 4C30A 2G7UA 3F8MA 4L9NA 3FDYA 2LY2A 2R7SA 5H6QA 3S3MA 4BNCA 2HI3A 3H3ZA 1QZYA 2W4SA 4Z6YA 3K4MA 2Y0SN 4PJ0C 3GVAA 1RI7A 2QA4I 3G6EI 1BJZA 3CCJI 4XOPA 1WQ2A 1KQ9A 2CWEA 3FKIJ 2EFWA 3C18A 9ANTA 1VQ9I 1D8KA 2R4GA 4RGUA 3TBIA 2EA4A 3WODF 2HPMA 4U7BA 3IP4B 3G71I 3L2CA 4KDPA 2DAOA 3FF5A 3JREA 4UUSB 2L7MP 1OMIA 3PIPF 3JRIA 3GLXA 4LGWA 1WJFA 1OYWA 1BC7C 1VQKI 3BR3A 4OIRF 1ULYA 1W0TA 1MBJA 3WE2A 1WHUA 3SZPA 3ULQB 4LJZF 4RAYA 3FHZA 1HF0A 5J1YA 2K40A 4KT6A 1MDMA 3IRRA 1Q1VA 3OYMA 5LLQA 1R7JA 3FXOA 3J7YJ 2EILH 3K1NA 1T6SA 3CMMA 4ZC3A 5FO5A 2NS8A 3SEZA 5IP9J 5AIPA 2WV1A 5CVRA 1ACIA 4M3GA 4DW6A 4UY8I 3G73A 2CQNA 4NB5A 3I59A 3IC7A 1U2WA 2DQRA 4LG0A 2M4KA 4LFUA 2O03A 3ZQQA 2DJIA 3JAMZ 1GVJA 1OLTA 3K2ZA 4OWRB 1IJWC 3L2RA 4UB6C 3Q0UA 4JQFA 3KEOA 1MNMC 2KIMA 5FB2A 5FFXA 1JT6A 5DDGA 2BHZA 5B1BH 4HF2A 3RKYA 1W36D 2JJ7A 2CYYA 2XAFA 2XPVA 5DS9A 2L2OA 1PUFB 3E5XA 1GXPA 1TWAJ 2FE3A 1EF4A 3SHFA 3VEPA 1TP4A 3ZP5A 2GIVA 1UZCA 1FBSA 1YOVB 4PDKA 2M0CA 4YFKF 1IXCA 1VQPI 2DOAA 1EV7A 2L02A 4NNJA 2AHQA 3Q9SA 1RIOH 2H6BA 2P0WA 4HNTA 2Y31A 2KL4A 1XSXA 2V79A 1N77A 2RDPA 1HXDA 2VJ4A 4BEHB 2MABA 5LGNA 1KQ0A 4HX4A 1YI2I 1P7JA 2BE5F 4ZDPA 3NWSA 1LDDA 2E19A 2VQCA 4NQWA 2DODA 3QYFA 1LB2A 1IGNA 3OYLA 4IOAF 3H5RA 3QWLA 4IL6C 2GXBA 1FMVA 1QHGA 4JP0A 3M8EA 1J5YA 4HX8A 5DCMA 3S16J 3LSGA 2L7ZA 1I1GA 4IQ4A 3S2WA 1Q1HA 2V1DA 1IW7F 3FXQA 3K10A 2DT5A 2K9NA 1JKOC 3B6AA 1V55H 3DEWA 3OSFA 5IOZA 1IN8A 2A6HF 1D1CA 2CSOA 4Y7NJ 2TDXA 2VOOA 2DTRA 1YIOA 4D5CA 2R7DA 4HBLA 4PGHA 4H0EA 4XSXF 2VL8A 4WXCA 4M73A 4MLOA 2WAFA 4G6QA 4D5FA 3LSRA 3F6OA 2PJRA 1VZ0A 2D45A 5M5WJ 3OV8A 3HRTA 2B63J 4A3JJ 3OWTA 1FOKA 1YJ9I 4KUMA 4YIIA 3H9GA 1RPWA 4J00A 1IV6A 3HEFA 2XAJA 3ZPLA 3CO6C 1TT5B 2PFBA 5F1JA 3L9FA 1O3RA 4FASD 4RGXA 5BPIA 4CCMA 5IOYA 3CESA 1QQIA 2YUSA 2CV1A 1BM9A 1MNDA 3LSMA 3O6BB 3BZCA 3CDLA 1X1DA 1ERDA 3MZHA 4O5VA 1I6HJ 5C4XJ 2LMDA 4LK1F 2AQFA 2X1EA 2CO5A 2CUZA 3E6BA 1ON1A 3CJNA 2K02A 4MFEA 4LIVA 1WZ2A 2F5FA 4BDZA 2ME0A 3DBRB 4IJAA 4EGZA 3J80Z 3PIOF 4V19K 2JVGA 2M8EA 3HL2A 5EGOB 3DBHB 2VBYA 2DYSH 4O3MA 1SD4A 2ISYA 5FROA 3PM1A 2VUMJ 1IN6A 2PMZN 3S6VA 3CCQI 2DI3A 2QF7A 4C9YA 2VKEA 3OS2A 3AFHA 4IPAA 1K7AA 2DBBA 2ZC2A 1R5HA 3FMRA 4U87A 3ABMH 1Y1VJ 2ADUA 2LH9A 2OQGA 3B6CA 3SDGA 2IT0A 5L3FA 3S2DJ 5EG0A 2UV1A 2AQEA 1AHDP 2COMA 2K3FA 5FKMA 2FXAA 4HG2A 4EM0B 1LKXA 3BZKA 1JGSA 3FBIB 5BNGA 1JJ8C 4M6XA 2V26A 3LMMA 5E1XA 3CC2I 2KDZA 3TKYA 3L2UA 3ECOA 2RQQA 3G1MA 4I01A 1KZHA 2PJPA 1IAWA 2DMNA 1AOYA 3HTSB 1TWGJ 4MQ9F 3O2PE 1BOBA 3H9QA 1A31A 2CW0F 1FC3A 3JTHA 2B9SA 3J7AY 4ESFA 2D1VA 2K4BA 3WU1B 5L3DA 4NDLA 3F3XA 4EJTA 4HAMA 1T98A 5FLXZ 2L7KA 4BXUA 4XL9A 1IRXA 2O3FA 2X1CA 2K86A 1QZZA 2XHKA 5FRMA 2K9QA 5ICCA 3H1CA 4Q4ZF 4IO9F 1TW2A 5LD2C 1B1BA 5EDNA 1HSJA 2QLZA 2FD5A 4D1QA 2TRTA 4A3LJ 3C3WA 2E1OA 2KHMA 3QU6A 4RBOA 3IKTA 2X9DA 1FOXA 5L3EA 3A1YA 1KONA 2KP6A 3KPHA 4EM1A 1QU3A 2ZNZA 2M45A 1ETWA 2IGKA 5E1ZB 2FBKA 2FRHA 4HLXA 3QYBA 4KMFA 3OIQA 3CCYA 4AD9A 3FXMA 1BL0A 2MGQA 3WTWC 1U0JA 1FYMA 3ZN1A 3OYIA 1OCPA 1MSEC 2Y48A 1ORKA 5FKOA 3E6MA 2H94A 2M4GA 2JSCA 2ZMEC 3VB2A 1YX3A 4HRIA 3AL0B 4BJTA 4RB1A 4JOMA 1S7EA 4E7KA 4C3IJ 1Z77A 4D7MA 5B66C 3JRGA 1UB9A 5H2FC 3BPVA 2J5PA 3OYBA 1C0WA 1QHHD 3LAPA 2QSHX 2L3DA 3VYUB 2HYGD 4E70A 3MAJA 3VSLA 1U9OA 1T95A 4ENNA 2CQQA 3I4PA 3BDDA 3ESWB 2HOTA 3LSTA 4ANJA 2BW3A 3L2QA 2XIGA 2K3PA 3TQNA 3BG9A 4UV8A 1J2XA 2JK3A 4I02A 4KIGA 5J40A 1RR7A 3SFZA 2F2EA 2QGUA 2GOXB 4YFNF 4L0ZB 2K27A 3QU3A 4ZTFA 1TQMA 3HIFA 4M3EA 2ELHA 5DD8A 1VQMI 3B02A 2JUGA 4MFDA 2CMPA 2Z3YA 1LJ9A 3FK7A 4LMYA 4LLGF 4XMYA 1YRNA 1SD5A 1B72A 1HKQA 2IGOA 4MGRA 3CUOA 1D3YA 4BQOA 1WH5A 4KMUX 1RR8C 5D6EA 2ZBKA 1W4MA 4GCVA 1Z6TA 4YIFA 2M1BA 2LK2A 1FNNA 2DA2A 2IJLA 2XB5A 3JRBA 2LP0A 4A3DJ 2HPIA 2OCEA 2YR2A 2Q2EB 4CYCA 2VOPA 1XGSA 1ZKGA 5IYBJ 2CU7A 3J81K 4F7ZA 3I56I 2O0YA 3WTTC 3CMAI 4G7ZF 4NUNA 2H8RA 3D1NI 1HQCA 3HOYJ 1GUUA 1O3SA 2ZXJA 2A69F 2M8GX 5DM6F 1RUOA 3WHCA 3I53A 3UR3C 2MC3A 4I09A 4DYQA 1RKWA 1Y6IA 5D8LB 4L9TA 3J7AO 3I54A 2P6TA 5IPAA 1V5GA 5F0CA 3TDUC 1TL8A 2UXXA 2ZSIB 1NTCA 5TGTA 4A5NA 3L2WA 4KISA 4CCJA 4II3A 3OSGA 1FTZA 2VJJA 1ZHFA 3D5LA 3NQOA 2M0MA 4LIUA 2LRDA 3DP7A 4FQGA 3GXOA 1U5TC 2A5WA 3HUGB 2EH3A 5JLXA 2QQ8A 4DIQA 5FD6A 1R5GA 5ETEA 3QAHA 1SANA 4A3BJ 3TP0A 2YU9J 5K7HA 4OIOF 1PDNC 1MJ9A 1DPUA 4C2TA 1AKHA 1JUSA 2E35A 3BR6A 2LKSA 1MZBA 3K6GA 3LSKA 4PJLA 4YFXF 1W7PD 3ASOH 3D5RC 3ZQFA 4P5OA 1MH4A 3FMSA 1JJ6C 3DU5A 3O8GA 2L0KA 1MNEA 4XNFA 2XF6A 3RYRA 2JTVA 4M9SA 3CUQA 1V5EA 2PEXA 1MBHA 2ZFWA 4GFBA 3IH2A 4R8HA 1MJAA 2BZTA 4RB0A 1F9NA 2D1HA 1ZG3A 2QENA 3WTVC 5C3EJ 4L5IA 2MFZA 4NC7A 5HS9A 2VONA 3ZGKA 3N05A 1U9NA 2W82A 1P4AA 3BTIA 4DZPA 4XLHA 3H36A 3ZMVA 4DNCA 3WTYC 1X1AA 3VODA 2P5VA 2E2HJ 4B44A 2FMYA 2KQRA 1XTAA 2KKOA 4C2MJ 2VQLA 1RNLA 3JRDA 5GP9A 1L0OC 2XASA 2DK8A 3AKZA 5F08A 3HHHA 2G7HA 2KRCA 2X6XA 1A5JA 1Z21A 4G7OF 3GFJA 1ZN2A 4HQEA 4A3KJ 1L3LA 1OISA 2ZSHB 1WI9A 1J59A 1D1AA 1YYVA 3ZQGA 1MIJA 1Z6RA 3SXYA 1UELB 4IHXA 4RMNA 3RKQA 1W5TA 2BVMA 3S6UA 2XGXA 2A6EF 4BACA 2M3AA 5C4JJ 3A2KA 2O5RA 4AUXA 2K4JA 5E8GA 1G3TA 3Q0WA 1W5SA 4MHGA 1AWCA 3HBLA 2WB1N 3PL8A 3F8FA 3HGGA 3PQKA 3FWEA 1I5ZA 1ZLJA 2CFXA 3RIRA 5IT9Z 3DEEA 2W7NA 1OCOH 4AIHA 1S8NA 4B43A 2FU4A 3TL4X 1PYVA 3DLAA 4I0AA 2IS2A 2DT6A 1G4DA 4XKBA 5K5RA 2JQ7A 1X1CA 1Y39A 4XM3A 4KYWA 3GTPJ 2NVXJ 4BE2A 3HRMA 1SEUA 2LF8A 1B6AA 3OYAA 1JKPC 1HW5A 2LOOA 4Y4RA 1EH8A 2NVYJ 4G6TB 1FLIA 5DM7F 4A5MA 1YW7A 3ZMZA 4J01A 2R93J 4Q5SF 3FXJA 1HDDC 4E6KG 4AYBN 5LRSA 3CC4I 4ABZA 4XN3A 2KJBA 1IRZA 2XSJC 3ML6A 3HSEA 1U8BA 4OIQF 2M34A 3BPXA 3GEZA 3I64A 1K6YA 2VB6A 2DT7B 2H1KA 1BR1A 2X6WA 1W36C 2Z9OA 2DFHA 3TOAA 4M3DA 2PX9A 3F21A 1EA3A 3OS0A 3H3VK 3G1OA 3HTUA 5E8IA 1UAAA 2HFHA 1YLFA 4XONA 3L2VA 1U3EM 4BJ5C 3DKYA 2FOKA 1W5CC 3QPLA 4AVZA 4L0YB 3DKWA 3IKVA 4FE4A 5GPCA 2BHYA 5FFZA 4UV9A 2HU9A 1G3SA 3CDHA 1XMXA 3K0LA 1GVDA 2R7WA 1JE8A 2NVQJ 2RKHA 4EV0A 2DOFA 5J1UA 3M1CA 3GTJJ 4IZZA 1H8AC 4OU0A 3REOA 2VXZA 1TWHJ 4MTEA 2UZKA 2A3SA 2OU2A 1R9TJ 3E7LA 5L3CA 2FBIA 1DGWY 3QP6A 4IEJA 4L5JA 1SD7A 2OBPA 2ESHA 3BWGA 3COAC 1IC8A 2ZXWH 3KLOA 4WF2A 2A5YB 3RJPA 2QM3A 3SQNA 3F9KA 4HDUA 2BXYA 2F5CA 3W6JB 5TJJA 5HLGA 1FIPA 3IH3A 3RKWA 1YS6A 3RTRA 2E7XA 3T0YA 1K4TA 3M3YJ 4R79A 5LHGA 1MDMB 1UFMA 1YITI 4L9VA 4M71A 1RUNA 2FOWA 4S0HB 2MLKA 2O7OA 4UUVA 2J5OA 3DU6A 3T5XA 2E1CA 5KK1A 3TDZC 1RRJA 1MGTA 5E79C 3JW4A 1A6QA 3OIOA 2V9KA 1MMSA 2QYOA 3I59B 2OC6A 3A0BC 3DTEA 3CCSI 2RC4A 1X58A 4IF4A 1FX7A 1X3WB 2IS4A 2XAHA 1WWXA 2HS5A 2LKPA 1O3QA 2HKOA 1ON2A 1FWZA 3PUFA 3W2WA 5GADJ 2I5UA 3JSPA 2DXIA 1BA5A 4DBQA 1SFEA 2M30A 1WJBA 1FMWA 3BQYA 3K7AJ 3P5JA 4LD5A 2K7LA 2W57A 2ZO4A 2DMQA 3RPUD 2P4WA 1W7PB 2BOLA 4LB6B 4NUBA 4NC8A 5K7FA 1XSVA 4CDGA 3GFIA 2VXDA 4B1RA 4A12A 1B9NA 3BR2A 1ZELA 1JTYA 4O6JA 2R0QC 4ENJA 2E5ZA 3CCUI 3M9AA 3T1BA 2XRNA 3QOEA 4BHPA 5M3FJ 2D5VA 2MH2A 1LVAA 2RNJA 4P9UA 4C3HJ 4NQWB 2Z99A 1SFOJ 1IG7A 3WU2C 3WG7H 1O3TA 1WJEA 1REPC 5DCMB 1D0ZA 4A3FJ 2I8DA 3Q2RA 1FY7A 3LSIA 5IP6A 3K4NA 4RB3C 1XMAA 1QPIA 3ZMDA 2XPUA 2PI0A 2FUG2 3HOUJ 3CLOA 2IXSA 5FRNA 4M74A 1W1WE 3G2BA 3WTXC 2HXOA 4KFCA 1XS9A 3IL2A 2DMPA 2L5QA 1D8JA 1D5YA 5DYMA 5A2QK 5D5VB 4HEA2 1ZGWA 1Z0XA 2MBFA 3BCAA 3CJRB 3HOTA 3KETA 2LTPA 5E20A 3I5UA 2PJRB 3WGGA 1KU7A 3M1EA 3V7SA 1K6OA 2X1DA 3DLLF 5B5EC 2GIZA 2P7CB 4A6EA 1ETKA 3P9CA 4CSWA 3S3NA 3FIWA 1ZRFA 3K4KA 2P6SA 1R5ID 1IUFA 3BJAA 1D0XA 4N0BA 2A07F 2QSGX 3FZVA 4XIDA 2XC7A 2IRFG 2VZNA 4A6DA 4HYEA 2YS9A 4A3MJ 1ETQA 2EZHA 1JGGA 4JX6A 2I10A 1TZLA 3DV8A 2ZJRF 3U9GA 1F36A 2ZCWA 3QOPA 1ZRDA 3E3VA 1ZG5A 3M4OJ 4OAYA 4BL0B 2HKXA 1SFXA 4W1UA 2V1XA 3AG1H 4G94A 4JX5A 4ESBA 4CGZA 5D4RA 5TISC 1N78A 2XUBA 2EJRA 1ZQ3P 4YELA 3EQLF 2ZMEA 5J8CA 1QNTA 1TQPA 3NAUA 3K4BA 2HOSA 3E0JB 3OYNA 2HQ5A 4IHTA 4P9FA 2F4OB 2GLOA 1WJAA 2JZYA 4KIBA 2CV2A 1G8XA 2KRFA 3F8CA 5ICFA 2EB7A 3CD6I 2E1MB 4F92B 2OQRA 1SD6A 3QQAA 4G8XA 5CQEA 2XPWA 4XKWA 1JTXA 3GTGJ 1TLHB 5EG0B 3FK6A 3OYJA 4D53A 4WWCA 3I4MJ 4ZZDA 2R5YA 5HNHA 3BOQA 3FHNA 1Z3YA 1WRJA 3KCCA 4EM2A 4G9YA 5E3MA 1JI8A 1I39A 5KAIC 2GAUA 3IV5A 3CLQA 3BZ6A 2WY7Q 3MZ8A 3LSJA 1YJNI 1OYYA 3HOSA 3ERED 1RZ4A 2LVSA 4CICA 5GTIC 3KFWX 1SMTA 3KLNA 1FJLA 2F5DA 4I0BA 3HKZA 2WWYA 2V6EA 4Y3OA 3BT9A 3QRFF 3DF8A 2EZIA 2GZWA 1FZPB 1BR2A 2CQ7A 4A3EJ 3JRAA 2FBHA 3PNTA 2XB0X 2OF7A 3U2RA 5F0FA 3J81Z 2EIMH 1R36A 4FHTA 1SAXA 5DEQA 1I3AA 1WKMA 4LLNA 3FXKA 5J6XA 1YE9A 4YEJA 4N9HA 3U21A 3SYTA 5E3OA 2LFBA 1UJ8A 3GX4X 4U0YA 3L1PA 1J09A 2VQGA 1SVLA 1SVOA 4RM2A 1Y8QB 5F04A 3F23A 1K4SA 2MD0A 3DPUA 1HW2A 5LBQA 4B47A 4N4NB 1FPQA 2WAEA 4NUOA 1Y8RB 1DQUA 3MD2A 4HLYA 3K9TA 1X19A 2EBIA 3WHBA 2VIXA 2E5NA 3SZGA 5J4YA 3N97A 1R71A 1NK2P 1HA8A 2HTJA 4P27A 4E7HA 3E97A 1S29A 4BQAA 2BY0A 1BN5A 3ZQ7A 4BY7J 4N9IA 3A4CA 2FQ3A 3HRSA 2Z5UA 2HQNA 2ZXHA 5M5YJ 4KNYA 2W85A 2AS5F 2LR8A 4PJNA 3Q9VA 1FEXA 4EJOA 1CQTA 3CJTB 5BQTA 3ZMSA 4ZZLA 2VE9A 2YSRA 2ZJPF 2L9VA 2VPRA 3MEXA 3OL4A 2JA5J 1ZR4A 2VBXA 1DPRA 1I1SA 4K2EA 1U5TA 3HRUA 3HOWJ 4QPQA 1JHHA 5JHUA 3TGNA 1NK3P 5EZHA 2NS0A 1BJAA 5EJCA 1VFCA 2IBDA 1UCRA 4XQFA 1D1BA 2BW3B 3GTMJ 2MC4A 2HDDA 1XD7A 4C2UA 1XN7A 1HOMA 1H9GA 1WJ5A 2N8GA 5CVIA 2E2JJ 4FETA 2IVMA 1MBGA 5DV5A 1GT0C 2IEKA 1ETXA 2DDAA 5AIQA 1U53A 4II2A 1ZK8A 4M9XA 3JAMK 4XRFA 5D5UB 1XB4A 3DKXA 5HNFA 4AVPA 2UUZA 1IN5A 1BIAA 1FOYA 1B72B 3L00A 1X4PA 3OOPA 1EKEA 2G0EA 3ONQA 2QBYA 1V5FA 4S05A 2RQPA 3OYDA 3ZQCA 2PBIA 4M6YA 3L7WA 2ICWG 4M6VA 2DA6A 5B1AH 3KYDB 3ECHA 3IRQA 4ENMA 5JYSA 2JMWA 2JSPA 1VNDA 1X1PA 2HQAA 3MZYA 1HSTA 5D4SA 2ESNA 4CYCB 5HS8A 4I6ZA 2MG4A 1B8IA 1LE8A 2Q1ZB 3ZCOA 1A04A 1SAUA 5IYCJ 2OTLI 2HVSA 1S6LA 1TNTA 4LK0F 4ZYHA 2XSDC 1BW6A 3OYGA 4PGGA 4B09A 2IA1A 3W3CA 2Y69H 3TW7A 1U78A 1APLC 3M8FA 5HLIA 2UWMA 2LNBA 4XBFA 3SZTA 4FISA 3NT8A 5KAFC 4F3QA 3JRHA 1XC5A 3F6VA 3KP7A 1SFKA 1E2XA 2F5EA 3OL3A 2FA5A 4RB2C 4U0VA 3A01A 2CRGA 4XLFA 4DQ2A 3G1LA 1S72I 1H0MA 4EATA 4XSZF 3HZJA 1P92A 1VQ8I 5CVJA 3RDIA 3RSNA 1T0FC 4B4CA 2GBYA 4B48A 3ABLH 3BROA 1ZG1A 3UKGA 4NHJA 1HDPA 4B3XA 2DPUA 3DBLB 3TOBA 1KYWA 1P7IA 1V4RA 6PAXA 3LNQA 2JA2A 1J9IA 2DQLA 1DP3A 1XGOA 5CVVA 2JPBA 2YX4A 2QEXI 2V1UA 1S7AA 2ID6A 3S8PA 2MSYA 4BXXJ 1CGPA 2K5CA 2E60A 2VT3A 4GGGA 3OR1C 1AKHB 2BBYA 2P7VB 4NC6A 3WGIA 1VQ7I 2ZXIA 2LREA 1QO0D 2KISA 4A3CJ 2ZJQF 1TW3A 1AA7A 1Z1DA 5JHFA 2O8KA 3GTOJ 3GBGA 2HWVA 4PFOA 1JKQC 3GTKJ 3C7JA 3HOZJ 1FOWA 1UMQA 4DZJA 1NG7A 1WH7A 1OR7C 2B0LA 2FMLA 3N4MA 1E3HA 1V54H 4GYIA 3RZDJ 2LDUA 3CUQB 3CDIA 4AIDA 2DFFA 1P6RA 4RGSA 5CLSA 5LEJA 4EEFG 2E71A 4FT8A 1U6GA 2CJJA 3SEQA 4F93B 4KIFA 2E1MC 3J80K 2O9LA 3MCZA 2KJCA 3UNGC 3ZQIA 1QA6A 1MMDA 1PVEA 2W48A 2HDCA 5FKLA 2NS7A 1M1EB 3P9KA 4HNUA 3HOVJ 3R0JA 3U3NC 2WADA 3HC7A 3HG9A 4QSHA 3F72A 3QPHA 2R7QA 1FP2A 2XAQA 2CW8A 2W84A 5BOXA 3V4GA 1OQYA 2MYSA 4AIJA 3OYKA 3DWLE 5F27A 4AC0A 1FSEA 3PNVA 2QWWA 3M8JA 4RLQA 2H27A 1CFEA 2ACJA 1A36A 2Q0OA 1SMYF 4XRMA 2OJED 1WSUA 3CMYA 4G2UA 2NYXA 4PUSA 2DA3A 4IKFA 4H4KC 2BXZA 4OINF 4EQQA 3V8JA 3BLYA 2L4MA 4OOIA 2HXIA 3CC7I 1OFCX 4NUIA 5J8FA 4EJWA 3FX3A 1FT9A 3C1DA 2AXLA 3K2AA 5K7ZA 3LA7A 4DBRA 3S32A 5L3BA 2E1NA 2GOMA 4XK4A 1OKRA 3I0TA 4RAFA 3WG9A 4CCOA 4XLAA 1LDJA 1TWCJ 2L4AA 5M3MJ 1QRYA 4DOZA 4KJZA 4WXDA 4C3JJ 3ZXSA 4PCQA 2E7WA 1WJDA 4PJJA 5ILVA 1K78A 2LKXA 3BC8A 2NNYA 3AG2H 2F48A 3MKYB 2HYJA 1YJWI 3FXUA 1TNSA 4PSXA 4RA2A 3KZZA 1V3FA 4Q48A 3LQRA 4ZDLA 5JI6A 2BY2A 1X1BA 3ZQLA 5HLHA 1A35A 2W00A 2VC1A 2FX0A 4X0GA 2KLOA 2QQBA 2WBMA 3OYFA 3NEUA 5DUKA 3JSOA 3TO9A 3HB9A 2IA2A 4CCNA 5DUIA 1IRGA 1XMKA 3ZMTA 3ELKA 1ZYRF 1I27A 4IHWA 3KIOA 4CH7A 4MEYF 1LUJB 2CUEA 2PMZA 5DCFA 2ELKA 3W6KB 2KMUA 2X0LA 2VASA 3DTIA 3ZRGA 2OZUA 3V8LA 4U88A 1STZA 3F0CA 2EZLA 1R58A 4N4OB 3ZQHA 4EVIA 2V9PA 1YW9A 4B8XA 3KE2A 1PP7U 3BTCA 1R23A 5TRDA 1N75A 1NHAA 4LITA 4EMSA 4TPVA 5FJ8J 2LG4A 2VI6A 1IXSB 4XLPF 4MTDA 1YW8A 2ECBA 3PFIA 3RYPA 5LHIA 1DU6A 2CG4A 2DMUA 2EFPA 2HOAA 2R3SA 3NRVA 4MO7A 4OMYA 4QPOA 4RAZA 4UVCA 5JVTA 2GQQA 2M7BA 1H88C 3TMOA 3OYHA 2LBFA 3HSFA 4HV6A 4IHYA 2HTSA 1R22A 1MMNA 3M07A 1ZRCA 5ED4A 4OMZA 1JUPA 1XDUA 1TBXA 5A2QZ 4YG2F 4QTRA 2FF4A 3PSIA 3LL7A 2JRTA 2VN2A 3R60A 4TV7A 3QPSA 3RCOA 2O61A 2E34A 2M7AA 3FKJA 2HEOA 3AL0C 2XGCA 3K4LA 1J0RA 1CF7A 1POGA 2Z2SB 3BR1A 1N25A 3IAM2 4ETSA 5JVGF 3EYYA 3PO3J 3LAJA 3K4JA 1R1UA 1P2FA 2Z16A 5CYVA 1R4MB 3Q2UA 3CMEI 2EPFA 1FYLA 3ABTA 2YX7A 2FEZA 2FNPA 3NWTA 4B3AA 2GM4A 1RETA 4FX4A 1BR4A 1ZGJA 4E7LA 2COBA 4HF1A 4XR6A 4M9ZA 3ROUA 3A03A 4KN4X 1WPKA 1XCVA 1B59A 2K9SA 3JTGA 1E17A 5CQGA 1O7FA 1IN7A 3HHGA 1O7LA 2VLAA 5ILSA 4QLCU 1QBJA 4D7NA 2GA1A 1DGRM 1BI2A 3GLLA 2Y9YA 3GTLJ 5LHHA 3BJ6A 4ZTJA 2H09A 1TQIA 1XG1A 4ENKA 1VQ4I 2ETHA 1UG0A 1VF9A 2LYCA 4XRSA 1HBXG 3VOEA 4ASNA 2MW8A 2V1NA 3KZIC 4L9JA 3K70C 2R7UA 1I6XA 3GFMA 1Z91A 2DMTA 2QVOA 3VYRB 5IY5H 2Y2ZA 3KEQA 4IHVA 3ZMUA 4YIRX 2E36A 5LGUA 3RZOJ 1XX5A 2WTEA 3OS1A 1LFUP 1PUEE 2OPTA 2G9WA 3LSHA 2HOEA 1HLVA 2XGEA 1XSDA 4GO1A 5E17F 2H8WA 3GWZA 4HA8A 4I99C 3ABKH 3CZ6A 5FKNA 1T39A 3BTLA 2EV5A 2EQRA 2DA1A 3CUQC 4V2FA 1A6IA 4LLLA 3LWFA 3JRFA 1B4AA 2R5ZA 1GV5A 3EUHC 4IQJA 3OY9A 4BHBA 4G6DA 5M5XJ 1MSFC 3EETA 2WV0A 3H5AA 1SMBA 4LG0B 2IS6A 2KDOA 4CUGA 3JCUC 1UHSA 4UNOA 2KIUA 4IFAA 3ZN0A 2MA3A 3MFKA 3G3ZA 3NARA 2DA4A 3PJRA 3GFLA
chains in the Genus database with same CATH topology
4LY5A 3MZ8A 4NUIA 3S6VA 4H0AA 5ETEA 3NT8A 2VZNA 2A05A 3U3UC 5JYSA 2DDAA 1WVRA 4NUOA 1U53A 3Q2RA 1RC9A 1CFEA 3S6SA 2GIZA 1SMBA 4AIWA 2CQ7A 4TPVA 4D53A 4G2UA 1XX5A 4IFAA 4P27A 3S6UA 3Q2UA 3U3NC 4NUNA 1XTAA 4NUKA 2DDBA 2EPFA 3U3LC 1QNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LY5 A;  3MZ8 A;  4NUI A;  3S6V A;  4H0A A;  5ETE A;  3NT8 A;  2VZN A;  2A05 A;  3U3U C;  5JYS A;  2DDA A;  1WVR A;  4NUO A;  1U53 A;  3Q2R A;  1RC9 A;  1CFE A;  3S6S A;  2GIZ A;  1SMB A;  4AIW A;  2CQ7 A;  4TPV A;  4D53 A;  4G2U A;  1XX5 A;  4IFA A;  4P27 A;  3S6U A;  3Q2U A;  3U3N C;  4NUN A;  1XTA A;  4NUK A;  2DDB A;  2EPF A;  3U3L C;  1QNX A; 
#chains in the Genus database with same CATH topology
 3CF5 F;  5HOD A;  2MD5 A;  1Z7U A;  1FBU A;  4G7H F;  5K5O A;  5GPA A;  5F6F A;  3I9V 2;  3IUO A;  5J3L A;  1IF1 A;  2MLG A;  3CCL I;  2VBZ A;  1R49 A;  2O8X A;  3HJE A;  3S15 J;  1GDT A;  4QIW N;  1RC9 A;  1G3W A;  4S04 A;  3S6S A;  2DLL A;  1Y0U A;  5D6F A;  3S14 J;  5K1Y A;  2IW5 A;  5D5X B;  2DFI A;  2V4J C;  3MN2 A;  2NRA C;  2JPC A;  5E1W A;  3LSP A;  4M3B A;  4CA0 A;  1S9H A;  2BY3 A;  3H0G J;  3KEY A;  2CW7 A;  3DXJ F;  4NUK A;  1KQ8 A;  3CTA A;  2P5K A;  1YS7 A;  1B9M A;  3BG3 A;  3IHU A;  2E2I J;  2ID3 A;  3IWZ A;  4E7J A;  2Y30 A;  2RAE A;  3WTZ A;  3RI4 A;  3GF2 A;  3M7G A;  1R1V A;  3EDP A;  1P4X A;  2EFQ A;  4OAZ A;  1RES A;  1X3U A;  2OV7 A;  3TP3 A;  5GAG J;  3JRC A;  3CCE I;  4P96 A;  4U0W A;  2EFO A;  3OIP A;  2XDV A;  2LY1 A;  3MMY B;  2Y9Z A;  2ZME B;  3GO5 A;  1KYZ A;  5HVQ C;  5BMZ A;  2NVT J;  3V8K A;  4MNU A;  4H0A A;  1ETO A;  5AON A;  4M72 A;  2W1O A;  5IT9 K;  4HDV A;  5FLV A;  3W2A A;  3GZ5 A;  3VYT B;  2EIK H;  3PUB A;  3U1K A;  4HPQ A;  1G2H A;  5ERI A;  1MMA A;  2QZ8 A;  2KZG A;  4WXH A;  3D0S A;  2R5Y B;  1E3O C;  1I50 J;  2MH9 A;  1IO2 A;  4AU7 A;  1UHM A;  3I55 I;  2WAQ A;  2F4I A;  2L9S A;  2WA0 A;  4I7H A;  2VPL A;  3GYH X;  3L09 A;  1HC8 A;  4UB8 C;  1G6N A;  3HYI A;  4I2O A;  4FE7 A;  4XLE A;  2LD5 A;  5FLM J;  3CCR I;  5JR3 A;  5LRR A;  3CP2 A;  4IOC F;  1MBF A;  2RGV A;  1UST A;  5EZG A;  5JLW A;  1I3Q J;  5LEK A;  1Y1W J;  4UUS A;  1W7P A;  2X48 A;  1T8I A;  1FIA A;  2VE8 A;  3S1R J;  3KX2 A;  4KIC A;  1WFX A;  4J19 A;  2NXN B;  3K70 D;  1FTT A;  2HGC A;  1IXR C;  1SC7 A;  4FCY A;  2PG4 A;  4WK8 F;  2BVL A;  3IH4 A;  4W97 A;  1HCR A;  1K83 J;  5E18 F;  1FP1 D;  3BR0 A;  2F6C A;  2JRM A;  4ZDO A;  5ICG A;  5HDK A;  2DDB A;  1T08 B;  4RGR A;  1S3J A;  3P9I A;  5HS7 A;  2DOE A;  4XOR A;  2ELJ A;  5IYD J;  2X85 A;  3VFZ A;  3CJQ B;  3IAS 2;  1VI0 A;  3WGH A;  3TED A;  2Z1D A;  2PLY A;  3FM5 A;  2XAU A;  1R1T A;  1ODD A;  4RS8 A;  4KA4 A;  4BS9 A;  1DU0 A;  4PJM A;  4A0Y A;  2K9M A;  2VQH A;  3K4C A;  5EEG A;  3SDB A;  1VQO I;  2KIQ A;  4Y17 A;  5EF6 A;  2BV6 A;  2PQ8 A;  2WY8 Q;  2HVQ A;  4Z2Y A;  2PMU A;  2ZJ2 A;  3BJO A;  1WI3 A;  3PO2 J;  4V2G A;  2A68 F;  2PMH A;  4GRI A;  3OMY A;  1X2M A;  2FSW A;  4XOT A;  5EEA A;  1QPM A;  2QQ9 A;  3I3L A;  3W6V A;  2FNA A;  2WB1 A;  4HNV A;  1TC3 C;  3MQ0 A;  1D5V A;  2V7F A;  1D0Y A;  1X2N A;  4P55 A;  1BI3 A;  3KP4 A;  4RAG A;  2EV6 A;  2HNH A;  1PUF A;  5KNL A;  1K61 A;  2KZV A;  3FMQ A;  2R7F A;  1T0F A;  1TWF J;  1UG2 A;  5EEH A;  3TO7 A;  2ECC A;  1U5T B;  1ITY A;  3QYE A;  2UXN A;  1AU7 A;  3BG7 A;  3LFK A;  2EV0 A;  1OPC A;  4PSW A;  3PNY A;  3KP6 A;  4F52 A;  3DCF A;  5GAE J;  3C2B A;  3OOU A;  3J7Z I;  2DJN A;  1ONV A;  2IP2 A;  3RQI A;  2Z33 A;  1ZGA A;  2ME6 A;  4BEH A;  1VTN C;  3FXL A;  2CFO A;  2RRE A;  4IHS A;  2BEO A;  2RVC A;  1IUY A;  1MKM A;  2RN7 A;  1KA8 A;  4D0P A;  1WVR A;  2W25 A;  4AYB A;  1J7K A;  2R7R A;  3KP2 A;  4HW0 A;  3RKX A;  2WC2 A;  1S5L C;  1OR7 A;  2VJ5 A;  2STW A;  2JA7 J;  1GLN A;  2XF7 A;  1QVU A;  2QBY B;  4XKC A;  2DU9 A;  3EPZ A;  1QNX A;  4KT5 C;  4ZYA A;  5BS6 A;  2QSF X;  3O3K A;  2M9H A;  2P5L C;  2A05 A;  5JFR A;  3HM5 A;  3MWM A;  2EZK A;  4KIT B;  3K69 A;  3H3U A;  4DJA A;  3HPH A;  3LA2 A;  1B8I B;  1LE8 B;  3P7N A;  4ON0 A;  2V9V A;  2LF7 A;  4HX7 A;  1ZLK A;  1IDY A;  3X2Q H;  3JR9 A;  3Q0V A;  2HZT A;  2NOJ B;  4BAY A;  4CO8 A;  4CCK A;  2XVC A;  1BW5 A;  1P9Q C;  1ENH A;  4XIC A;  2KIF A;  2RNG A;  1ETV A;  3HSR A;  3R6S A;  3S1M J;  4L5E A;  2OUM A;  2C6Y A;  2CGP A;  1WCM J;  1MBK A;  1BI1 A;  1Z05 A;  3DPL C;  4BHC A;  1YQA A;  2XAG A;  1VQ6 I;  1LNW A;  1TTY A;  1YFH A;  3A01 B;  2H6C A;  2XRO A;  1OCZ H;  5F1R A;  2L9N A;  4R1H A;  1GV2 A;  2XGD A;  3S1N J;  4AIW A;  3S2H J;  1TT0 A;  2LY9 A;  5E3N A;  1YRN B;  4IXA A;  2B7E A;  1NH3 A;  4UVA A;  4MIM A;  1Y56 A;  1MBE A;  2VJI A;  1MH3 A;  4FTH A;  1P4W A;  5EGO A;  3H5N A;  2JWT A;  3RPQ A;  2K9L A;  5HDN A;  2CV0 A;  3V42 A;  5ICE A;  4DYR A;  5ILU A;  4AIK A;  2ZKZ A;  4BKX A;  1FYK A;  3H92 A;  1XGN A;  2R7V A;  2DA7 A;  2DTZ A;  3WU0 A;  4A2U A;  2IGN A;  4RLF A;  4BBR J;  2NVU B;  4E7S A;  4BBS J;  2L01 A;  3ABU A;  1FBQ A;  1R4N B;  1XGM A;  1BC8 C;  2K85 A;  3ERM A;  1Z7L A;  2Y0S A;  3IWF A;  4HOB A;  3F8N A;  4G12 A;  1PP8 F;  1BBY A;  2OA4 A;  1OCT C;  5KCM A;  1KU3 A;  1E3P A;  4HV5 A;  1LPQ A;  4JBA A;  4UVB A;  2A61 A;  2XKO A;  4GDF A;  2EIN H;  3T8R A;  5IP7 J;  3ZR8 X;  3E6C C;  1BOA A;  2P8T A;  2IPQ X;  2LC2 A;  3U1D A;  1KU2 A;  1JUM A;  4WCG A;  3OYE A;  2GXG A;  2VKV A;  2F4M B;  1YG2 A;  2DYR H;  3ZOB A;  3MKZ A;  4BQN A;  3SJM A;  4KN7 X;  5K5Q A;  1XDS A;  1VQN I;  1IDZ A;  4BE0 A;  2R7Z J;  1LEA A;  2YU3 A;  4DGW B;  2X51 A;  2OD5 A;  2OZ6 A;  2HDW A;  2TCT A;  1OJL A;  3C2H A;  2VOD A;  4X1E A;  3RPU A;  2IA0 A;  1YX5 A;  1SFU A;  4FX0 A;  4Y52 J;  1YTY A;  1GXQ A;  2Y0M A;  1DDN A;  1EJ9 A;  4LG3 A;  4LOC A;  3DEU A;  5J47 A;  1ZAR A;  2DW4 A;  2QQA A;  2LSO A;  4IRG A;  4ITV A;  3DQV C;  2JN6 A;  4XRS G;  1VQ5 I;  3WTU C;  2ZNY A;  2JVH A;  4EJU A;  5FKK A;  4BGD A;  2HZD A;  1BIB A;  2XRL A;  5J4V A;  2ISZ A;  2EA2 A;  3TW6 A;  1G59 A;  2OAZ A;  2XV4 S;  2QKL B;  1X3Z B;  1K79 A;  2OCC H;  4JYK A;  4UUT A;  3HXL A;  4I98 B;  3DFG A;  3MKW B;  3U3L C;  4XN0 A;  4MEX F;  2DCE A;  1OCR H;  4UHT A;  2R7X A;  3S93 A;  2DN0 A;  2QCO A;  2IGM A;  2CH0 A;  4BJ6 C;  4BQQ A;  1MJB A;  4ZYD A;  1LFB A;  1QVT A;  2M5W A;  3KZY A;  3U3U C;  3BG5 A;  3K1P A;  3GZN B;  3KYC B;  3FXR A;  3CO7 C;  1E0E A;  4AWX B;  1T33 A;  2CQK A;  3B73 A;  3H35 A;  2VBW A;  1F1Z A;  4PK4 A;  2IS1 A;  1LEB A;  1IZ1 A;  1WGX A;  1DP7 P;  3R61 A;  4DYC A;  1JT0 A;  2CS3 A;  3QOD A;  4IX7 A;  1YIJ I;  4E7Z A;  1LQ1 A;  1K78 B;  1F5T A;  5H6R A;  3VPR A;  3HGY A;  3PSF A;  4UXN A;  4X6A J;  1BI0 A;  1ZH5 A;  3S17 J;  4Y33 A;  5D5W B;  5CKT A;  2M87 A;  3GZ6 A;  3I4N J;  1XCB A;  1HW1 A;  3OYC A;  3VSK A;  2VKD A;  4EJV A;  4P1W A;  2X4H A;  3C2G A;  5D8K B;  1IV8 A;  3GME A;  1QGP A;  2QKM B;  5L3G A;  3CQZ J;  3I58 A;  4CYD A;  3I71 A;  3G4S I;  3V7C A;  2KRH A;  2CQX A;  3EUA A;  3FM3 A;  3HPG A;  5GTH C;  5KHD A;  2EIJ H;  4BDY A;  5CJ9 A;  3GW2 A;  1O4X A;  5F0H A;  4Y13 A;  4ZYE A;  2VC0 A;  2LLK A;  2L54 A;  1FSH A;  2A6T A;  4GXO A;  4HST A;  5BPD A;  4D9J A;  3KP5 A;  2L7F P;  1ZAO A;  2HVR A;  3BTJ A;  4JK1 X;  2VT2 A;  2RV8 A;  1JXS A;  4U7D A;  3F8B A;  1OYI A;  5H20 A;  3A0H C;  2STT A;  5FLX K;  1LVK A;  1ZTR A;  4Q47 A;  2Q2E A;  2JA6 J;  3BQZ A;  2HQR A;  5DTD A;  4IRH A;  4QWQ A;  3LA3 A;  1NG6 A;  4Y15 A;  2WAQ N;  4A93 J;  2CUF A;  2BGC A;  2LBF B;  4YRV A;  3H0D A;  4LY5 A;  3R0A A;  3VYS B;  3GCM A;  1WJC A;  2O6G E;  3EUH A;  2R7T A;  3Q5F A;  5J1R A;  3S3O A;  3LQQ A;  1GHC A;  5C44 J;  4JX4 A;  5FD5 A;  3FIS A;  3WTS C;  2DPD A;  2DO7 A;  1R6R A;  4NBQ A;  1CF7 B;  2XKP A;  4BY1 J;  4HZF A;  3F22 A;  2PN6 A;  2GWR A;  1OCC H;  2M2E A;  2R92 J;  1VQL I;  3HUG A;  1USS A;  2OTJ I;  1S7O A;  3CCV I;  4ZJZ A;  4XKV A;  2Q8K A;  3O8H A;  3KYL A;  1YHQ I;  5HDG A;  2JUC A;  2L9R A;  2P81 A;  4BE1 A;  3ISP A;  3BG6 A;  1EH6 A;  3PFY A;  1MD0 A;  3GTQ J;  2YPR A;  3FBN B;  5FGM A;  2FJ1 A;  4E4H A;  2QUF A;  4A0Z A;  4CHU A;  1RKT A;  4F91 B;  3QP5 A;  3D5S C;  4L18 B;  4BH9 A;  5IT3 A;  2ZFU A;  3BCB A;  5LFA A;  5HOO A;  1U8R A;  1O57 A;  4M3F A;  4A69 C;  2CUJ A;  2D2W A;  3BP8 A;  3V7R A;  2DK5 A;  2NAZ A;  2JT1 A;  3E5U A;  3BY6 A;  5LGT A;  4OIP F;  2EFN A;  3AG3 H;  1QZE A;  3HKZ N;  4EGY A;  3ASN H;  3SFI A;  2EWN A;  1JKR C;  2X6Y A;  1IN4 A;  4BXF A;  3HDD A;  1IRF A;  3S1Q J;  2GXA A;  2AO9 A;  1JHF A;  5GAH J;  4RDU A;  4XLN F;  4CZZ A;  2KPM A;  1Z3X A;  4F55 A;  2H1L A;  1MW7 A;  4ZH4 F;  1YO5 C;  3HOX J;  3QPT A;  1UHW A;  2XF5 A;  2IAI A;  4CCL A;  4ESJ A;  5CPR B;  1ZRE A;  1Z67 A;  5HLT A;  1T38 A;  3CCM I;  2R5Z B;  1SVM A;  1W0U A;  3LFU A;  4AM3 A;  2V6C A;  1G3Y A;  3K1M A;  3WE3 A;  2HR3 A;  3RQ4 A;  3GUD A;  2VKH A;  2NNN A;  1ETY A;  4CZC A;  4CXF A;  3AAF A;  3CF2 A;  1LDK B;  5F64 A;  1DUX C;  5CVU A;  4WX9 A;  2Y75 A;  1Z9C A;  3A02 A;  1HKT A;  3VDX A;  1HKS A;  3E6D A;  3VWB A;  3KP3 A;  1R00 A;  5B3S H;  2JA8 J;  1EH7 A;  1Y0N A;  3E5Q A;  1LFP A;  3EYI A;  4A3I J;  1PJR A;  3PQJ A;  3Q3S A;  4PZJ A;  1F43 A;  5KVR A;  4XLC A;  1MMG A;  3DPT A;  4A0X A;  2HYF A;  2EK5 A;  2R7O A;  2NOG A;  4BYY A;  4LB5 A;  2BY1 A;  4A3G J;  2DA5 A;  3MVP A;  4RM3 A;  4BU2 A;  5E3L A;  3DTK A;  5EYR A;  2KFD A;  4BUP A;  3T8T A;  4GYG A;  3OR2 C;  3CP8 A;  2W24 A;  4HSR A;  3BR5 A;  1H9T A;  5DD4 A;  4E7I A;  1T2K A;  1KU9 A;  3TO6 A;  1ZR2 A;  1F4K A;  4HQM A;  2BYV E;  3MKL A;  1J75 A;  1T56 A;  3EUK L;  4I76 A;  4IVN A;  4IRI A;  3R4K A;  1XPX A;  3AG4 H;  3LOC A;  2GA2 A;  4HF0 A;  2F5V A;  1KGS A;  2X6O A;  2KT0 A;  4ZYG A;  4MQV A;  2ZB9 A;  3E1S A;  1X4O A;  1H89 C;  2AXT C;  4PFP A;  3W2V A;  3H9J A;  2FQ4 A;  2DFE A;  4C30 A;  2G7U A;  3F8M A;  4L9N A;  3FDY A;  2LY2 A;  2R7S A;  5H6Q A;  3S3M A;  4BNC A;  2HI3 A;  3H3Z A;  1QZY A;  2W4S A;  4Z6Y A;  3K4M A;  2Y0S N;  4PJ0 C;  3GVA A;  1RI7 A;  2QA4 I;  3G6E I;  1BJZ A;  3CCJ I;  4XOP A;  1WQ2 A;  1KQ9 A;  2CWE A;  3FKI J;  2EFW A;  3C18 A;  9ANT A;  1VQ9 I;  1D8K A;  2R4G A;  4RGU A;  3TBI A;  2EA4 A;  3WOD F;  2HPM A;  4U7B A;  3IP4 B;  3G71 I;  3L2C A;  4KDP A;  2DAO A;  3FF5 A;  3JRE A;  4UUS B;  2L7M P;  1OMI A;  3PIP F;  3JRI A;  3GLX A;  4LGW A;  1WJF A;  1OYW A;  1BC7 C;  1VQK I;  3BR3 A;  4OIR F;  1ULY A;  1W0T A;  1MBJ A;  3WE2 A;  1WHU A;  3SZP A;  3ULQ B;  4LJZ F;  4RAY A;  3FHZ A;  1HF0 A;  5J1Y A;  2K40 A;  4KT6 A;  1MDM A;  3IRR A;  1Q1V A;  3OYM A;  5LLQ A;  1R7J A;  3FXO A;  3J7Y J;  2EIL H;  3K1N A;  1T6S A;  3CMM A;  4ZC3 A;  5FO5 A;  2NS8 A;  3SEZ A;  5IP9 J;  5AIP A;  2WV1 A;  5CVR A;  1ACI A;  4M3G A;  4DW6 A;  4UY8 I;  3G73 A;  2CQN A;  4NB5 A;  3I59 A;  3IC7 A;  1U2W A;  2DQR A;  4LG0 A;  2M4K A;  4LFU A;  2O03 A;  3ZQQ A;  2DJI A;  3JAM Z;  1GVJ A;  1OLT A;  3K2Z A;  4OWR B;  1IJW C;  3L2R A;  4UB6 C;  3Q0U A;  4JQF A;  3KEO A;  1MNM C;  2KIM A;  5FB2 A;  5FFX A;  1JT6 A;  5DDG A;  2BHZ A;  5B1B H;  4HF2 A;  3RKY A;  1W36 D;  2JJ7 A;  2CYY A;  2XAF A;  2XPV A;  5DS9 A;  2L2O A;  1PUF B;  3E5X A;  1GXP A;  1TWA J;  2FE3 A;  1EF4 A;  3SHF A;  3VEP A;  1TP4 A;  3ZP5 A;  2GIV A;  1UZC A;  1FBS A;  1YOV B;  4PDK A;  2M0C A;  4YFK F;  1IXC A;  1VQP I;  2DOA A;  1EV7 A;  2L02 A;  4NNJ A;  2AHQ A;  3Q9S A;  1RIO H;  2H6B A;  2P0W A;  4HNT A;  2Y31 A;  2KL4 A;  1XSX A;  2V79 A;  1N77 A;  2RDP A;  1HXD A;  2VJ4 A;  4BEH B;  2MAB A;  5LGN A;  1KQ0 A;  4HX4 A;  1YI2 I;  1P7J A;  2BE5 F;  4ZDP A;  3NWS A;  1LDD A;  2E19 A;  2VQC A;  4NQW A;  2DOD A;  3QYF A;  1LB2 A;  1IGN A;  3OYL A;  4IOA F;  3H5R A;  3QWL A;  4IL6 C;  2GXB A;  1FMV A;  1QHG A;  4JP0 A;  3M8E A;  1J5Y A;  4HX8 A;  5DCM A;  3S16 J;  3LSG A;  2L7Z A;  1I1G A;  4IQ4 A;  3S2W A;  1Q1H A;  2V1D A;  1IW7 F;  3FXQ A;  3K10 A;  2DT5 A;  2K9N A;  1JKO C;  3B6A A;  1V55 H;  3DEW A;  3OSF A;  5IOZ A;  1IN8 A;  2A6H F;  1D1C A;  2CSO A;  4Y7N J;  2TDX A;  2VOO A;  2DTR A;  1YIO A;  4D5C A;  2R7D A;  4HBL A;  4PGH A;  4H0E A;  4XSX F;  2VL8 A;  4WXC A;  4M73 A;  4MLO A;  2WAF A;  4G6Q A;  4D5F A;  3LSR A;  3F6O A;  2PJR A;  1VZ0 A;  2D45 A;  5M5W J;  3OV8 A;  3HRT A;  2B63 J;  4A3J J;  3OWT A;  1FOK A;  1YJ9 I;  4KUM A;  4YII A;  3H9G A;  1RPW A;  4J00 A;  1IV6 A;  3HEF A;  2XAJ A;  3ZPL A;  3CO6 C;  1TT5 B;  2PFB A;  5F1J A;  3L9F A;  1O3R A;  4FAS D;  4RGX A;  5BPI A;  4CCM A;  5IOY A;  3CES A;  1QQI A;  2YUS A;  2CV1 A;  1BM9 A;  1MND A;  3LSM A;  3O6B B;  3BZC A;  3CDL A;  1X1D A;  1ERD A;  3MZH A;  4O5V A;  1I6H J;  5C4X J;  2LMD A;  4LK1 F;  2AQF A;  2X1E A;  2CO5 A;  2CUZ A;  3E6B A;  1ON1 A;  3CJN A;  2K02 A;  4MFE A;  4LIV A;  1WZ2 A;  2F5F A;  4BDZ A;  2ME0 A;  3DBR B;  4IJA A;  4EGZ A;  3J80 Z;  3PIO F;  4V19 K;  2JVG A;  2M8E A;  3HL2 A;  5EGO B;  3DBH B;  2VBY A;  2DYS H;  4O3M A;  1SD4 A;  2ISY A;  5FRO A;  3PM1 A;  2VUM J;  1IN6 A;  2PMZ N;  3S6V A;  3CCQ I;  2DI3 A;  2QF7 A;  4C9Y A;  2VKE A;  3OS2 A;  3AFH A;  4IPA A;  1K7A A;  2DBB A;  2ZC2 A;  1R5H A;  3FMR A;  4U87 A;  3ABM H;  1Y1V J;  2ADU A;  2LH9 A;  2OQG A;  3B6C A;  3SDG A;  2IT0 A;  5L3F A;  3S2D J;  5EG0 A;  2UV1 A;  2AQE A;  1AHD P;  2COM A;  2K3F A;  5FKM A;  2FXA A;  4HG2 A;  4EM0 B;  1LKX A;  3BZK A;  1JGS A;  3FBI B;  5BNG A;  1JJ8 C;  4M6X A;  2V26 A;  3LMM A;  5E1X A;  3CC2 I;  2KDZ A;  3TKY A;  3L2U A;  3ECO A;  2RQQ A;  3G1M A;  4I01 A;  1KZH A;  2PJP A;  1IAW A;  2DMN A;  1AOY A;  3HTS B;  1TWG J;  4MQ9 F;  3O2P E;  1BOB A;  3H9Q A;  1A31 A;  2CW0 F;  1FC3 A;  3JTH A;  2B9S A;  3J7A Y;  4ESF A;  2D1V A;  2K4B A;  3WU1 B;  5L3D A;  4NDL A;  3F3X A;  4EJT A;  4HAM A;  1T98 A;  5FLX Z;  2L7K A;  4BXU A;  4XL9 A;  1IRX A;  2O3F A;  2X1C A;  2K86 A;  1QZZ A;  2XHK A;  5FRM A;  2K9Q A;  5ICC A;  3H1C A;  4Q4Z F;  4IO9 F;  1TW2 A;  5LD2 C;  1B1B A;  5EDN A;  1HSJ A;  2QLZ A;  2FD5 A;  4D1Q A;  2TRT A;  4A3L J;  3C3W A;  2E1O A;  2KHM A;  3QU6 A;  4RBO A;  3IKT A;  2X9D A;  1FOX A;  5L3E A;  3A1Y A;  1KON A;  2KP6 A;  3KPH A;  4EM1 A;  1QU3 A;  2ZNZ A;  2M45 A;  1ETW A;  2IGK A;  5E1Z B;  2FBK A;  2FRH A;  4HLX A;  3QYB A;  4KMF A;  3OIQ A;  3CCY A;  4AD9 A;  3FXM A;  1BL0 A;  2MGQ A;  3WTW C;  1U0J A;  1FYM A;  3ZN1 A;  3OYI A;  1OCP A;  1MSE C;  2Y48 A;  1ORK A;  5FKO A;  3E6M A;  2H94 A;  2M4G A;  2JSC A;  2ZME C;  3VB2 A;  1YX3 A;  4HRI A;  3AL0 B;  4BJT A;  4RB1 A;  4JOM A;  1S7E A;  4E7K A;  4C3I J;  1Z77 A;  4D7M A;  5B66 C;  3JRG A;  1UB9 A;  5H2F C;  3BPV A;  2J5P A;  3OYB A;  1C0W A;  1QHH D;  3LAP A;  2QSH X;  2L3D A;  3VYU B;  2HYG D;  4E70 A;  3MAJ A;  3VSL A;  1U9O A;  1T95 A;  4ENN A;  2CQQ A;  3I4P A;  3BDD A;  3ESW B;  2HOT A;  3LST A;  4ANJ A;  2BW3 A;  3L2Q A;  2XIG A;  2K3P A;  3TQN A;  3BG9 A;  4UV8 A;  1J2X A;  2JK3 A;  4I02 A;  4KIG A;  5J40 A;  1RR7 A;  3SFZ A;  2F2E A;  2QGU A;  2GOX B;  4YFN F;  4L0Z B;  2K27 A;  3QU3 A;  4ZTF A;  1TQM A;  3HIF A;  4M3E A;  2ELH A;  5DD8 A;  1VQM I;  3B02 A;  2JUG A;  4MFD A;  2CMP A;  2Z3Y A;  1LJ9 A;  3FK7 A;  4LMY A;  4LLG F;  4XMY A;  1YRN A;  1SD5 A;  1B72 A;  1HKQ A;  2IGO A;  4MGR A;  3CUO A;  1D3Y A;  4BQO A;  1WH5 A;  4KMU X;  1RR8 C;  5D6E A;  2ZBK A;  1W4M A;  4GCV A;  1Z6T A;  4YIF A;  2M1B A;  2LK2 A;  1FNN A;  2DA2 A;  2IJL A;  2XB5 A;  3JRB A;  2LP0 A;  4A3D J;  2HPI A;  2OCE A;  2YR2 A;  2Q2E B;  4CYC A;  2VOP A;  1XGS A;  1ZKG A;  5IYB J;  2CU7 A;  3J81 K;  4F7Z A;  3I56 I;  2O0Y A;  3WTT C;  3CMA I;  4G7Z F;  4NUN A;  2H8R A;  3D1N I;  1HQC A;  3HOY J;  1GUU A;  1O3S A;  2ZXJ A;  2A69 F;  2M8G X;  5DM6 F;  1RUO A;  3WHC A;  3I53 A;  3UR3 C;  2MC3 A;  4I09 A;  4DYQ A;  1RKW A;  1Y6I A;  5D8L B;  4L9T A;  3J7A O;  3I54 A;  2P6T A;  5IPA A;  1V5G A;  5F0C A;  3TDU C;  1TL8 A;  2UXX A;  2ZSI B;  1NTC A;  5TGT A;  4A5N A;  3L2W A;  4KIS A;  4CCJ A;  4II3 A;  3OSG A;  1FTZ A;  2VJJ A;  1ZHF A;  3D5L A;  3NQO A;  2M0M A;  4LIU A;  2LRD A;  3DP7 A;  4FQG A;  3GXO A;  1U5T C;  2A5W A;  3HUG B;  2EH3 A;  5JLX A;  2QQ8 A;  4DIQ A;  5FD6 A;  1R5G A;  5ETE A;  3QAH A;  1SAN A;  4A3B J;  3TP0 A;  2YU9 J;  5K7H A;  4OIO F;  1PDN C;  1MJ9 A;  1DPU A;  4C2T A;  1AKH A;  1JUS A;  2E35 A;  3BR6 A;  2LKS A;  1MZB A;  3K6G A;  3LSK A;  4PJL A;  4YFX F;  1W7P D;  3ASO H;  3D5R C;  3ZQF A;  4P5O A;  1MH4 A;  3FMS A;  1JJ6 C;  3DU5 A;  3O8G A;  2L0K A;  1MNE A;  4XNF A;  2XF6 A;  3RYR A;  2JTV A;  4M9S A;  3CUQ A;  1V5E A;  2PEX A;  1MBH A;  2ZFW A;  4GFB A;  3IH2 A;  4R8H A;  1MJA A;  2BZT A;  4RB0 A;  1F9N A;  2D1H A;  1ZG3 A;  2QEN A;  3WTV C;  5C3E J;  4L5I A;  2MFZ A;  4NC7 A;  5HS9 A;  2VON A;  3ZGK A;  3N05 A;  1U9N A;  2W82 A;  1P4A A;  3BTI A;  4DZP A;  4XLH A;  3H36 A;  3ZMV A;  4DNC A;  3WTY C;  1X1A A;  3VOD A;  2P5V A;  2E2H J;  4B44 A;  2FMY A;  2KQR A;  1XTA A;  2KKO A;  4C2M J;  2VQL A;  1RNL A;  3JRD A;  5GP9 A;  1L0O C;  2XAS A;  2DK8 A;  3AKZ A;  5F08 A;  3HHH A;  2G7H A;  2KRC A;  2X6X A;  1A5J A;  1Z21 A;  4G7O F;  3GFJ A;  1ZN2 A;  4HQE A;  4A3K J;  1L3L A;  1OIS A;  2ZSH B;  1WI9 A;  1J59 A;  1D1A A;  1YYV A;  3ZQG A;  1MIJ A;  1Z6R A;  3SXY A;  1UEL B;  4IHX A;  4RMN A;  3RKQ A;  1W5T A;  2BVM A;  3S6U A;  2XGX A;  2A6E F;  4BAC A;  2M3A A;  5C4J J;  3A2K A;  2O5R A;  4AUX A;  2K4J A;  5E8G A;  1G3T A;  3Q0W A;  1W5S A;  4MHG A;  1AWC A;  3HBL A;  2WB1 N;  3PL8 A;  3F8F A;  3HGG A;  3PQK A;  3FWE A;  1I5Z A;  1ZLJ A;  2CFX A;  3RIR A;  5IT9 Z;  3DEE A;  2W7N A;  1OCO H;  4AIH A;  1S8N A;  4B43 A;  2FU4 A;  3TL4 X;  1PYV A;  3DLA A;  4I0A A;  2IS2 A;  2DT6 A;  1G4D A;  4XKB A;  5K5R A;  2JQ7 A;  1X1C A;  1Y39 A;  4XM3 A;  4KYW A;  3GTP J;  2NVX J;  4BE2 A;  3HRM A;  1SEU A;  2LF8 A;  1B6A A;  3OYA A;  1JKP C;  1HW5 A;  2LOO A;  4Y4R A;  1EH8 A;  2NVY J;  4G6T B;  1FLI A;  5DM7 F;  4A5M A;  1YW7 A;  3ZMZ A;  4J01 A;  2R93 J;  4Q5S F;  3FXJ A;  1HDD C;  4E6K G;  4AYB N;  5LRS A;  3CC4 I;  4ABZ A;  4XN3 A;  2KJB A;  1IRZ A;  2XSJ C;  3ML6 A;  3HSE A;  1U8B A;  4OIQ F;  2M34 A;  3BPX A;  3GEZ A;  3I64 A;  1K6Y A;  2VB6 A;  2DT7 B;  2H1K A;  1BR1 A;  2X6W A;  1W36 C;  2Z9O A;  2DFH A;  3TOA A;  4M3D A;  2PX9 A;  3F21 A;  1EA3 A;  3OS0 A;  3H3V K;  3G1O A;  3HTU A;  5E8I A;  1UAA A;  2HFH A;  1YLF A;  4XON A;  3L2V A;  1U3E M;  4BJ5 C;  3DKY A;  2FOK A;  1W5C C;  3QPL A;  4AVZ A;  4L0Y B;  3DKW A;  3IKV A;  4FE4 A;  5GPC A;  2BHY A;  5FFZ A;  4UV9 A;  2HU9 A;  1G3S A;  3CDH A;  1XMX A;  3K0L A;  1GVD A;  2R7W A;  1JE8 A;  2NVQ J;  2RKH A;  4EV0 A;  2DOF A;  5J1U A;  3M1C A;  3GTJ J;  4IZZ A;  1H8A C;  4OU0 A;  3REO A;  2VXZ A;  1TWH J;  4MTE A;  2UZK A;  2A3S A;  2OU2 A;  1R9T J;  3E7L A;  5L3C A;  2FBI A;  1DGW Y;  3QP6 A;  4IEJ A;  4L5J A;  1SD7 A;  2OBP A;  2ESH A;  3BWG A;  3COA C;  1IC8 A;  2ZXW H;  3KLO A;  4WF2 A;  2A5Y B;  3RJP A;  2QM3 A;  3SQN A;  3F9K A;  4HDU A;  2BXY A;  2F5C A;  3W6J B;  5TJJ A;  5HLG A;  1FIP A;  3IH3 A;  3RKW A;  1YS6 A;  3RTR A;  2E7X A;  3T0Y A;  1K4T A;  3M3Y J;  4R79 A;  5LHG A;  1MDM B;  1UFM A;  1YIT I;  4L9V A;  4M71 A;  1RUN A;  2FOW A;  4S0H B;  2MLK A;  2O7O A;  4UUV A;  2J5O A;  3DU6 A;  3T5X A;  2E1C A;  5KK1 A;  3TDZ C;  1RRJ A;  1MGT A;  5E79 C;  3JW4 A;  1A6Q A;  3OIO A;  2V9K A;  1MMS A;  2QYO A;  3I59 B;  2OC6 A;  3A0B C;  3DTE A;  3CCS I;  2RC4 A;  1X58 A;  4IF4 A;  1FX7 A;  1X3W B;  2IS4 A;  2XAH A;  1WWX A;  2HS5 A;  2LKP A;  1O3Q A;  2HKO A;  1ON2 A;  1FWZ A;  3PUF A;  3W2W A;  5GAD J;  2I5U A;  3JSP A;  2DXI A;  1BA5 A;  4DBQ A;  1SFE A;  2M30 A;  1WJB A;  1FMW A;  3BQY A;  3K7A J;  3P5J A;  4LD5 A;  2K7L A;  2W57 A;  2ZO4 A;  2DMQ A;  3RPU D;  2P4W A;  1W7P B;  2BOL A;  4LB6 B;  4NUB A;  4NC8 A;  5K7F A;  1XSV A;  4CDG A;  3GFI A;  2VXD A;  4B1R A;  4A12 A;  1B9N A;  3BR2 A;  1ZEL A;  1JTY A;  4O6J A;  2R0Q C;  4ENJ A;  2E5Z A;  3CCU I;  3M9A A;  3T1B A;  2XRN A;  3QOE A;  4BHP A;  5M3F J;  2D5V A;  2MH2 A;  1LVA A;  2RNJ A;  4P9U A;  4C3H J;  4NQW B;  2Z99 A;  1SFO J;  1IG7 A;  3WU2 C;  3WG7 H;  1O3T A;  1WJE A;  1REP C;  5DCM B;  1D0Z A;  4A3F J;  2I8D A;  3Q2R A;  1FY7 A;  3LSI A;  5IP6 A;  3K4N A;  4RB3 C;  1XMA A;  1QPI A;  3ZMD A;  2XPU A;  2PI0 A;  2FUG 2;  3HOU J;  3CLO A;  2IXS A;  5FRN A;  4M74 A;  1W1W E;  3G2B A;  3WTX C;  2HXO A;  4KFC A;  1XS9 A;  3IL2 A;  2DMP A;  2L5Q A;  1D8J A;  1D5Y A;  5DYM A;  5A2Q K;  5D5V B;  4HEA 2;  1ZGW A;  1Z0X A;  2MBF A;  3BCA A;  3CJR B;  3HOT A;  3KET A;  2LTP A;  5E20 A;  3I5U A;  2PJR B;  3WGG A;  1KU7 A;  3M1E A;  3V7S A;  1K6O A;  2X1D A;  3DLL F;  5B5E C;  2GIZ A;  2P7C B;  4A6E A;  1ETK A;  3P9C A;  4CSW A;  3S3N A;  3FIW A;  1ZRF A;  3K4K A;  2P6S A;  1R5I D;  1IUF A;  3BJA A;  1D0X A;  4N0B A;  2A07 F;  2QSG X;  3FZV A;  4XID A;  2XC7 A;  2IRF G;  2VZN A;  4A6D A;  4HYE A;  2YS9 A;  4A3M J;  1ETQ A;  2EZH A;  1JGG A;  4JX6 A;  2I10 A;  1TZL A;  3DV8 A;  2ZJR F;  3U9G A;  1F36 A;  2ZCW A;  3QOP A;  1ZRD A;  3E3V A;  1ZG5 A;  3M4O J;  4OAY A;  4BL0 B;  2HKX A;  1SFX A;  4W1U A;  2V1X A;  3AG1 H;  4G94 A;  4JX5 A;  4ESB A;  4CGZ A;  5D4R A;  5TIS C;  1N78 A;  2XUB A;  2EJR A;  1ZQ3 P;  4YEL A;  3EQL F;  2ZME A;  5J8C A;  1QNT A;  1TQP A;  3NAU A;  3K4B A;  2HOS A;  3E0J B;  3OYN A;  2HQ5 A;  4IHT A;  4P9F A;  2F4O B;  2GLO A;  1WJA A;  2JZY A;  4KIB A;  2CV2 A;  1G8X A;  2KRF A;  3F8C A;  5ICF A;  2EB7 A;  3CD6 I;  2E1M B;  4F92 B;  2OQR A;  1SD6 A;  3QQA A;  4G8X A;  5CQE A;  2XPW A;  4XKW A;  1JTX A;  3GTG J;  1TLH B;  5EG0 B;  3FK6 A;  3OYJ A;  4D53 A;  4WWC A;  3I4M J;  4ZZD A;  2R5Y A;  5HNH A;  3BOQ A;  3FHN A;  1Z3Y A;  1WRJ A;  3KCC A;  4EM2 A;  4G9Y A;  5E3M A;  1JI8 A;  1I39 A;  5KAI C;  2GAU A;  3IV5 A;  3CLQ A;  3BZ6 A;  2WY7 Q;  3MZ8 A;  3LSJ A;  1YJN I;  1OYY A;  3HOS A;  3ERE D;  1RZ4 A;  2LVS A;  4CIC A;  5GTI C;  3KFW X;  1SMT A;  3KLN A;  1FJL A;  2F5D A;  4I0B A;  3HKZ A;  2WWY A;  2V6E A;  4Y3O A;  3BT9 A;  3QRF F;  3DF8 A;  2EZI A;  2GZW A;  1FZP B;  1BR2 A;  2CQ7 A;  4A3E J;  3JRA A;  2FBH A;  3PNT A;  2XB0 X;  2OF7 A;  3U2R A;  5F0F A;  3J81 Z;  2EIM H;  1R36 A;  4FHT A;  1SAX A;  5DEQ A;  1I3A A;  1WKM A;  4LLN A;  3FXK A;  5J6X A;  1YE9 A;  4YEJ A;  4N9H A;  3U21 A;  3SYT A;  5E3O A;  2LFB A;  1UJ8 A;  3GX4 X;  4U0Y A;  3L1P A;  1J09 A;  2VQG A;  1SVL A;  1SVO A;  4RM2 A;  1Y8Q B;  5F04 A;  3F23 A;  1K4S A;  2MD0 A;  3DPU A;  1HW2 A;  5LBQ A;  4B47 A;  4N4N B;  1FPQ A;  2WAE A;  4NUO A;  1Y8R B;  1DQU A;  3MD2 A;  4HLY A;  3K9T A;  1X19 A;  2EBI A;  3WHB A;  2VIX A;  2E5N A;  3SZG A;  5J4Y A;  3N97 A;  1R71 A;  1NK2 P;  1HA8 A;  2HTJ A;  4P27 A;  4E7H A;  3E97 A;  1S29 A;  4BQA A;  2BY0 A;  1BN5 A;  3ZQ7 A;  4BY7 J;  4N9I A;  3A4C A;  2FQ3 A;  3HRS A;  2Z5U A;  2HQN A;  2ZXH A;  5M5Y J;  4KNY A;  2W85 A;  2AS5 F;  2LR8 A;  4PJN A;  3Q9V A;  1FEX A;  4EJO A;  1CQT A;  3CJT B;  5BQT A;  3ZMS A;  4ZZL A;  2VE9 A;  2YSR A;  2ZJP F;  2L9V A;  2VPR A;  3MEX A;  3OL4 A;  2JA5 J;  1ZR4 A;  2VBX A;  1DPR A;  1I1S A;  4K2E A;  1U5T A;  3HRU A;  3HOW J;  4QPQ A;  1JHH A;  5JHU A;  3TGN A;  1NK3 P;  5EZH A;  2NS0 A;  1BJA A;  5EJC A;  1VFC A;  2IBD A;  1UCR A;  4XQF A;  1D1B A;  2BW3 B;  3GTM J;  2MC4 A;  2HDD A;  1XD7 A;  4C2U A;  1XN7 A;  1HOM A;  1H9G A;  1WJ5 A;  2N8G A;  5CVI A;  2E2J J;  4FET A;  2IVM A;  1MBG A;  5DV5 A;  1GT0 C;  2IEK A;  1ETX A;  2DDA A;  5AIQ A;  1U53 A;  4II2 A;  1ZK8 A;  4M9X A;  3JAM K;  4XRF A;  5D5U B;  1XB4 A;  3DKX A;  5HNF A;  4AVP A;  2UUZ A;  1IN5 A;  1BIA A;  1FOY A;  1B72 B;  3L00 A;  1X4P A;  3OOP A;  1EKE A;  2G0E A;  3ONQ A;  2QBY A;  1V5F A;  4S05 A;  2RQP A;  3OYD A;  3ZQC A;  2PBI A;  4M6Y A;  3L7W A;  2ICW G;  4M6V A;  2DA6 A;  5B1A H;  3KYD B;  3ECH A;  3IRQ A;  4ENM A;  5JYS A;  2JMW A;  2JSP A;  1VND A;  1X1P A;  2HQA A;  3MZY A;  1HST A;  5D4S A;  2ESN A;  4CYC B;  5HS8 A;  4I6Z A;  2MG4 A;  1B8I A;  1LE8 A;  2Q1Z B;  3ZCO A;  1A04 A;  1SAU A;  5IYC J;  2OTL I;  2HVS A;  1S6L A;  1TNT A;  4LK0 F;  4ZYH A;  2XSD C;  1BW6 A;  3OYG A;  4PGG A;  4B09 A;  2IA1 A;  3W3C A;  2Y69 H;  3TW7 A;  1U78 A;  1APL C;  3M8F A;  5HLI A;  2UWM A;  2LNB A;  4XBF A;  3SZT A;  4FIS A;  3NT8 A;  5KAF C;  4F3Q A;  3JRH A;  1XC5 A;  3F6V A;  3KP7 A;  1SFK A;  1E2X A;  2F5E A;  3OL3 A;  2FA5 A;  4RB2 C;  4U0V A;  3A01 A;  2CRG A;  4XLF A;  4DQ2 A;  3G1L A;  1S72 I;  1H0M A;  4EAT A;  4XSZ F;  3HZJ A;  1P92 A;  1VQ8 I;  5CVJ A;  3RDI A;  3RSN A;  1T0F C;  4B4C A;  2GBY A;  4B48 A;  3ABL H;  3BRO A;  1ZG1 A;  3UKG A;  4NHJ A;  1HDP A;  4B3X A;  2DPU A;  3DBL B;  3TOB A;  1KYW A;  1P7I A;  1V4R A;  6PAX A;  3LNQ A;  2JA2 A;  1J9I A;  2DQL A;  1DP3 A;  1XGO A;  5CVV A;  2JPB A;  2YX4 A;  2QEX I;  2V1U A;  1S7A A;  2ID6 A;  3S8P A;  2MSY A;  4BXX J;  1CGP A;  2K5C A;  2E60 A;  2VT3 A;  4GGG A;  3OR1 C;  1AKH B;  2BBY A;  2P7V B;  4NC6 A;  3WGI A;  1VQ7 I;  2ZXI A;  2LRE A;  1QO0 D;  2KIS A;  4A3C J;  2ZJQ F;  1TW3 A;  1AA7 A;  1Z1D A;  5JHF A;  2O8K A;  3GTO J;  3GBG A;  2HWV A;  4PFO A;  1JKQ C;  3GTK J;  3C7J A;  3HOZ J;  1FOW A;  1UMQ A;  4DZJ A;  1NG7 A;  1WH7 A;  1OR7 C;  2B0L A;  2FML A;  3N4M A;  1E3H A;  1V54 H;  4GYI A;  3RZD J;  2LDU A;  3CUQ B;  3CDI A;  4AID A;  2DFF A;  1P6R A;  4RGS A;  5CLS A;  5LEJ A;  4EEF G;  2E71 A;  4FT8 A;  1U6G A;  2CJJ A;  3SEQ A;  4F93 B;  4KIF A;  2E1M C;  3J80 K;  2O9L A;  3MCZ A;  2KJC A;  3UNG C;  3ZQI A;  1QA6 A;  1MMD A;  1PVE A;  2W48 A;  2HDC A;  5FKL A;  2NS7 A;  1M1E B;  3P9K A;  4HNU A;  3HOV J;  3R0J A;  3U3N C;  2WAD A;  3HC7 A;  3HG9 A;  4QSH A;  3F72 A;  3QPH A;  2R7Q A;  1FP2 A;  2XAQ A;  2CW8 A;  2W84 A;  5BOX A;  3V4G A;  1OQY A;  2MYS A;  4AIJ A;  3OYK A;  3DWL E;  5F27 A;  4AC0 A;  1FSE A;  3PNV A;  2QWW A;  3M8J A;  4RLQ A;  2H27 A;  1CFE A;  2ACJ A;  1A36 A;  2Q0O A;  1SMY F;  4XRM A;  2OJE D;  1WSU A;  3CMY A;  4G2U A;  2NYX A;  4PUS A;  2DA3 A;  4IKF A;  4H4K C;  2BXZ A;  4OIN F;  4EQQ A;  3V8J A;  3BLY A;  2L4M A;  4OOI A;  2HXI A;  3CC7 I;  1OFC X;  4NUI A;  5J8F A;  4EJW A;  3FX3 A;  1FT9 A;  3C1D A;  2AXL A;  3K2A A;  5K7Z A;  3LA7 A;  4DBR A;  3S32 A;  5L3B A;  2E1N A;  2GOM A;  4XK4 A;  1OKR A;  3I0T A;  4RAF A;  3WG9 A;  4CCO A;  4XLA A;  1LDJ A;  1TWC J;  2L4A A;  5M3M J;  1QRY A;  4DOZ A;  4KJZ A;  4WXD A;  4C3J J;  3ZXS A;  4PCQ A;  2E7W A;  1WJD A;  4PJJ A;  5ILV A;  1K78 A;  2LKX A;  3BC8 A;  2NNY A;  3AG2 H;  2F48 A;  3MKY B;  2HYJ A;  1YJW I;  3FXU A;  1TNS A;  4PSX A;  4RA2 A;  3KZZ A;  1V3F A;  4Q48 A;  3LQR A;  4ZDL A;  5JI6 A;  2BY2 A;  1X1B A;  3ZQL A;  5HLH A;  1A35 A;  2W00 A;  2VC1 A;  2FX0 A;  4X0G A;  2KLO A;  2QQB A;  2WBM A;  3OYF A;  3NEU A;  5DUK A;  3JSO A;  3TO9 A;  3HB9 A;  2IA2 A;  4CCN A;  5DUI A;  1IRG A;  1XMK A;  3ZMT A;  3ELK A;  1ZYR F;  1I27 A;  4IHW A;  3KIO A;  4CH7 A;  4MEY F;  1LUJ B;  2CUE A;  2PMZ A;  5DCF A;  2ELK A;  3W6K B;  2KMU A;  2X0L A;  2VAS A;  3DTI A;  3ZRG A;  2OZU A;  3V8L A;  4U88 A;  1STZ A;  3F0C A;  2EZL A;  1R58 A;  4N4O B;  3ZQH A;  4EVI A;  2V9P A;  1YW9 A;  4B8X A;  3KE2 A;  1PP7 U;  3BTC A;  1R23 A;  5TRD A;  1N75 A;  1NHA A;  4LIT A;  4EMS A;  4TPV A;  5FJ8 J;  2LG4 A;  2VI6 A;  1IXS B;  4XLP F;  4MTD A;  1YW8 A;  2ECB A;  3PFI A;  3RYP A;  5LHI A;  1DU6 A;  2CG4 A;  2DMU A;  2EFP A;  2HOA A;  2R3S A;  3NRV A;  4MO7 A;  4OMY A;  4QPO A;  4RAZ A;  4UVC A;  5JVT A;  2GQQ A;  2M7B A;  1H88 C;  3TMO A;  3OYH A;  2LBF A;  3HSF A;  4HV6 A;  4IHY A;  2HTS A;  1R22 A;  1MMN A;  3M07 A;  1ZRC A;  5ED4 A;  4OMZ A;  1JUP A;  1XDU A;  1TBX A;  5A2Q Z;  4YG2 F;  4QTR A;  2FF4 A;  3PSI A;  3LL7 A;  2JRT A;  2VN2 A;  3R60 A;  4TV7 A;  3QPS A;  3RCO A;  2O61 A;  2E34 A;  2M7A A;  3FKJ A;  2HEO A;  3AL0 C;  2XGC A;  3K4L A;  1J0R A;  1CF7 A;  1POG A;  2Z2S B;  3BR1 A;  1N25 A;  3IAM 2;  4ETS A;  5JVG F;  3EYY A;  3PO3 J;  3LAJ A;  3K4J A;  1R1U A;  1P2F A;  2Z16 A;  5CYV A;  1R4M B;  3Q2U A;  3CME I;  2EPF A;  1FYL A;  3ABT A;  2YX7 A;  2FEZ A;  2FNP A;  3NWT A;  4B3A A;  2GM4 A;  1RET A;  4FX4 A;  1BR4 A;  1ZGJ A;  4E7L A;  2COB A;  4HF1 A;  4XR6 A;  4M9Z A;  3ROU A;  3A03 A;  4KN4 X;  1WPK A;  1XCV A;  1B59 A;  2K9S A;  3JTG A;  1E17 A;  5CQG A;  1O7F A;  1IN7 A;  3HHG A;  1O7L A;  2VLA A;  5ILS A;  4QLC U;  1QBJ A;  4D7N A;  2GA1 A;  1DGR M;  1BI2 A;  3GLL A;  2Y9Y A;  3GTL J;  5LHH A;  3BJ6 A;  4ZTJ A;  2H09 A;  1TQI A;  1XG1 A;  4ENK A;  1VQ4 I;  2ETH A;  1UG0 A;  1VF9 A;  2LYC A;  4XRS A;  1HBX G;  3VOE A;  4ASN A;  2MW8 A;  2V1N A;  3KZI C;  4L9J A;  3K70 C;  2R7U A;  1I6X A;  3GFM A;  1Z91 A;  2DMT A;  2QVO A;  3VYR B;  5IY5 H;  2Y2Z A;  3KEQ A;  4IHV A;  3ZMU A;  4YIR X;  2E36 A;  5LGU A;  3RZO J;  1XX5 A;  2WTE A;  3OS1 A;  1LFU P;  1PUE E;  2OPT A;  2G9W A;  3LSH A;  2HOE A;  1HLV A;  2XGE A;  1XSD A;  4GO1 A;  5E17 F;  2H8W A;  3GWZ A;  4HA8 A;  4I99 C;  3ABK H;  3CZ6 A;  5FKN A;  1T39 A;  3BTL A;  2EV5 A;  2EQR A;  2DA1 A;  3CUQ C;  4V2F A;  1A6I A;  4LLL A;  3LWF A;  3JRF A;  1B4A A;  2R5Z A;  1GV5 A;  3EUH C;  4IQJ A;  3OY9 A;  4BHB A;  4G6D A;  5M5X J;  1MSF C;  3EET A;  2WV0 A;  3H5A A;  1SMB A;  4LG0 B;  2IS6 A;  2KDO A;  4CUG A;  3JCU C;  1UHS A;  4UNO A;  2KIU A;  4IFA A;  3ZN0 A;  2MA3 A;  3MFK A;  3G3Z A;  3NAR A;  2DA4 A;  3PJR A;  3GFL A; 
#chains in the Genus database with same CATH homology
 4LY5 A;  3MZ8 A;  4NUI A;  3S6V A;  4H0A A;  5ETE A;  3NT8 A;  2VZN A;  2A05 A;  3U3U C;  5JYS A;  2DDA A;  1WVR A;  4NUO A;  1U53 A;  3Q2R A;  1RC9 A;  1CFE A;  3S6S A;  2GIZ A;  1SMB A;  4AIW A;  2CQ7 A;  4TPV A;  4D53 A;  4G2U A;  1XX5 A;  4IFA A;  4P27 A;  3S6U A;  3Q2U A;  3U3N C;  4NUN A;  1XTA A;  4NUK A;  2DDB A;  2EPF A;  3U3L C;  1QNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...