2DDAA

Crystal structure of pseudechetoxin from pseudechis australis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
KNYQKEIVDKHNALRRSVKPTARNMLQMKWNSRAAQNAKRWANRCTFAHSPPNKRTVGKLRCGENIFMSSQPFPWSGVVQAWYDEIKNFVYGIGAKPPGSVIGHYTQVVWYKSYLIGCASAKCSSSKYLYVCQYCPAGNIRGSIATPYKSGPPCADCPSACVNKLCTNPCKRNNDFSNCKSLAKKSKCQTEWIKKKCPASCFCHNKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of pseudechetoxin and pseudecin, two snake-venom cysteine-rich secretory proteins that target cyclic nucleotide-gated ion channels: implications for movement of the C-terminal cysteine-rich domain
pubmed doi rcsb
molecule tags Toxin
molecule keywords Pseudechetoxin
total genus 60
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 2ddaA02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 2ddaA01
1XX5A 4NUNA 3U3UC 4G2UA 2DDBA 4NUKA 3S6SA 3U3LC 1CFEA 1SMBA 4AIWA 3MZ8A 5ETEA 1XTAA 1WVRA 2VZNA 4H0AA 2DDAA 3Q2RA 1QNXA 4IFAA 4LY5A 3Q2UA 5JYSA 1U53A 3S6VA 2EPFA 3NT8A 1RC9A 4NUOA 2GIZA 2A05A 4D53A 3U3NC 4TPVA 3S6UA 4NUIA 4P27A 2CQ7A
chains in the Genus database with same CATH superfamily
3UKGA 1AU7A 2JSCA 4RMNA 1MBKA 1FOWA 4QSHA 1X1PA 4XOTA 4L9TA 4LK1F 3M8EA 3RQIA 3HRTA 4NUBA 4XKWA 3HKZN 2HQNA 2K86A 2XF7A 3DPLC 3I59B 4RAGA 4XN3A 1K6OA 2KLOA 3AG3H 4CXFA 3ZMDA 1XB4A 4HQEA 2K27A 5E17F 4WK8F 5HS7A 5TJJA 1ZKGA 5CQGA 4P96A 1WH7A 1FTZA 3C1DA 3KEOA 4GFBA 1SAUA 1RKTA 3JR9A 2DXIA 4HX7A 4LOCA 4G2UA 2HTSA 1XCBA 4DNCA 2NVQJ 2RV8A 5HVQC 1GUUA 2LY9A 3H35A 5GAEJ 3CMEI 1TC3C 2ZFUA 4IL6C 2P5VA 4G6TB 4BEHB 4F52A 3S3NA 2E2JJ 4BNCA 3EDPA 5BQTA 3HOTA 2B63J 3KETA 1T2KA 3HG9A 5IYDJ 1SD5A 5TGTA 2P5LC 1U5TB 2WB1N 1VZ0A 4BJ5C 1M1EB 1YS6A 4KDPA 2L9RA 2HWVA 2R0QC 1FOXA 4ZH4F 5JI6A 3S3OA 1QZYA 1ZREA 4V2GA 4BJTA 3M07A 4IHSA 2M7AA 3BQZA 1R1TA 4R8HA 5HLGA 1G59A 2CFXA 3OL4A 1D0YA 3OYEA 4M3DA 2EFWA 1YS7A 1MNDA 4AIWA 3SEZA 1XTAA 1Z91A 4I01A 3I4NJ 1U6GA 3GWZA 1U78A 1TNSA 2CQKA 2VLAA 1CQTA 3KZZA 1IUYA 1IDZA 2GA2A 1X3WB 4BXXJ 3WU1B 3FXMA 2XRLA 3OYLA 1X1CA 2XAQA 4M9ZA 4L5EA 1R36A 3ML6A 1AWCA 2COBA 2EV5A 2FEZA 2OCEA 3DQVC 2CQ7A 1H89C 3K10A 3R61A 4ETSA 1ULYA 4HRIA 2HS5A 1UHWA 2COMA 1Z67A 5EEAA 2EK5A 1I50J 1TWCJ 4RB2C 5EEHA 3PO3J 1KYWA 4RA2A 3B6AA 2KJCA 2F5VA 2BHYA 2LOOA 1GV5A 3WODF 4PUSA 4UV8A 3RKQA 4H0EA 2VASA 2W24A 2K5CA 3FXOA 2IGOA 3MVPA 2CSOA 3A03A 2XRNA 2QA4I 2V1NA 3L2QA 3KP4A 2DDBA 4I02A 1RR8C 1RKWA 1WH5A 2E1NA 3D5RC 1OCRH 1TNTA 3S93A 1BI0A 1FIPA 2K85A 2LBFA 5KVRA 3PUFA 3GTGJ 3J7AO 5F04A 1R5ID 3H3VK 3DEUA 3RPUD 3B6CA 3BTLA 3ZQCA 2ECBA 2KRCA 4A93J 4PFOA 2QEXI 3PIPF 1T33A 2WWYA 2DI3A 3CDLA 3RTRA 2LNBA 1ON1A 4TPVA 3HIFA 4XRFA 3CCLI 2P6TA 4OAYA 2XB0X 1MH4A 3JCUC 4HX8A 5D6EA 1IZ1A 4U87A 5CKTA 3L1PA 2HQAA 4JQFA 2AQFA 4KISA 2NS0A 1IC8A 2VPLA 5HNFA 3C2HA 1T8IA 1QHHD 3TDZC 1SMYF 1MBHA 3L7WA 3FBIB 3PNYA 1EV7A 2I10A 5F0HA 3FXRA 3ABUA 2OC6A 3MQ0A 3BCAA 1FMWA 1FZPB 1UMQA 1U3EM 1OJLA 2OA4A 2EZHA 4RM2A 5L3FA 2O0YA 2VT3A 1T0FC 1U9NA 3LSMA 4A2UA 3GYHX 9ANTA 4BXFA 1R4MB 2ESHA 2X1EA 2X6XA 3KIOA 3M7GA 3BJOA 1WRJA 3WU2C 2LP0A 4B8XA 3ABLH 1FIAA 3LNQA 2XGEA 4P9FA 1DQUA 3CMMA 4EEFG 2DDAA 5LGTA 2Q2EA 3WTSC 3PQJA 4E7LA 2Z33A 5E18F 3JRAA 1KU9A 4Y13A 3CF2A 3GTPJ 4JX4A 5ILUA 1OYYA 2A69F 4CUGA 2W48A 3E97A 5ICEA 1I1GA 3CCYA 3E1SA 3GZ5A 4NC7A 2OV7A 2STWA 2XASA 1BW6A 4KYWA 2OQRA 2L2OA 3DTEA 3WTXC 3CUQA 4EV0A 1HOMA 3BP8A 3HL2A 3JRCA 3LFUA 2LF7A 5J8FA 4EATA 5BS6A 1R1VA 3KYCB 3IKVA 2Y31A 4UY8I 1WHUA 3GTKJ 1Z9CA 2GAUA 1K83J 2HDWA 1ETVA 1X3UA 2CJJA 1DPUA 2WA0A 4AIJA 3OYIA 2WV1A 4LIVA 1ZELA 5EG0B 4KUMA 2E1MB 4D1QA 4I0AA 4M3GA 4DGWB 4ZYEA 2E19A 1X58A 2ZJRF 4E7IA 1J2XA 4CH7A 2F5FA 4M6VA 2ZXJA 3RPQA 3J7YJ 2QLZA 5E8IA 2OJED 2HOTA 2RNGA 3H3UA 1YQAA 1HW5A 2RQPA 4ESBA 3OYKA 3OYHA 4HG2A 1R71A 3U3UC 2BYVE 1Y39A 3FMQA 3U3LC 2GIVA 2QYOA 1K4SA 2HEOA 1LE8B 1ETOA 1N75A 1IN4A 4B44A 2XGXA 1PVEA 3K4MA 3JRHA 2MG4A 5ICGA 1IXCA 3MZHA 2RDPA 3FDYA 2IRFG 4FISA 2DMTA 4ZJZA 3BROA 4BY7J 4XLCA 2R5ZB 4C2UA 5J1RA 2W00A 3I55I 1K78B 1QPMA 1MJAA 2X85A 5IP7J 4M9SA 2M4GA 1GHCA 1A04A 2E34A 4BH9A 3ECHA 4IJAA 4XR6A 1B4AA 4WCGA 2IS6A 3IKTA 2HXIA 5LD2C 4II3A 3CC2I 2E7XA 2O03A 4BBSJ 2NS7A 2R93J 2O61A 2NVTJ 2DCEA 3QYEA 5LHGA 1ETWA 2E5ZA 1IRGA 1ZGAA 2Q2EB 2PJRA 1MZBA 1YIOA 2K9QA 2WAQN 4BYYA 1JJ8C 2V9VA 1GVDA 2LYCA 1OQYA 4Y15A 2JA6J 3BQYA 4N4OB 1BOBA 5HDKA 1DGWY 1ZN2A 1REPC 3F22A 4U7BA 3TW7A 1BR1A 3OS2A 4DBQA 4GYIA 4FX4A 4XKBA 4LLGF 4D7NA 2B7EA 1SD4A 2KDZA 3SYTA 4LGWA 2QM3A 1S5LC 3KEQA 1ZG1A 4AVZA 1SVOA 1DP3A 4IEJA 4A0YA 4O3MA 2DOEA 3E7LA 3GEZA 5D5XB 2DFHA 2YU3A 1B8IA 1BJZA 1LFUP 2ZKZA 3LOCA 3S6VA 1MJBA 2OF7A 3H9JA 4G6DA 2Y48A 3MKZA 1JGSA 4ZZLA 3BR3A 2HR3A 3K4JA 4PJJA 2NVUB 5CVVA 4YG2F 1P4WA 2CGPA 2ZSHB 4IHTA 1J5YA 1Y0UA 3S3MA 2H8WA 3O3KA 1POGA 3FISA 4A6EA 3WTTC 1FX7A 2PFBA 1TWHJ 1YOVB 2DFEA 1O57A 2DMNA 1ZGJA 2A61A 2DFFA 2VXDA 2K40A 2VONA 3IH3A 3KPHA 1SFEA 1OCZH 3GBGA 4IPAA 2W7NA 4UVAA 2LY2A 1D0ZA 1ITYA 2LMDA 3TQNA 5HLHA 4DOZA 1V4RA 2FBKA 2KPMA 2QQAA 4ON0A 3AKZA 4Y4RA 3VSKA 4BBRJ 4I0BA 1A31A 4G8XA 2EZIA 1Z7LA 4WXCA 1TL8A 3ASNH 3LA2A 3DKWA 1J9IA 3CQZJ 3I4PA 3PO2J 2L9SA 2XSDC 1E0EA 2KIUA 3JSOA 3K4NA 1T98A 3NARA 1LE8A 1UFMA 1XS9A 3ZMUA 1J0RA 3HSRA 1BI1A 4N9IA 1P9QC 4HV6A 1YIJI 1OR7C 3F8BA 2YUSA 4AVPA 2CW0F 1T6SA 4OAZA 1UG0A 1BR2A 4PK4A 1U53A 1R58A 4Y33A 1HCRA 3HGYA 2PMHA 3KYDB 4CDGA 5E20A 1DPRA 3DTIA 3I59A 1E17A 5FD6A 1RR7A 3ZMSA 3WTZA 4I98B 3FMSA 3DU5A 2KT0A 2D45A 4JX5A 3CCRI 3S6SA 4DJAA 1MGTA 2JA8J 2V6EA 2V1UA 2E60A 1CF7B 1LDDA 3BDDA 1JT0A 1WJFA 1QRYA 1IXRC 1VNDA 4HBLA 1DGRM 1YYVA 2DT6A 3BZKA 2PI0A 3E5UA 2UXXA 2MLKA 2E71A 5DD8A 4I99C 4L9JA 2A6HF 4C3JJ 5H6RA 1WZ2A 2XF5A 3GZNB 1IJWC 4FETA 2EJRA 3SFIA 5E3LA 2GIZA 5KHDA 2IA2A 4IQ4A 4MTDA 2HU9A 4PJMA 3LL7A 4BJ6C 2HTJA 1O3TA 4EJWA 1R00A 4Y52J 1WCMJ 2JWTA 1YW9A 5ED4A 4RB1A 1SMBA 2NS8A 3DV8A 5DCFA 3TEDA 2H6CA 3AL0C 1ZR2A 5KAIC 3HDDA 1ZG3A 2IS4A 3OYJA 3F6OA 4LB6B 5F64A 2K3PA 4LLNA 2XGDA 1IXSB 3TOAA 4OIPF 5CVUA 1RZ4A 2HPMA 5JLXA 2ZMEA 3ZN0A 1SD7A 1T0FA 3D0SA 4D53A 1QPIA 3SXYA 1H9TA 2V9PA 2VBZA 5IYBJ 1GV2A 1SEUA 4Y17A 3G3ZA 1JGGA 2QCOA 4ABZA 4WWCA 4UUSB 3C7JA 2F2EA 4UB6C 2XHKA 2BY2A 6PAXA 2FE3A 1ZH5A 1ZK8A 1OISA 1BR4A 1USTA 1KYZA 2P81A 3GFJA 3MAJA 2IJLA 3H0DA 1X1DA 2DA1A 1PJRA 3ELKA 4NB5A 4ZZDA 2JA7J 1W7PA 2R7FA 2EFOA 5FD5A 2LF8A 5D8KB 2QGUA 1FJLA 2WY7Q 4O6JA 5AONA 3IP4B 4UHTA 4B3XA 1BL0A 1YW7A 2L7FP 1MBEA 4F91B 2AXTC 3DBHB 3BC8A 4I6ZA 3Q0VA 2VQCA 3JRDA 2IA1A 2I5UA 1Z1DA 4IXAA 5E1WA 4K2EA 5GAHJ 4EJOA 2OUMA 2M4KA 4CCJA 3P9IA 4UUVA 4RS8A 5DUIA 4B47A 4IF4A 4XKVA 4HDUA 3UNGC 2DMPA 1O7LA 2KMUA 2DO7A 1G4DA 2GXAA 4LB5A 2TCTA 5DTDA 4GRIA 2BY1A 5DEQA 3CESA 1FP2A 5IT9K 2IGKA 2J5OA 2NVYJ 1XMAA 2CV1A 2L7MP 1WQ2A 1Z3YA 2LG4A 2M9HA 4BU2A 1R5HA 4DZPA 2HXOA 2CQNA 2JPCA 2WAEA 3J81Z 1RUOA 3MD2A 2PLYA 1VQ7I 2V9KA 2EIMH 2MGQA 5B3SH 3BR5A 2HQRA 2CRGA 3DLAA 3GLXA 3H9QA 2OZUA 5HS9A 4CGZA 1FYMA 4Y3OA 2DOFA 1JT6A 4G7OF 4WF2A 1VFCA 1W5TA 1XGOA 4V2FA 3G73A 1OYIA 3QQAA 4P55A 5KK1A 2LSOA 5FRNA 5JLWA 3A1YA 2YX4A 4IHWA 2K7LA 2OPTA 1JHHA 5LGUA 3S14J 4D9JA 2VOOA 4MHGA 3F21A 3C18A 3QRFF 4ENKA 3RIRA 1AOYA 2Q1ZB 3AL0B 1KONA 1NK2P 4BQAA 4HV5A 3PFYA 3CCJI 2O3FA 3ISPA 2VUMJ 3IH4A 2EB7A 3ZCOA 4BKXA 4B4CA 4C2MJ 2P4WA 1XG1A 2PMUA 1UELB 1WI9A 2QZ8A 4PFPA 4A3KJ 5BOXA 2ZNZA 3JTHA 1WPKA 3U3NC 3BTCA 1VTNC 3S6UA 2CUFA 1Z6TA 2ZNYA 5FKKA 4OINF 5E3NA 2HDCA 1BA5A 4EJTA 1WJBA 4XL9A 4BQQA 1GDTA 2F5CA 2VJ5A 2DPUA 1KGSA 3Q9SA 2WAFA 1MH3A 4G7ZF 2LLKA 1EA3A 2VQHA 3LA3A 1U8RA 1QNTA 1YRNB 1QHGA 2RN7A 3H1CA 4AC0A 3E5XA 3JW4A 1U0JA 3TO7A 5D5WB 3VODA 4BACA 3GTOJ 1FP1D 3DXJF 3ZGKA 1QO0D 2LDUA 5GAGJ 1F4KA 5J3LA 1HW2A 1B9MA 2JQ7A 5E79C 3HOUJ 4BDYA 2X6YA 1UZCA 4ZYHA 3ZOBA 2Y2ZA 3J80Z 2R7VA 3S17J 2GM4A 2E2IJ 4HF1A 3F8NA 4IHYA 1A36A 1MSEC 4OMZA 5M5YJ 2ELJA 3F3XA 2M1BA 1PP8F 1ENHA 2BXYA 2LC2A 2M45A 2MW8A 2BOLA 3H3ZA 4CZCA 1LVAA 1I39A 2AQEA 4MQVA 2DN0A 2ZB9A 1XGNA 2JT1A 2CQXA 2OU2A 4EJUA 1N78A 1H0MA 2LTPA 2LFBA 1VQ8I 2UUZA 1EKEA 1TQPA 1TZLA 2MH9A 4QPOA 1HF0A 1FMVA 1S3JA 2E5NA 5TRDA 5HLTA 5F08A 2HKXA 3KP3A 3GW2A 2XKPA 5FLXZ 4UUSA 2ACJA 3BY6A 1C0WA 3W6VA 2VKEA 3WHBA 4XM3A 3S2WA 5K5OA 1LFBA 2M2EA 1W36C 1P4XA 1R49A 2WV0A 5L3EA 1SFOJ 3P9CA 1QNXA 3BWGA 2W1OA 3L00A 5J6XA 4IX7A 4HA8A 2VC1A 2QQ9A 2H8RA 3HHGA 1YO5C 3GTMJ 3ZQLA 2ECCA 2WADA 3JRGA 1RIOH 4QTRA 1U5TA 2D1VA 1W7PD 2X4HA 2F6CA 2RVCA 2HGCA 1FSHA 4LITA 2CV2A 1J7KA 1MKMA 5J1UA 2VL8A 1V55H 4PJLA 4DYRA 2BV6A 1WJAA 2VIXA 3KYLA 1YLFA 3GFLA 1ETQA 2KZVA 4KFCA 2CG4A 2MC4A 1ODDA 3N05A 4MLOA 3LQQA 3CJQB 2KL4A 3HOWJ 3RQ4A 4BHBA 4E7KA 1OFCX 5F1RA 2K9LA 3BTIA 1R9TJ 1TT5B 2GA1A 2L3DA 4A12A 1W0TA 4QWQA 1YTYA 2ID3A 2QVOA 3NQOA 3REOA 3BJAA 5HLIA 1P4AA 1Y6IA 3K4BA 1QZEA 3DU6A 3L2WA 4P5OA 2XF6A 2D1HA 3O6BB 2L4MA 5EYRA 3F0CA 1A6IA 4DIQA 5FLMJ 2BGCA 2PG4A 2MD5A 4QLCU 4C3HJ 4RB3C 2FNPA 3PL8A 3TOBA 2IT0A 3ERED 3CF5F 1IN8A 3OIOA 1Q1VA 3KZYA 3FM3A 4MIMA 4CCLA 5DD4A 4MFEA 2BVMA 4KICA 3FK7A 4S04A 2OTJI 3DF8A 2OBPA 1K78A 2DT5A 2Y0SN 1FOYA 3HKZA 3ABMH 2M0CA 1VQMI 4LG0A 2X48A 2F5EA 3CCUI 3ZMTA 3PFIA 2ZMEC 2WY8Q 1BN5A 2A3SA 1YI2I 3BG9A 3GUDA 1QZZA 3S32A 4GDFA 4FE7A 2G7HA 2V7FA 4FCYA 2R5YA 5BPIA 1J09A 3GFMA 4AIKA 1TT0A 2MYSA 1XDUA 3H92A 4A5MA 3KP6A 2EFNA 5DM7F 1FNNA 4YFKF 3VYUB 1D1BA 4PJ0C 4IOAF 2YS9A 3FZVA 1X4PA 3BJ6A 5E3MA 2W25A 3K1PA 4OMYA 3OYDA 3LSHA 3W6KB 1JHFA 3EETA 2ZSIB 1ZTRA 3OYAA 4XSXF 2TRTA 5AIPA 3KCCA 3H5RA 1FBUA 4MQ9F 4L9VA 5ICFA 5GADJ 3LAPA 4NDLA 2VE8A 5FO5A 3U1KA 4CICA 4AM3A 3A2KA 3KP2A 5D5VB 1FEXA 2IS1A 2L7ZA 3DBRB 2L4AA 5ILSA 2VQGA 5M3MJ 4KN4X 1OCOH 4W97A 2EIKH 4F93B 3KZIC 2P7CB 3I54A 4CCOA 2JPBA 5EF6A 2D5VA 5DM6F 1TLHB 4EGYA 4A3IJ 5JVTA 1YE9A 2F5DA 3J7AY 1D5YA 2F4OB 4L5IA 5K5RA 3ASOH 3BG7A 2XPVA 2L02A 3WE3A 4G6QA 2XKOA 4ESJA 4ITVA 3NAUA 3JRBA 5HS8A 1ZARA 1IF1A 4AIDA 4H4KC 2LD5A 3W2VA 4A3GJ 1D1AA 2JUGA 2UZKA 4R1HA 4HF2A 2X9DA 3V4GA 1UCRA 2PMZA 3MN2A 1JE8A 2G9WA 3H36A 5KAFC 3A02A 1S72I 1G3WA 2CUJA 3Q2UA 3CUQB 3FXJA 2STTA 3WGHA 2R7DA 3K7AJ 3CO6C 1R1UA 3PNVA 2V26A 3LSIA 3RKWA 2F48A 3ZN1A 5K7HA 4ENNA 1EF4A 4RGSA 4NBQA 3PNTA 5FGMA 1W0UA 1IV6A 4XSZF 4O5VA 2PBIA 2RGVA 2IBDA 2XC7A 3CJRB 5ICCA 2W84A 2ELHA 5C44J 2FF4A 5IT3A 2E7WA 1A6QA 2L9VA 4L9NA 5CVRA 5J40A 3G2BA 2NNNA 4A3LJ 2ELKA 4FQGA 4N4NB 4UB8C 4EQQA 1DU6A 1ZGWA 2HOAA 1AA7A 3TMOA 5FKOA 3IH2A 1MJ9A 2KRHA 3E6MA 3KP5A 2BW3A 1YG2A 2R7RA 2HDDA 1B72A 2IW5A 4YIIA 5DV5A 2FOWA 5IOZA 5J8CA 5JHFA 1ZYRF 3SZTA 3OYFA 4ENJA 3L09A 1H8AC 3U9GA 1MMAA 1B9NA 1Z7UA 3L9FA 2EFQA 1W7PB 4CCNA 4E7SA 1ZRDA 4BS9A 1KZHA 4A69C 1OCTC 1R4NB 3RSNA 3KE2A 2XDVA 1LPQA 2OTLI 1P7JA 4IRHA 4KIGA 3I0TA 3CD6I 5LBQA 4BDZA 3N97A 2R7TA 2Y9ZA 3U21A 5IT9Z 5JHUA 3GX4X 2HYJA 2P8TA 4HOBA 2DMQA 3VFZA 3EYYA 2DT7B 2Z1DA 2HYFA 3WG7H 1Z77A 1XSXA 2IP2A 3CDIA 3EQLF 3K2AA 1ETKA 1V3FA 1Y8QB 1IO2A 2ZMEB 3Q0WA 1LQ1A 2VQLA 2MD0A 3PSIA 1PUFA 4Q5SF 5EG0A 3HSEA 4WX9A 3FK6A 2W82A 3PIOF 1S7OA 3ZQGA 2XAFA 4GXOA 1BJAA 3QYFA 1HA8A 1XGMA 5HNHA 1VF9A 4M3EA 4XLHA 4G12A 3K1NA 1X4OA 3OR2C 1JKQC 5CLSA 1S8NA 2B0LA 1FBSA 4IQJA 1LJ9A 1LEAA 4XK4A 2ZJQF 4LIUA 3HPGA 3DTKA 2MABA 4NNJA 3M3YJ 2M34A 2FBIA 2A07F 3OY9A 3VEPA 1X2NA 4Q48A 1I1SA 1FPQA 3OV8A 2X1DA 3FHNA 2KIFA 4XLEA 2LKPA 3M8FA 2EA2A 3COAC 3S1QJ 3X2QH 1UHMA 2CYYA 2D2WA 3V8JA 1JUPA 1ON2A 3R60A 3SEQA 5LEKA 4D7MA 3D5SC 1H88C 2XAUA 3EYIA 3QOEA 5M5XJ 5FKNA 4GCVA 1CFEA 3BG3A 3C2BA 4NQWA 3OOPA 2K4BA 1I27A 3GO5A 1HKSA 3A01B 2FRHA 2KISA 4UXNA 4ZTJA 2QSGX 4YFXF 1D8JA 3OYMA 4J00A 2R7SA 1I6XA 1NHAA 2GBYA 3RDIA 5D5UB 4XLFA 1RUNA 1YW8A 3QWLA 3RYPA 5DYMA 1SVMA 1MNMC 2QWWA 3HPHA 5E8GA 1DP7P 1NK3P 1LVKA 1IN6A 4CSWA 3CUQC 2VB6A 1FBQA 3DEEA 2OZ6A 4XN0A 2H6BA 2K3FA 1I3QJ 3NEUA 2DQRA 2H1KA 2GOXB 2XUBA 3C2GA 3IHUA 3BLYA 4PGHA 4I7HA 2Y9YA 2K02A 3EUKL 5CYVA 5K7FA 2Y69H 3HRUA 2ZC2A 3F23A 5GTIC 2HZDA 3QAHA 3U1DA 5K7ZA 2EV6A 2GLOA 2V4JC 3QODA 2R4GA 4U0WA 3JAMZ 2A5WA 5F0FA 3J80K 5KNLA 3DP7A 4KITB 3ZR8X 5BNGA 2DMUA 1Z21A 4C9YA 4M3BA 1V54H 1QA6A 4FTHA 2JRMA 2DYRH 2MBFA 3FX3A 4ANJA 3OS1A 1Z3XA 2NXNB 4YELA 4BAYA 3JRIA 1BC7C 4KMUX 3FXKA 5D8LB 4KJZA 4A3CJ 3HTUA 1BOAA 4IOCF 2LH9A 4S0HB 2HFHA 5IP9J 3TDUC 3HXLA 1I6HJ 3IUOA 4UUTA 1H9GA 5FKLA 4EMSA 3D5LA 2DJNA 2OD5A 1GXPA 3G71I 4BY1J 1P92A 3P7NA 4NUKA 4A3BJ 2OCCH 5FFXA 4XQFA 2VE9A 2E36A 5FLXK 2PJPA 2GQQA 3P5JA 3GTLJ 3PSFA 3RI4A 1MBJA 2CU7A 3K70D 1R22A 3BZCA 3LSRA 3T0YA 3CCVI 3GTJJ 5L3GA 1VQ4I 1W4MA 4HQMA 4IHVA 1I5ZA 2MFZA 5L3CA 3S2HJ 1W1WE 2JZYA 3CTAA 4AUXA 1X3ZB 1S7EA 3GMEA 4LLLA 1PUEE 4F3QA 2DA6A 1R23A 4NQWB 4KT6A 3BG5A 1P7IA 1Q1HA 4TV7A 3L2UA 5M3FJ 2VKVA 1KU2A 1PUFB 3TKYA 1EJ9A 2E1OA 3ABKH 3ESWB 3Q2RA 3BCBA 1VQOI 1B1BA 4RB0A 1MMNA 2NOGA 3HM5A 2F4IA 3BTJA 3HZJA 5GPCA 3L2CA 4LD5A 1L3LA 4E7JA 1NG7A 2OQGA 4DBRA 1S9HA 2GXGA 3V42A 2ZFWA 2PEXA 1TW3A 2HKOA 3CCEI 4YFNF 2HPIA 4ESFA 3F8FA 4NUIA 3MCZA 1E3PA 3OSGA 4B1RA 2LRDA 5IPAA 2JMWA 3OOUA 3FBNB 4OU0A 2XV4S 2DLLA 1PP7U 1HLVA 5LLQA 2BY3A 3EUAA 5JFRA 5IYCJ 4YIFA 2KFDA 2CQQA 5F1JA 3ZPLA 5B1AH 2FOKA 2VN2A 2M30A 4M74A 1K7AA 3GCMA 4IRGA 4Z6YA 2W85A 4OWRB 2W57A 5D4RA 4I2OA 1IG7A 3MKWB 4QPQA 2JSPA 2P6SA 2AXLA 3LQRA 4U0VA 1YJ9I 1QBJA 2H1LA 4CCMA 4GO1A 1VQNI 2LR8A 3T8RA 3H0GJ 2Y30A 1BI3A 2LY1A 1RPWA 3HB9A 2JRTA 1KQ0A 3CLOA 3PQKA 1FTTA 2DA2A 3FKIJ 2L5QA 4KNYA 3BZ6A 1OPCA 1P2FA 1XCVA 2JTVA 3CC7I 2NRAC 1LNWA 1O7FA 1XMXA 2R5YB 3S1NJ 2HOEA 1RETA 2LK2A 3RKYA 4YRVA 4NUOA 2K4JA 2RQQA 3AFHA 4ZDLA 1IN5A 4IO9F 3VWBA 4P9UA 2DJIA 2Z2SB 4XONA 5ERIA 5EZGA 4BE2A 2IGMA 2K9NA 5E3OA 4IRIA 2EIJH 2HYGD 3G1MA 3RPUA 1ETXA 1HXDA 4AD9A 3GFIA 5C4JJ 1WVRA 2IPQX 4BHCA 4BE0A 1JUSA 3EPZA 1XGSA 2FD5A 4PGGA 3BR0A 4HNUA 1OMIA 3A0BC 3E0JB 2R5ZA 1FY7A 3F72A 4BUPA 1F36A 4GYGA 5HOOA 3OSFA 2HQ5A 1XC5A 2CWEA 1FWZA 1YJWI 4CYDA 4CHUA 1MMDA 1SMTA 4G7HF 4I76A 2V1XA 1UAAA 4XKCA 3UR3C 2NAZA 3IAM2 4FE4A 4XMYA 3FHZA 2VZNA 4ZYDA 4ZYAA 4B3AA 1XD7A 2K9MA 3HUGA 1S6LA 4UVBA 5JYSA 2V6CA 2R7OA 5CVIA 5DS9A 2L9NA 4Q4ZF 1MDMA 4UVCA 4EGZA 3HGGA 5J47A 5EGOA 5C3EJ 3VOEA 1HDDC 1JJ6C 3AG1H 4XIDA 3G6EI 2ME6A 4MEYF 1FT9A 2XB5A 2M5WA 5E1ZB 3CCQI 4DYCA 3IAS2 4XORA 1V5EA 4EVIA 3HC7A 2R7WA 5DCMB 2O6GE 2O5RA 3QPTA 3RYRA 1NH3A 2ZBKA 1TW2A 3V7RA 2WAQA 3HJEA 2BZTA 3CUOA 2QBYA 3TGNA 2Z9OA 2O8XA 3S2DJ 2NVXJ 1UG2A 3VPRA 4KT5C 4BGDA 2KQRA 4HAMA 4A3JJ 4CYCB 1U9OA 3KEYA 1O3RA 3V7SA 1O3QA 4D5FA 4OIRF 4NUNA 1G3YA 4XRSG 1ZAOA 4Y7NJ 4FASD 4N0BA 1IN7A 3DBLB 2M3AA 2YR2A 4U88A 4A3FJ 1EH6A 1JKPC 3TP3A 2VC0A 1XMKA 3L2RA 5D6FA 2V79A 5CQEA 2H94A 3JTGA 1IRFA 2CW8A 2DTZA 3O2PE 2A6EF 4G94A 2P0WA 2E1MC 3FM5A 4OIQF 3R6SA 4E70A 1RC9A 4F92B 3LWFA 3WTVC 3BT9A 3LSJA 3T5XA 4E4HA 3BPXA 1HQCA 5EDNA 1XN7A 2JJ7A 3DPTA 4E7ZA 3IL2A 5K5QA 1N77A 1XPXA 3SZGA 3F8MA 2HNHA 3QU3A 5AIQA 4U7DA 2NYXA 5LHIA 4ZTFA 3ZQHA 2IVMA 3SQNA 2VJJA 1T95A 2RAEA 3KLNA 4F55A 1U8BA 1T08B 5D4SA 1WI3A 1T38A 1T56A 1ZHFA 4RLQA 3DLLF 1OLTA 1IGNA 2EZKA 3ZXSA 4LG0B 3K6GA 2N8GA 1YX5A 1ZR4A 1W5SA 3VSLA 5CVJA 2KDOA 1YFHA 2Z16A 3QU6A 1ONVA 1Z05A 2FU4A 2DU9A 1ERDA 1S29A 1Y56A 1NTCA 2BW3B 5FLVA 1OYWA 2FQ4A 3K4LA 2IEKA 2CUZA 2FQ3A 1ZQ3P 1JXSA 2FX0A 2L54A 4JX6A 3OL3A 3GVAA 4XLPF 1ZG5A 4PZJA 3IC7A 3KLOA 2BHZA 2F4MB 3FKJA 3ONQA 4XLAA 5HDGA 2CH0A 2K9SA 4ENMA 4XRSA 1I3AA 1WJDA 4EM2A 1HW1A 3CC4I 1D1CA 2DOAA 3BR2A 3TBIA 1MD0A 3CO7C 2VODA 5BPDA 2TDXA 4LK0F 3FXUA 1OCCH 5HDNA 5CPRB 4X6AJ 2QUFA 2JK3A 3QPSA 2DBBA 4BQOA 1LFPA 3V7CA 2EQRA 3B73A 4H0AA 2RNJA 1SFKA 4FHTA 2EZLA 3NWSA 2ME0A 1B6AA 2DK8A 3C3WA 4NHJA 3I9V2 4A3DJ 3A01A 1F43A 2CS3A 4KN7X 5J4YA 3I3LA 4BQNA 3FIWA 2A6TA 1G6NA 1R6RA 1V5GA 3AG2H 1SFXA 4XLNF 1SFUA 3GXOA 3HSFA 4RAYA 3I5UA 2JN6A 1X2MA 4RAFA 2DQLA 4FT8A 1WJEA 2X6OA 4HZFA 1F9NA 3OYBA 2B9SA 3TW6A 1CGPA 4IHXA 4M9XA 2QQBA 4JBAA 2CUEA 1VQ9I 3OS0A 1A5JA 2L01A 4RBOA 3LAJA 4MGRA 1FLIA 2MH2A 2BXZA 1GT0C 3LSGA 4B43A 3CMYA 4QIWN 2KP6A 1BIBA 3ZQ7A 3CP8A 4G9YA 4RGRA 4L0YB 3MZYA 4EM0B 1U2WA 1OKRA 3F9KA 2YPRA 1BBYA 3LA7A 1RNLA 4D5CA 3OMYA 5DDGA 2GZWA 1K6YA 2ZJPF 1XX5A 2A5YB 2DW4A 3ZMVA 4ZC3A 3CCMI 3JAMK 3DKYA 2DODA 3K0LA 1LKXA 2DTRA 5M5WJ 3CLQA 3HOSA 5TISC 1LDKB 5FJ8J 5IOYA 1F5TA 1WJ5A 5LRSA 2QSHX 1MNEA 2IAIA 1HSJA 3ULQB 4AU7A 1X1AA 1RESA 4M6XA 3NT8A 3OYGA 3H9GA 2EFPA 3GZ6A 3WTYC 1VQLI 3HOVJ 4ASNA 4KIFA 4L0ZB 3ZQFA 5LHHA 4JOMA 2FMYA 2JVGA 1DU0A 2ETHA 3I58A 2HZTA 3KFWX 1D0XA 3VB2A 3Q5FA 3DFGA 3SFZA 3ABTA 5CJ9A 2XVCA 3O8GA 1RI7A 3HRSA 3ZP5A 4L18B 3LSPA 1G3TA 3MEXA 5B66C 1ETYA 3Q3SA 4BE1A 1UB9A 2PMZN 3QPLA 5ILVA 1TWGJ 5KCMA 2EV0A 3W6JB 5LFAA 1T39A 1WSUA 2XIGA 2HOSA 3W2AA 2EILH 4XICA 3I4MJ 1KA8A 3NRVA 4MNUA 3WG9A 1PDNC 2EBIA 1G2HA 1EH7A 3GF2A 2M8GX 5IY5H 4UNOA 3QP5A 1OR7A 4E6KG 3WHCA 1N25A 2KKOA 4RLFA 3JSPA 2ZJ2A 3ZMZA 4S05A 5FRMA 3IRRA 2Z5UA 4J19A 3S8PA 1VQPI 3HHHA 2A05A 3BPVA 4HYEA 5LRRA 1BC8C 2VKDA 1APLC 1GXQA 3GLLA 4A6DA 2Z99A 4DQ2A 2VPRA 2RC4A 2XSJC 4CO8A 1Y1WJ 3M8JA 4B48A 1AKHB 4M72A 1R7JA 4HF0A 2UWMA 4A0ZA 4HLYA 1BM9A 1FSEA 2ID6A 2IS2A 4DZJA 2WB1A 3DKXA 3RZOJ 2BVLA 1IUFA 4HDVA 1VQ5I 1F1ZA 2FSWA 2X51A 2FA5A 2ZCWA 3WE2A 4BEHA 5F0CA 2UV1A 2PN6A 2E1CA 1HSTA 5FFZA 2I8DA 1UJ8A 4EM1A 5H20A 2VXZA 3HOYJ 3A0HC 3E6CC 4ZDOA 4XBFA 4A0XA 4KA4A 1SD6A 5LGNA 2MC3A 3WGGA 2Y75A 3RJPA 1SANA 4IKFA 2DA4A 3MFKA 3LSTA 3PUBA 3NWTA 3K70C 3VYRB 3LMMA 1MW7A 2AHQA 5JVGF 1D8KA 2DAOA 1IV8A 4I09A 4OIOF 4W1UA 2VI6A 4PSXA 1WFXA 4WXDA 2FBHA 4A5NA 3VYTB 5JR3A 2WBMA 2RREA 4EJVA 2QF7A 2DYSH 3TO9A 4RDUA 3OIPA 3M9AA 4YEJA 3T8TA 1XSVA 2CFOA 2DK5A 1MBGA 4ZYGA 4AYBN 3E3VA 3G4SI 3N4MA 2H09A 2Q8KA 3R4KA 1ZLJA 3MZ8A 2LBFB 2NNYA 2BY0A 2DA5A 4MO7A 2PQ8A 1JI8A 1WJCA 4BL0B 3D1NI 2R3SA 3SDBA 3W2WA 4HNVA 1SAXA 5L3BA 1QVUA 4MTEA 1OCPA 3A4CA 3E5QA 3LFKA 2E35A 2MLGA 2XAHA 5HODA 2JA2A 2YSRA 3F8CA 3HYIA 1J59A 2P5KA 2CW7A 1MSFC 2XGCA 2L0KA 3M1EA 1P6RA 4HSTA 5K1YA 2GWRA 3TO6A 1YJNI 2ZXIA 3RZDJ 2DFIA 1W36D 2QBYB 2M87A 2R7XA 1UHSA 3I64A 4LY5A 4XOPA 5H6QA 2XPUA 5B1BH 5FROA 1HC8A 3BOQA 4HSRA 3HBLA 2EPFA 3K2ZA 4CYCA 1B59A 3FXQA 2VOPA 4NC8A 1JKOC 4BXUA 4DYQA 1HBXG 4F7ZA 3MKYB 5J1YA 1MDMB 5B5EC 3OYCA 1ZRCA 1VQ6I 4X1EA 4ZDPA 4X0GA 5F6FA 1LB2A 2IA0A 3H5NA 4B09A 5ETEA 4Q47A 3ZQIA 3FWEA 5GTHC 3DEWA 1TBXA 3HUGB 3ZQQA 2M8EA 5E1XA 1MBFA 2JA5J 5F27A 2R7ZJ 4P1WA 4J01A 2FXAA 2EWNA 4NC6A 4GGGA 1O3SA 1HKQA 2C6YA 3FF5A 3DPUA 3K69A 3MKLA 1Z6RA 3PM1A 2LVSA 3WGIA 1TP4A 4XNFA 1BIAA 1PYVA 2VBWA 3K9TA 2BBYA 4P27A 4M73A 4RAZA 1JKRC 1STZA 2KIQA 3MMYB 4HEA2 1YITI 2NOJB 3B02A 1YX3A 1S7AA 2QKMB 3ERMA 3E6DA 5A2QK 1IW7F 2WTEA 4A3MJ 1WGXA 3BG6A 4HPQA 2BE5F 2LREA 2EH3A 1WWXA 4RM3A 3AAFA 3ROUA 3CCSI 2M7BA 2FMLA 3K4CA 1J75A 3RKXA 1Y0NA 1KQ8A 1FC3A 3U2RA 3CJNA 1QU3A 1Y8RB 3I56I 3HTSB 4CCKA 4N9HA 1RRJA 2X0LA 2YX7A 3P9KA 1KQ9A 5C4XJ 3ZRGA 4RGXA 2W4SA 2HVSA 2CO5A 3WTUC 4JYKA 4HX4A 5IP6A 3DCFA 4M3FA 5EGOB 5DUKA 3SZPA 1K61A 1VI0A 1X19A 4KMFA 4D0PA 1XSDA 1JUMA 1O4XA 4CZZA 3L2VA 3KP7A 3S15J 2CV0A 5BMZA 2MSYA 1NG6A 3IWZA 4MEXF 1ZLKA 4OOIA 3BR6A 2KJBA 2XAGA 2XAJA 1VQKI 3G1LA 2KZGA 4LFUA 2FNAA 4M71A 1FYKA 1R5GA 1KU7A 2PX9A 4KIBA 1LEBA 1USSA 1D5VA 1GLNA 1QGPA 4IFAA 1DUXC 1TQIA 2AS5F 2O8KA 1ORKA 2HVQA 3QP6A 5J4VA 1EH8A 3CMAI 3H5AA 4LJZF 4RGUA 1YHQI 2UXNA 1E3HA 2VBXA 1Y1VJ 1K79A 4JK1X 1L0OC 2Y0SA 3CJTB 4V19K 3PJRA 2JUCA 3FXLA 2X6WA 1WKMA 4U0YA 1G8XA 2IXSA 4PDKA 2GXBA 4C30A 3I53A 2DA7A 2HI3A 1TQMA 1MMGA 1ACIA 1G3SA 3HOZJ 3J81K 1YRNA 1JTYA 2V1DA 2ZXWH 1W5CC 4JP0A 1FYLA 1D3YA 1QVTA 2QENA 4II2A 1LDJA 3DWLE 2KIMA 4WXHA 2L7KA 3I71A 2CMPA 1K4TA 4PCQA 1U5TC 3HRMA 4DW6A 5EEGA 2XROA 2DA3A 3K4KA 3JRFA 2QQ8A 3ECOA 1MIJA 3Q0UA 3S1MJ 2ICWG 2ADUA 3SJMA 2AO9A 3EUHA 2Y0MA 2E2HJ 2VJ4A 1IAWA 3LSKA 3OYNA 1MMSA 3HOXJ 1HKTA 1A35A 2O9LA 3M4OJ 3AG4H 5A2QZ 4BHPA 5LEJA 2JVHA 5GP9A 3M1CA 2PJRB 3K1MA 2O7OA 2KRFA 1XDSA 5FB2A 1AKHA 2KHMA 3OWTA 3V8LA 3BR1A 2G0EA 3QOPA 1AHDP 3Q9VA 2QKLB 2HVRA 1DDNA 1GVJA 3KX2A 2R7QA 4IZZA 3CZ6A 1KU3A 4L5JA 1B72B 3CP2A 3CDHA 3WU0A 2J5PA 4C3IJ 2RKHA 3R0JA 2DPDA 1IRXA 1QQIA 4CA0A 4MFDA 2OAZA 2H27A 3SDGA 1TWFJ 2XPWA 4AIHA 2G7UA 2ZXHA 3TP0A 2A68F 2EA4A 4IVNA 3WTWC 5FKMA 2M0MA 4HNTA 2YU9J 3O8HA 2VT2A 5GPAA 2MA3A 2VJIA 4HW0A 1X1BA 2ESNA 3RCOA 4YIRX 1E3OC 1LUJB 3QPHA 2EINH 2GOMA 2IGNA 4Z2YA 3OR1C 2R7UA 3E6BA 1JTXA 3V8KA 4E7HA 3QYBA 1TWAJ 4AWXB 3W3CA 3EUHC 2FUG2 3F6VA 3IRQA 1FOKA 1CF7A 2Z3YA 3IV5A 4FX0A 3HEFA 3TL4X 2VKHA 3FMRA 4A3EJ 2LKXA 2ISZA 4XRMA 2FJ1A 2X1CA 3JREA 1BI2A 1Z0XA 3IWFA 3OIQA 1V5FA 1E2XA 3SHFA 1IRZA 4UV9A 3S1RJ 2QSFX 3T1BA 5H2FC 2WC2A 1HDPA 1SC7A 4LMYA 2ZO4A 2LKSA 2P7VB 1IDYA 2BEOA 4PSWA 2VBYA 3VDXA 5DCMA 4M6YA 3MWMA 1ZRFA 5EJCA 3G1OA 3GTQJ 2Q0OA 1B8IB 2ISYA 3R0AA 3VYSB 4PJNA 3S16J 5EZHA 5L3DA 3J7ZI 1BW5A 1TTYA 4HLXA 4R79A 4LG3A 4C2TA 4AYBA 2R92J 1SVLA
chains in the Genus database with same CATH topology
1XX5A 4NUNA 3U3UC 4G2UA 2DDBA 4NUKA 3S6SA 3U3LC 1CFEA 1SMBA 4AIWA 3MZ8A 5ETEA 1XTAA 1WVRA 2VZNA 4H0AA 2DDAA 3Q2RA 1QNXA 4IFAA 4LY5A 3Q2UA 5JYSA 1U53A 3S6VA 2EPFA 3NT8A 1RC9A 4NUOA 2GIZA 2A05A 4D53A 3U3NC 4TPVA 3S6UA 4NUIA 4P27A 2CQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XX5 A;  4NUN A;  3U3U C;  4G2U A;  2DDB A;  4NUK A;  3S6S A;  3U3L C;  1CFE A;  1SMB A;  4AIW A;  3MZ8 A;  5ETE A;  1XTA A;  1WVR A;  2VZN A;  4H0A A;  2DDA A;  3Q2R A;  1QNX A;  4IFA A;  4LY5 A;  3Q2U A;  5JYS A;  1U53 A;  3S6V A;  2EPF A;  3NT8 A;  1RC9 A;  4NUO A;  2GIZ A;  2A05 A;  4D53 A;  3U3N C;  4TPV A;  3S6U A;  4NUI A;  4P27 A;  2CQ7 A; 
#chains in the Genus database with same CATH topology
 3UKG A;  1AU7 A;  2JSC A;  4RMN A;  1MBK A;  1FOW A;  4QSH A;  1X1P A;  4XOT A;  4L9T A;  4LK1 F;  3M8E A;  3RQI A;  3HRT A;  4NUB A;  4XKW A;  3HKZ N;  2HQN A;  2K86 A;  2XF7 A;  3DPL C;  3I59 B;  4RAG A;  4XN3 A;  1K6O A;  2KLO A;  3AG3 H;  4CXF A;  3ZMD A;  1XB4 A;  4HQE A;  2K27 A;  5E17 F;  4WK8 F;  5HS7 A;  5TJJ A;  1ZKG A;  5CQG A;  4P96 A;  1WH7 A;  1FTZ A;  3C1D A;  3KEO A;  4GFB A;  1SAU A;  1RKT A;  3JR9 A;  2DXI A;  4HX7 A;  4LOC A;  4G2U A;  2HTS A;  1XCB A;  4DNC A;  2NVQ J;  2RV8 A;  5HVQ C;  1GUU A;  2LY9 A;  3H35 A;  5GAE J;  3CME I;  1TC3 C;  2ZFU A;  4IL6 C;  2P5V A;  4G6T B;  4BEH B;  4F52 A;  3S3N A;  2E2J J;  4BNC A;  3EDP A;  5BQT A;  3HOT A;  2B63 J;  3KET A;  1T2K A;  3HG9 A;  5IYD J;  1SD5 A;  5TGT A;  2P5L C;  1U5T B;  2WB1 N;  1VZ0 A;  4BJ5 C;  1M1E B;  1YS6 A;  4KDP A;  2L9R A;  2HWV A;  2R0Q C;  1FOX A;  4ZH4 F;  5JI6 A;  3S3O A;  1QZY A;  1ZRE A;  4V2G A;  4BJT A;  3M07 A;  4IHS A;  2M7A A;  3BQZ A;  1R1T A;  4R8H A;  5HLG A;  1G59 A;  2CFX A;  3OL4 A;  1D0Y A;  3OYE A;  4M3D A;  2EFW A;  1YS7 A;  1MND A;  4AIW A;  3SEZ A;  1XTA A;  1Z91 A;  4I01 A;  3I4N J;  1U6G A;  3GWZ A;  1U78 A;  1TNS A;  2CQK A;  2VLA A;  1CQT A;  3KZZ A;  1IUY A;  1IDZ A;  2GA2 A;  1X3W B;  4BXX J;  3WU1 B;  3FXM A;  2XRL A;  3OYL A;  1X1C A;  2XAQ A;  4M9Z A;  4L5E A;  1R36 A;  3ML6 A;  1AWC A;  2COB A;  2EV5 A;  2FEZ A;  2OCE A;  3DQV C;  2CQ7 A;  1H89 C;  3K10 A;  3R61 A;  4ETS A;  1ULY A;  4HRI A;  2HS5 A;  1UHW A;  2COM A;  1Z67 A;  5EEA A;  2EK5 A;  1I50 J;  1TWC J;  4RB2 C;  5EEH A;  3PO3 J;  1KYW A;  4RA2 A;  3B6A A;  2KJC A;  2F5V A;  2BHY A;  2LOO A;  1GV5 A;  3WOD F;  4PUS A;  4UV8 A;  3RKQ A;  4H0E A;  2VAS A;  2W24 A;  2K5C A;  3FXO A;  2IGO A;  3MVP A;  2CSO A;  3A03 A;  2XRN A;  2QA4 I;  2V1N A;  3L2Q A;  3KP4 A;  2DDB A;  4I02 A;  1RR8 C;  1RKW A;  1WH5 A;  2E1N A;  3D5R C;  1OCR H;  1TNT A;  3S93 A;  1BI0 A;  1FIP A;  2K85 A;  2LBF A;  5KVR A;  3PUF A;  3GTG J;  3J7A O;  5F04 A;  1R5I D;  3H3V K;  3DEU A;  3RPU D;  3B6C A;  3BTL A;  3ZQC A;  2ECB A;  2KRC A;  4A93 J;  4PFO A;  2QEX I;  3PIP F;  1T33 A;  2WWY A;  2DI3 A;  3CDL A;  3RTR A;  2LNB A;  1ON1 A;  4TPV A;  3HIF A;  4XRF A;  3CCL I;  2P6T A;  4OAY A;  2XB0 X;  1MH4 A;  3JCU C;  4HX8 A;  5D6E A;  1IZ1 A;  4U87 A;  5CKT A;  3L1P A;  2HQA A;  4JQF A;  2AQF A;  4KIS A;  2NS0 A;  1IC8 A;  2VPL A;  5HNF A;  3C2H A;  1T8I A;  1QHH D;  3TDZ C;  1SMY F;  1MBH A;  3L7W A;  3FBI B;  3PNY A;  1EV7 A;  2I10 A;  5F0H A;  3FXR A;  3ABU A;  2OC6 A;  3MQ0 A;  3BCA A;  1FMW A;  1FZP B;  1UMQ A;  1U3E M;  1OJL A;  2OA4 A;  2EZH A;  4RM2 A;  5L3F A;  2O0Y A;  2VT3 A;  1T0F C;  1U9N A;  3LSM A;  4A2U A;  3GYH X;  9ANT A;  4BXF A;  1R4M B;  2ESH A;  2X1E A;  2X6X A;  3KIO A;  3M7G A;  3BJO A;  1WRJ A;  3WU2 C;  2LP0 A;  4B8X A;  3ABL H;  1FIA A;  3LNQ A;  2XGE A;  4P9F A;  1DQU A;  3CMM A;  4EEF G;  2DDA A;  5LGT A;  2Q2E A;  3WTS C;  3PQJ A;  4E7L A;  2Z33 A;  5E18 F;  3JRA A;  1KU9 A;  4Y13 A;  3CF2 A;  3GTP J;  4JX4 A;  5ILU A;  1OYY A;  2A69 F;  4CUG A;  2W48 A;  3E97 A;  5ICE A;  1I1G A;  3CCY A;  3E1S A;  3GZ5 A;  4NC7 A;  2OV7 A;  2STW A;  2XAS A;  1BW6 A;  4KYW A;  2OQR A;  2L2O A;  3DTE A;  3WTX C;  3CUQ A;  4EV0 A;  1HOM A;  3BP8 A;  3HL2 A;  3JRC A;  3LFU A;  2LF7 A;  5J8F A;  4EAT A;  5BS6 A;  1R1V A;  3KYC B;  3IKV A;  2Y31 A;  4UY8 I;  1WHU A;  3GTK J;  1Z9C A;  2GAU A;  1K83 J;  2HDW A;  1ETV A;  1X3U A;  2CJJ A;  1DPU A;  2WA0 A;  4AIJ A;  3OYI A;  2WV1 A;  4LIV A;  1ZEL A;  5EG0 B;  4KUM A;  2E1M B;  4D1Q A;  4I0A A;  4M3G A;  4DGW B;  4ZYE A;  2E19 A;  1X58 A;  2ZJR F;  4E7I A;  1J2X A;  4CH7 A;  2F5F A;  4M6V A;  2ZXJ A;  3RPQ A;  3J7Y J;  2QLZ A;  5E8I A;  2OJE D;  2HOT A;  2RNG A;  3H3U A;  1YQA A;  1HW5 A;  2RQP A;  4ESB A;  3OYK A;  3OYH A;  4HG2 A;  1R71 A;  3U3U C;  2BYV E;  1Y39 A;  3FMQ A;  3U3L C;  2GIV A;  2QYO A;  1K4S A;  2HEO A;  1LE8 B;  1ETO A;  1N75 A;  1IN4 A;  4B44 A;  2XGX A;  1PVE A;  3K4M A;  3JRH A;  2MG4 A;  5ICG A;  1IXC A;  3MZH A;  2RDP A;  3FDY A;  2IRF G;  4FIS A;  2DMT A;  4ZJZ A;  3BRO A;  4BY7 J;  4XLC A;  2R5Z B;  4C2U A;  5J1R A;  2W00 A;  3I55 I;  1K78 B;  1QPM A;  1MJA A;  2X85 A;  5IP7 J;  4M9S A;  2M4G A;  1GHC A;  1A04 A;  2E34 A;  4BH9 A;  3ECH A;  4IJA A;  4XR6 A;  1B4A A;  4WCG A;  2IS6 A;  3IKT A;  2HXI A;  5LD2 C;  4II3 A;  3CC2 I;  2E7X A;  2O03 A;  4BBS J;  2NS7 A;  2R93 J;  2O61 A;  2NVT J;  2DCE A;  3QYE A;  5LHG A;  1ETW A;  2E5Z A;  1IRG A;  1ZGA A;  2Q2E B;  2PJR A;  1MZB A;  1YIO A;  2K9Q A;  2WAQ N;  4BYY A;  1JJ8 C;  2V9V A;  1GVD A;  2LYC A;  1OQY A;  4Y15 A;  2JA6 J;  3BQY A;  4N4O B;  1BOB A;  5HDK A;  1DGW Y;  1ZN2 A;  1REP C;  3F22 A;  4U7B A;  3TW7 A;  1BR1 A;  3OS2 A;  4DBQ A;  4GYI A;  4FX4 A;  4XKB A;  4LLG F;  4D7N A;  2B7E A;  1SD4 A;  2KDZ A;  3SYT A;  4LGW A;  2QM3 A;  1S5L C;  3KEQ A;  1ZG1 A;  4AVZ A;  1SVO A;  1DP3 A;  4IEJ A;  4A0Y A;  4O3M A;  2DOE A;  3E7L A;  3GEZ A;  5D5X B;  2DFH A;  2YU3 A;  1B8I A;  1BJZ A;  1LFU P;  2ZKZ A;  3LOC A;  3S6V A;  1MJB A;  2OF7 A;  3H9J A;  4G6D A;  2Y48 A;  3MKZ A;  1JGS A;  4ZZL A;  3BR3 A;  2HR3 A;  3K4J A;  4PJJ A;  2NVU B;  5CVV A;  4YG2 F;  1P4W A;  2CGP A;  2ZSH B;  4IHT A;  1J5Y A;  1Y0U A;  3S3M A;  2H8W A;  3O3K A;  1POG A;  3FIS A;  4A6E A;  3WTT C;  1FX7 A;  2PFB A;  1TWH J;  1YOV B;  2DFE A;  1O57 A;  2DMN A;  1ZGJ A;  2A61 A;  2DFF A;  2VXD A;  2K40 A;  2VON A;  3IH3 A;  3KPH A;  1SFE A;  1OCZ H;  3GBG A;  4IPA A;  2W7N A;  4UVA A;  2LY2 A;  1D0Z A;  1ITY A;  2LMD A;  3TQN A;  5HLH A;  4DOZ A;  1V4R A;  2FBK A;  2KPM A;  2QQA A;  4ON0 A;  3AKZ A;  4Y4R A;  3VSK A;  4BBR J;  4I0B A;  1A31 A;  4G8X A;  2EZI A;  1Z7L A;  4WXC A;  1TL8 A;  3ASN H;  3LA2 A;  3DKW A;  1J9I A;  3CQZ J;  3I4P A;  3PO2 J;  2L9S A;  2XSD C;  1E0E A;  2KIU A;  3JSO A;  3K4N A;  1T98 A;  3NAR A;  1LE8 A;  1UFM A;  1XS9 A;  3ZMU A;  1J0R A;  3HSR A;  1BI1 A;  4N9I A;  1P9Q C;  4HV6 A;  1YIJ I;  1OR7 C;  3F8B A;  2YUS A;  4AVP A;  2CW0 F;  1T6S A;  4OAZ A;  1UG0 A;  1BR2 A;  4PK4 A;  1U53 A;  1R58 A;  4Y33 A;  1HCR A;  3HGY A;  2PMH A;  3KYD B;  4CDG A;  5E20 A;  1DPR A;  3DTI A;  3I59 A;  1E17 A;  5FD6 A;  1RR7 A;  3ZMS A;  3WTZ A;  4I98 B;  3FMS A;  3DU5 A;  2KT0 A;  2D45 A;  4JX5 A;  3CCR I;  3S6S A;  4DJA A;  1MGT A;  2JA8 J;  2V6E A;  2V1U A;  2E60 A;  1CF7 B;  1LDD A;  3BDD A;  1JT0 A;  1WJF A;  1QRY A;  1IXR C;  1VND A;  4HBL A;  1DGR M;  1YYV A;  2DT6 A;  3BZK A;  2PI0 A;  3E5U A;  2UXX A;  2MLK A;  2E71 A;  5DD8 A;  4I99 C;  4L9J A;  2A6H F;  4C3J J;  5H6R A;  1WZ2 A;  2XF5 A;  3GZN B;  1IJW C;  4FET A;  2EJR A;  3SFI A;  5E3L A;  2GIZ A;  5KHD A;  2IA2 A;  4IQ4 A;  4MTD A;  2HU9 A;  4PJM A;  3LL7 A;  4BJ6 C;  2HTJ A;  1O3T A;  4EJW A;  1R00 A;  4Y52 J;  1WCM J;  2JWT A;  1YW9 A;  5ED4 A;  4RB1 A;  1SMB A;  2NS8 A;  3DV8 A;  5DCF A;  3TED A;  2H6C A;  3AL0 C;  1ZR2 A;  5KAI C;  3HDD A;  1ZG3 A;  2IS4 A;  3OYJ A;  3F6O A;  4LB6 B;  5F64 A;  2K3P A;  4LLN A;  2XGD A;  1IXS B;  3TOA A;  4OIP F;  5CVU A;  1RZ4 A;  2HPM A;  5JLX A;  2ZME A;  3ZN0 A;  1SD7 A;  1T0F A;  3D0S A;  4D53 A;  1QPI A;  3SXY A;  1H9T A;  2V9P A;  2VBZ A;  5IYB J;  1GV2 A;  1SEU A;  4Y17 A;  3G3Z A;  1JGG A;  2QCO A;  4ABZ A;  4WWC A;  4UUS B;  3C7J A;  2F2E A;  4UB6 C;  2XHK A;  2BY2 A;  6PAX A;  2FE3 A;  1ZH5 A;  1ZK8 A;  1OIS A;  1BR4 A;  1UST A;  1KYZ A;  2P81 A;  3GFJ A;  3MAJ A;  2IJL A;  3H0D A;  1X1D A;  2DA1 A;  1PJR A;  3ELK A;  4NB5 A;  4ZZD A;  2JA7 J;  1W7P A;  2R7F A;  2EFO A;  5FD5 A;  2LF8 A;  5D8K B;  2QGU A;  1FJL A;  2WY7 Q;  4O6J A;  5AON A;  3IP4 B;  4UHT A;  4B3X A;  1BL0 A;  1YW7 A;  2L7F P;  1MBE A;  4F91 B;  2AXT C;  3DBH B;  3BC8 A;  4I6Z A;  3Q0V A;  2VQC A;  3JRD A;  2IA1 A;  2I5U A;  1Z1D A;  4IXA A;  5E1W A;  4K2E A;  5GAH J;  4EJO A;  2OUM A;  2M4K A;  4CCJ A;  3P9I A;  4UUV A;  4RS8 A;  5DUI A;  4B47 A;  4IF4 A;  4XKV A;  4HDU A;  3UNG C;  2DMP A;  1O7L A;  2KMU A;  2DO7 A;  1G4D A;  2GXA A;  4LB5 A;  2TCT A;  5DTD A;  4GRI A;  2BY1 A;  5DEQ A;  3CES A;  1FP2 A;  5IT9 K;  2IGK A;  2J5O A;  2NVY J;  1XMA A;  2CV1 A;  2L7M P;  1WQ2 A;  1Z3Y A;  2LG4 A;  2M9H A;  4BU2 A;  1R5H A;  4DZP A;  2HXO A;  2CQN A;  2JPC A;  2WAE A;  3J81 Z;  1RUO A;  3MD2 A;  2PLY A;  1VQ7 I;  2V9K A;  2EIM H;  2MGQ A;  5B3S H;  3BR5 A;  2HQR A;  2CRG A;  3DLA A;  3GLX A;  3H9Q A;  2OZU A;  5HS9 A;  4CGZ A;  1FYM A;  4Y3O A;  2DOF A;  1JT6 A;  4G7O F;  4WF2 A;  1VFC A;  1W5T A;  1XGO A;  4V2F A;  3G73 A;  1OYI A;  3QQA A;  4P55 A;  5KK1 A;  2LSO A;  5FRN A;  5JLW A;  3A1Y A;  2YX4 A;  4IHW A;  2K7L A;  2OPT A;  1JHH A;  5LGU A;  3S14 J;  4D9J A;  2VOO A;  4MHG A;  3F21 A;  3C18 A;  3QRF F;  4ENK A;  3RIR A;  1AOY A;  2Q1Z B;  3AL0 B;  1KON A;  1NK2 P;  4BQA A;  4HV5 A;  3PFY A;  3CCJ I;  2O3F A;  3ISP A;  2VUM J;  3IH4 A;  2EB7 A;  3ZCO A;  4BKX A;  4B4C A;  4C2M J;  2P4W A;  1XG1 A;  2PMU A;  1UEL B;  1WI9 A;  2QZ8 A;  4PFP A;  4A3K J;  5BOX A;  2ZNZ A;  3JTH A;  1WPK A;  3U3N C;  3BTC A;  1VTN C;  3S6U A;  2CUF A;  1Z6T A;  2ZNY A;  5FKK A;  4OIN F;  5E3N A;  2HDC A;  1BA5 A;  4EJT A;  1WJB A;  4XL9 A;  4BQQ A;  1GDT A;  2F5C A;  2VJ5 A;  2DPU A;  1KGS A;  3Q9S A;  2WAF A;  1MH3 A;  4G7Z F;  2LLK A;  1EA3 A;  2VQH A;  3LA3 A;  1U8R A;  1QNT A;  1YRN B;  1QHG A;  2RN7 A;  3H1C A;  4AC0 A;  3E5X A;  3JW4 A;  1U0J A;  3TO7 A;  5D5W B;  3VOD A;  4BAC A;  3GTO J;  1FP1 D;  3DXJ F;  3ZGK A;  1QO0 D;  2LDU A;  5GAG J;  1F4K A;  5J3L A;  1HW2 A;  1B9M A;  2JQ7 A;  5E79 C;  3HOU J;  4BDY A;  2X6Y A;  1UZC A;  4ZYH A;  3ZOB A;  2Y2Z A;  3J80 Z;  2R7V A;  3S17 J;  2GM4 A;  2E2I J;  4HF1 A;  3F8N A;  4IHY A;  1A36 A;  1MSE C;  4OMZ A;  5M5Y J;  2ELJ A;  3F3X A;  2M1B A;  1PP8 F;  1ENH A;  2BXY A;  2LC2 A;  2M45 A;  2MW8 A;  2BOL A;  3H3Z A;  4CZC A;  1LVA A;  1I39 A;  2AQE A;  4MQV A;  2DN0 A;  2ZB9 A;  1XGN A;  2JT1 A;  2CQX A;  2OU2 A;  4EJU A;  1N78 A;  1H0M A;  2LTP A;  2LFB A;  1VQ8 I;  2UUZ A;  1EKE A;  1TQP A;  1TZL A;  2MH9 A;  4QPO A;  1HF0 A;  1FMV A;  1S3J A;  2E5N A;  5TRD A;  5HLT A;  5F08 A;  2HKX A;  3KP3 A;  3GW2 A;  2XKP A;  5FLX Z;  4UUS A;  2ACJ A;  3BY6 A;  1C0W A;  3W6V A;  2VKE A;  3WHB A;  4XM3 A;  3S2W A;  5K5O A;  1LFB A;  2M2E A;  1W36 C;  1P4X A;  1R49 A;  2WV0 A;  5L3E A;  1SFO J;  3P9C A;  1QNX A;  3BWG A;  2W1O A;  3L00 A;  5J6X A;  4IX7 A;  4HA8 A;  2VC1 A;  2QQ9 A;  2H8R A;  3HHG A;  1YO5 C;  3GTM J;  3ZQL A;  2ECC A;  2WAD A;  3JRG A;  1RIO H;  4QTR A;  1U5T A;  2D1V A;  1W7P D;  2X4H A;  2F6C A;  2RVC A;  2HGC A;  1FSH A;  4LIT A;  2CV2 A;  1J7K A;  1MKM A;  5J1U A;  2VL8 A;  1V55 H;  4PJL A;  4DYR A;  2BV6 A;  1WJA A;  2VIX A;  3KYL A;  1YLF A;  3GFL A;  1ETQ A;  2KZV A;  4KFC A;  2CG4 A;  2MC4 A;  1ODD A;  3N05 A;  4MLO A;  3LQQ A;  3CJQ B;  2KL4 A;  3HOW J;  3RQ4 A;  4BHB A;  4E7K A;  1OFC X;  5F1R A;  2K9L A;  3BTI A;  1R9T J;  1TT5 B;  2GA1 A;  2L3D A;  4A12 A;  1W0T A;  4QWQ A;  1YTY A;  2ID3 A;  2QVO A;  3NQO A;  3REO A;  3BJA A;  5HLI A;  1P4A A;  1Y6I A;  3K4B A;  1QZE A;  3DU6 A;  3L2W A;  4P5O A;  2XF6 A;  2D1H A;  3O6B B;  2L4M A;  5EYR A;  3F0C A;  1A6I A;  4DIQ A;  5FLM J;  2BGC A;  2PG4 A;  2MD5 A;  4QLC U;  4C3H J;  4RB3 C;  2FNP A;  3PL8 A;  3TOB A;  2IT0 A;  3ERE D;  3CF5 F;  1IN8 A;  3OIO A;  1Q1V A;  3KZY A;  3FM3 A;  4MIM A;  4CCL A;  5DD4 A;  4MFE A;  2BVM A;  4KIC A;  3FK7 A;  4S04 A;  2OTJ I;  3DF8 A;  2OBP A;  1K78 A;  2DT5 A;  2Y0S N;  1FOY A;  3HKZ A;  3ABM H;  2M0C A;  1VQM I;  4LG0 A;  2X48 A;  2F5E A;  3CCU I;  3ZMT A;  3PFI A;  2ZME C;  2WY8 Q;  1BN5 A;  2A3S A;  1YI2 I;  3BG9 A;  3GUD A;  1QZZ A;  3S32 A;  4GDF A;  4FE7 A;  2G7H A;  2V7F A;  4FCY A;  2R5Y A;  5BPI A;  1J09 A;  3GFM A;  4AIK A;  1TT0 A;  2MYS A;  1XDU A;  3H92 A;  4A5M A;  3KP6 A;  2EFN A;  5DM7 F;  1FNN A;  4YFK F;  3VYU B;  1D1B A;  4PJ0 C;  4IOA F;  2YS9 A;  3FZV A;  1X4P A;  3BJ6 A;  5E3M A;  2W25 A;  3K1P A;  4OMY A;  3OYD A;  3LSH A;  3W6K B;  1JHF A;  3EET A;  2ZSI B;  1ZTR A;  3OYA A;  4XSX F;  2TRT A;  5AIP A;  3KCC A;  3H5R A;  1FBU A;  4MQ9 F;  4L9V A;  5ICF A;  5GAD J;  3LAP A;  4NDL A;  2VE8 A;  5FO5 A;  3U1K A;  4CIC A;  4AM3 A;  3A2K A;  3KP2 A;  5D5V B;  1FEX A;  2IS1 A;  2L7Z A;  3DBR B;  2L4A A;  5ILS A;  2VQG A;  5M3M J;  4KN4 X;  1OCO H;  4W97 A;  2EIK H;  4F93 B;  3KZI C;  2P7C B;  3I54 A;  4CCO A;  2JPB A;  5EF6 A;  2D5V A;  5DM6 F;  1TLH B;  4EGY A;  4A3I J;  5JVT A;  1YE9 A;  2F5D A;  3J7A Y;  1D5Y A;  2F4O B;  4L5I A;  5K5R A;  3ASO H;  3BG7 A;  2XPV A;  2L02 A;  3WE3 A;  4G6Q A;  2XKO A;  4ESJ A;  4ITV A;  3NAU A;  3JRB A;  5HS8 A;  1ZAR A;  1IF1 A;  4AID A;  4H4K C;  2LD5 A;  3W2V A;  4A3G J;  1D1A A;  2JUG A;  2UZK A;  4R1H A;  4HF2 A;  2X9D A;  3V4G A;  1UCR A;  2PMZ A;  3MN2 A;  1JE8 A;  2G9W A;  3H36 A;  5KAF C;  3A02 A;  1S72 I;  1G3W A;  2CUJ A;  3Q2U A;  3CUQ B;  3FXJ A;  2STT A;  3WGH A;  2R7D A;  3K7A J;  3CO6 C;  1R1U A;  3PNV A;  2V26 A;  3LSI A;  3RKW A;  2F48 A;  3ZN1 A;  5K7H A;  4ENN A;  1EF4 A;  4RGS A;  4NBQ A;  3PNT A;  5FGM A;  1W0U A;  1IV6 A;  4XSZ F;  4O5V A;  2PBI A;  2RGV A;  2IBD A;  2XC7 A;  3CJR B;  5ICC A;  2W84 A;  2ELH A;  5C44 J;  2FF4 A;  5IT3 A;  2E7W A;  1A6Q A;  2L9V A;  4L9N A;  5CVR A;  5J40 A;  3G2B A;  2NNN A;  4A3L J;  2ELK A;  4FQG A;  4N4N B;  4UB8 C;  4EQQ A;  1DU6 A;  1ZGW A;  2HOA A;  1AA7 A;  3TMO A;  5FKO A;  3IH2 A;  1MJ9 A;  2KRH A;  3E6M A;  3KP5 A;  2BW3 A;  1YG2 A;  2R7R A;  2HDD A;  1B72 A;  2IW5 A;  4YII A;  5DV5 A;  2FOW A;  5IOZ A;  5J8C A;  5JHF A;  1ZYR F;  3SZT A;  3OYF A;  4ENJ A;  3L09 A;  1H8A C;  3U9G A;  1MMA A;  1B9N A;  1Z7U A;  3L9F A;  2EFQ A;  1W7P B;  4CCN A;  4E7S A;  1ZRD A;  4BS9 A;  1KZH A;  4A69 C;  1OCT C;  1R4N B;  3RSN A;  3KE2 A;  2XDV A;  1LPQ A;  2OTL I;  1P7J A;  4IRH A;  4KIG A;  3I0T A;  3CD6 I;  5LBQ A;  4BDZ A;  3N97 A;  2R7T A;  2Y9Z A;  3U21 A;  5IT9 Z;  5JHU A;  3GX4 X;  2HYJ A;  2P8T A;  4HOB A;  2DMQ A;  3VFZ A;  3EYY A;  2DT7 B;  2Z1D A;  2HYF A;  3WG7 H;  1Z77 A;  1XSX A;  2IP2 A;  3CDI A;  3EQL F;  3K2A A;  1ETK A;  1V3F A;  1Y8Q B;  1IO2 A;  2ZME B;  3Q0W A;  1LQ1 A;  2VQL A;  2MD0 A;  3PSI A;  1PUF A;  4Q5S F;  5EG0 A;  3HSE A;  4WX9 A;  3FK6 A;  2W82 A;  3PIO F;  1S7O A;  3ZQG A;  2XAF A;  4GXO A;  1BJA A;  3QYF A;  1HA8 A;  1XGM A;  5HNH A;  1VF9 A;  4M3E A;  4XLH A;  4G12 A;  3K1N A;  1X4O A;  3OR2 C;  1JKQ C;  5CLS A;  1S8N A;  2B0L A;  1FBS A;  4IQJ A;  1LJ9 A;  1LEA A;  4XK4 A;  2ZJQ F;  4LIU A;  3HPG A;  3DTK A;  2MAB A;  4NNJ A;  3M3Y J;  2M34 A;  2FBI A;  2A07 F;  3OY9 A;  3VEP A;  1X2N A;  4Q48 A;  1I1S A;  1FPQ A;  3OV8 A;  2X1D A;  3FHN A;  2KIF A;  4XLE A;  2LKP A;  3M8F A;  2EA2 A;  3COA C;  3S1Q J;  3X2Q H;  1UHM A;  2CYY A;  2D2W A;  3V8J A;  1JUP A;  1ON2 A;  3R60 A;  3SEQ A;  5LEK A;  4D7M A;  3D5S C;  1H88 C;  2XAU A;  3EYI A;  3QOE A;  5M5X J;  5FKN A;  4GCV A;  1CFE A;  3BG3 A;  3C2B A;  4NQW A;  3OOP A;  2K4B A;  1I27 A;  3GO5 A;  1HKS A;  3A01 B;  2FRH A;  2KIS A;  4UXN A;  4ZTJ A;  2QSG X;  4YFX F;  1D8J A;  3OYM A;  4J00 A;  2R7S A;  1I6X A;  1NHA A;  2GBY A;  3RDI A;  5D5U B;  4XLF A;  1RUN A;  1YW8 A;  3QWL A;  3RYP A;  5DYM A;  1SVM A;  1MNM C;  2QWW A;  3HPH A;  5E8G A;  1DP7 P;  1NK3 P;  1LVK A;  1IN6 A;  4CSW A;  3CUQ C;  2VB6 A;  1FBQ A;  3DEE A;  2OZ6 A;  4XN0 A;  2H6B A;  2K3F A;  1I3Q J;  3NEU A;  2DQR A;  2H1K A;  2GOX B;  2XUB A;  3C2G A;  3IHU A;  3BLY A;  4PGH A;  4I7H A;  2Y9Y A;  2K02 A;  3EUK L;  5CYV A;  5K7F A;  2Y69 H;  3HRU A;  2ZC2 A;  3F23 A;  5GTI C;  2HZD A;  3QAH A;  3U1D A;  5K7Z A;  2EV6 A;  2GLO A;  2V4J C;  3QOD A;  2R4G A;  4U0W A;  3JAM Z;  2A5W A;  5F0F A;  3J80 K;  5KNL A;  3DP7 A;  4KIT B;  3ZR8 X;  5BNG A;  2DMU A;  1Z21 A;  4C9Y A;  4M3B A;  1V54 H;  1QA6 A;  4FTH A;  2JRM A;  2DYR H;  2MBF A;  3FX3 A;  4ANJ A;  3OS1 A;  1Z3X A;  2NXN B;  4YEL A;  4BAY A;  3JRI A;  1BC7 C;  4KMU X;  3FXK A;  5D8L B;  4KJZ A;  4A3C J;  3HTU A;  1BOA A;  4IOC F;  2LH9 A;  4S0H B;  2HFH A;  5IP9 J;  3TDU C;  3HXL A;  1I6H J;  3IUO A;  4UUT A;  1H9G A;  5FKL A;  4EMS A;  3D5L A;  2DJN A;  2OD5 A;  1GXP A;  3G71 I;  4BY1 J;  1P92 A;  3P7N A;  4NUK A;  4A3B J;  2OCC H;  5FFX A;  4XQF A;  2VE9 A;  2E36 A;  5FLX K;  2PJP A;  2GQQ A;  3P5J A;  3GTL J;  3PSF A;  3RI4 A;  1MBJ A;  2CU7 A;  3K70 D;  1R22 A;  3BZC A;  3LSR A;  3T0Y A;  3CCV I;  3GTJ J;  5L3G A;  1VQ4 I;  1W4M A;  4HQM A;  4IHV A;  1I5Z A;  2MFZ A;  5L3C A;  3S2H J;  1W1W E;  2JZY A;  3CTA A;  4AUX A;  1X3Z B;  1S7E A;  3GME A;  4LLL A;  1PUE E;  4F3Q A;  2DA6 A;  1R23 A;  4NQW B;  4KT6 A;  3BG5 A;  1P7I A;  1Q1H A;  4TV7 A;  3L2U A;  5M3F J;  2VKV A;  1KU2 A;  1PUF B;  3TKY A;  1EJ9 A;  2E1O A;  3ABK H;  3ESW B;  3Q2R A;  3BCB A;  1VQO I;  1B1B A;  4RB0 A;  1MMN A;  2NOG A;  3HM5 A;  2F4I A;  3BTJ A;  3HZJ A;  5GPC A;  3L2C A;  4LD5 A;  1L3L A;  4E7J A;  1NG7 A;  2OQG A;  4DBR A;  1S9H A;  2GXG A;  3V42 A;  2ZFW A;  2PEX A;  1TW3 A;  2HKO A;  3CCE I;  4YFN F;  2HPI A;  4ESF A;  3F8F A;  4NUI A;  3MCZ A;  1E3P A;  3OSG A;  4B1R A;  2LRD A;  5IPA A;  2JMW A;  3OOU A;  3FBN B;  4OU0 A;  2XV4 S;  2DLL A;  1PP7 U;  1HLV A;  5LLQ A;  2BY3 A;  3EUA A;  5JFR A;  5IYC J;  4YIF A;  2KFD A;  2CQQ A;  5F1J A;  3ZPL A;  5B1A H;  2FOK A;  2VN2 A;  2M30 A;  4M74 A;  1K7A A;  3GCM A;  4IRG A;  4Z6Y A;  2W85 A;  4OWR B;  2W57 A;  5D4R A;  4I2O A;  1IG7 A;  3MKW B;  4QPQ A;  2JSP A;  2P6S A;  2AXL A;  3LQR A;  4U0V A;  1YJ9 I;  1QBJ A;  2H1L A;  4CCM A;  4GO1 A;  1VQN I;  2LR8 A;  3T8R A;  3H0G J;  2Y30 A;  1BI3 A;  2LY1 A;  1RPW A;  3HB9 A;  2JRT A;  1KQ0 A;  3CLO A;  3PQK A;  1FTT A;  2DA2 A;  3FKI J;  2L5Q A;  4KNY A;  3BZ6 A;  1OPC A;  1P2F A;  1XCV A;  2JTV A;  3CC7 I;  2NRA C;  1LNW A;  1O7F A;  1XMX A;  2R5Y B;  3S1N J;  2HOE A;  1RET A;  2LK2 A;  3RKY A;  4YRV A;  4NUO A;  2K4J A;  2RQQ A;  3AFH A;  4ZDL A;  1IN5 A;  4IO9 F;  3VWB A;  4P9U A;  2DJI A;  2Z2S B;  4XON A;  5ERI A;  5EZG A;  4BE2 A;  2IGM A;  2K9N A;  5E3O A;  4IRI A;  2EIJ H;  2HYG D;  3G1M A;  3RPU A;  1ETX A;  1HXD A;  4AD9 A;  3GFI A;  5C4J J;  1WVR A;  2IPQ X;  4BHC A;  4BE0 A;  1JUS A;  3EPZ A;  1XGS A;  2FD5 A;  4PGG A;  3BR0 A;  4HNU A;  1OMI A;  3A0B C;  3E0J B;  2R5Z A;  1FY7 A;  3F72 A;  4BUP A;  1F36 A;  4GYG A;  5HOO A;  3OSF A;  2HQ5 A;  1XC5 A;  2CWE A;  1FWZ A;  1YJW I;  4CYD A;  4CHU A;  1MMD A;  1SMT A;  4G7H F;  4I76 A;  2V1X A;  1UAA A;  4XKC A;  3UR3 C;  2NAZ A;  3IAM 2;  4FE4 A;  4XMY A;  3FHZ A;  2VZN A;  4ZYD A;  4ZYA A;  4B3A A;  1XD7 A;  2K9M A;  3HUG A;  1S6L A;  4UVB A;  5JYS A;  2V6C A;  2R7O A;  5CVI A;  5DS9 A;  2L9N A;  4Q4Z F;  1MDM A;  4UVC A;  4EGZ A;  3HGG A;  5J47 A;  5EGO A;  5C3E J;  3VOE A;  1HDD C;  1JJ6 C;  3AG1 H;  4XID A;  3G6E I;  2ME6 A;  4MEY F;  1FT9 A;  2XB5 A;  2M5W A;  5E1Z B;  3CCQ I;  4DYC A;  3IAS 2;  4XOR A;  1V5E A;  4EVI A;  3HC7 A;  2R7W A;  5DCM B;  2O6G E;  2O5R A;  3QPT A;  3RYR A;  1NH3 A;  2ZBK A;  1TW2 A;  3V7R A;  2WAQ A;  3HJE A;  2BZT A;  3CUO A;  2QBY A;  3TGN A;  2Z9O A;  2O8X A;  3S2D J;  2NVX J;  1UG2 A;  3VPR A;  4KT5 C;  4BGD A;  2KQR A;  4HAM A;  4A3J J;  4CYC B;  1U9O A;  3KEY A;  1O3R A;  3V7S A;  1O3Q A;  4D5F A;  4OIR F;  4NUN A;  1G3Y A;  4XRS G;  1ZAO A;  4Y7N J;  4FAS D;  4N0B A;  1IN7 A;  3DBL B;  2M3A A;  2YR2 A;  4U88 A;  4A3F J;  1EH6 A;  1JKP C;  3TP3 A;  2VC0 A;  1XMK A;  3L2R A;  5D6F A;  2V79 A;  5CQE A;  2H94 A;  3JTG A;  1IRF A;  2CW8 A;  2DTZ A;  3O2P E;  2A6E F;  4G94 A;  2P0W A;  2E1M C;  3FM5 A;  4OIQ F;  3R6S A;  4E70 A;  1RC9 A;  4F92 B;  3LWF A;  3WTV C;  3BT9 A;  3LSJ A;  3T5X A;  4E4H A;  3BPX A;  1HQC A;  5EDN A;  1XN7 A;  2JJ7 A;  3DPT A;  4E7Z A;  3IL2 A;  5K5Q A;  1N77 A;  1XPX A;  3SZG A;  3F8M A;  2HNH A;  3QU3 A;  5AIQ A;  4U7D A;  2NYX A;  5LHI A;  4ZTF A;  3ZQH A;  2IVM A;  3SQN A;  2VJJ A;  1T95 A;  2RAE A;  3KLN A;  4F55 A;  1U8B A;  1T08 B;  5D4S A;  1WI3 A;  1T38 A;  1T56 A;  1ZHF A;  4RLQ A;  3DLL F;  1OLT A;  1IGN A;  2EZK A;  3ZXS A;  4LG0 B;  3K6G A;  2N8G A;  1YX5 A;  1ZR4 A;  1W5S A;  3VSL A;  5CVJ A;  2KDO A;  1YFH A;  2Z16 A;  3QU6 A;  1ONV A;  1Z05 A;  2FU4 A;  2DU9 A;  1ERD A;  1S29 A;  1Y56 A;  1NTC A;  2BW3 B;  5FLV A;  1OYW A;  2FQ4 A;  3K4L A;  2IEK A;  2CUZ A;  2FQ3 A;  1ZQ3 P;  1JXS A;  2FX0 A;  2L54 A;  4JX6 A;  3OL3 A;  3GVA A;  4XLP F;  1ZG5 A;  4PZJ A;  3IC7 A;  3KLO A;  2BHZ A;  2F4M B;  3FKJ A;  3ONQ A;  4XLA A;  5HDG A;  2CH0 A;  2K9S A;  4ENM A;  4XRS A;  1I3A A;  1WJD A;  4EM2 A;  1HW1 A;  3CC4 I;  1D1C A;  2DOA A;  3BR2 A;  3TBI A;  1MD0 A;  3CO7 C;  2VOD A;  5BPD A;  2TDX A;  4LK0 F;  3FXU A;  1OCC H;  5HDN A;  5CPR B;  4X6A J;  2QUF A;  2JK3 A;  3QPS A;  2DBB A;  4BQO A;  1LFP A;  3V7C A;  2EQR A;  3B73 A;  4H0A A;  2RNJ A;  1SFK A;  4FHT A;  2EZL A;  3NWS A;  2ME0 A;  1B6A A;  2DK8 A;  3C3W A;  4NHJ A;  3I9V 2;  4A3D J;  3A01 A;  1F43 A;  2CS3 A;  4KN7 X;  5J4Y A;  3I3L A;  4BQN A;  3FIW A;  2A6T A;  1G6N A;  1R6R A;  1V5G A;  3AG2 H;  1SFX A;  4XLN F;  1SFU A;  3GXO A;  3HSF A;  4RAY A;  3I5U A;  2JN6 A;  1X2M A;  4RAF A;  2DQL A;  4FT8 A;  1WJE A;  2X6O A;  4HZF A;  1F9N A;  3OYB A;  2B9S A;  3TW6 A;  1CGP A;  4IHX A;  4M9X A;  2QQB A;  4JBA A;  2CUE A;  1VQ9 I;  3OS0 A;  1A5J A;  2L01 A;  4RBO A;  3LAJ A;  4MGR A;  1FLI A;  2MH2 A;  2BXZ A;  1GT0 C;  3LSG A;  4B43 A;  3CMY A;  4QIW N;  2KP6 A;  1BIB A;  3ZQ7 A;  3CP8 A;  4G9Y A;  4RGR A;  4L0Y B;  3MZY A;  4EM0 B;  1U2W A;  1OKR A;  3F9K A;  2YPR A;  1BBY A;  3LA7 A;  1RNL A;  4D5C A;  3OMY A;  5DDG A;  2GZW A;  1K6Y A;  2ZJP F;  1XX5 A;  2A5Y B;  2DW4 A;  3ZMV A;  4ZC3 A;  3CCM I;  3JAM K;  3DKY A;  2DOD A;  3K0L A;  1LKX A;  2DTR A;  5M5W J;  3CLQ A;  3HOS A;  5TIS C;  1LDK B;  5FJ8 J;  5IOY A;  1F5T A;  1WJ5 A;  5LRS A;  2QSH X;  1MNE A;  2IAI A;  1HSJ A;  3ULQ B;  4AU7 A;  1X1A A;  1RES A;  4M6X A;  3NT8 A;  3OYG A;  3H9G A;  2EFP A;  3GZ6 A;  3WTY C;  1VQL I;  3HOV J;  4ASN A;  4KIF A;  4L0Z B;  3ZQF A;  5LHH A;  4JOM A;  2FMY A;  2JVG A;  1DU0 A;  2ETH A;  3I58 A;  2HZT A;  3KFW X;  1D0X A;  3VB2 A;  3Q5F A;  3DFG A;  3SFZ A;  3ABT A;  5CJ9 A;  2XVC A;  3O8G A;  1RI7 A;  3HRS A;  3ZP5 A;  4L18 B;  3LSP A;  1G3T A;  3MEX A;  5B66 C;  1ETY A;  3Q3S A;  4BE1 A;  1UB9 A;  2PMZ N;  3QPL A;  5ILV A;  1TWG J;  5KCM A;  2EV0 A;  3W6J B;  5LFA A;  1T39 A;  1WSU A;  2XIG A;  2HOS A;  3W2A A;  2EIL H;  4XIC A;  3I4M J;  1KA8 A;  3NRV A;  4MNU A;  3WG9 A;  1PDN C;  2EBI A;  1G2H A;  1EH7 A;  3GF2 A;  2M8G X;  5IY5 H;  4UNO A;  3QP5 A;  1OR7 A;  4E6K G;  3WHC A;  1N25 A;  2KKO A;  4RLF A;  3JSP A;  2ZJ2 A;  3ZMZ A;  4S05 A;  5FRM A;  3IRR A;  2Z5U A;  4J19 A;  3S8P A;  1VQP I;  3HHH A;  2A05 A;  3BPV A;  4HYE A;  5LRR A;  1BC8 C;  2VKD A;  1APL C;  1GXQ A;  3GLL A;  4A6D A;  2Z99 A;  4DQ2 A;  2VPR A;  2RC4 A;  2XSJ C;  4CO8 A;  1Y1W J;  3M8J A;  4B48 A;  1AKH B;  4M72 A;  1R7J A;  4HF0 A;  2UWM A;  4A0Z A;  4HLY A;  1BM9 A;  1FSE A;  2ID6 A;  2IS2 A;  4DZJ A;  2WB1 A;  3DKX A;  3RZO J;  2BVL A;  1IUF A;  4HDV A;  1VQ5 I;  1F1Z A;  2FSW A;  2X51 A;  2FA5 A;  2ZCW A;  3WE2 A;  4BEH A;  5F0C A;  2UV1 A;  2PN6 A;  2E1C A;  1HST A;  5FFZ A;  2I8D A;  1UJ8 A;  4EM1 A;  5H20 A;  2VXZ A;  3HOY J;  3A0H C;  3E6C C;  4ZDO A;  4XBF A;  4A0X A;  4KA4 A;  1SD6 A;  5LGN A;  2MC3 A;  3WGG A;  2Y75 A;  3RJP A;  1SAN A;  4IKF A;  2DA4 A;  3MFK A;  3LST A;  3PUB A;  3NWT A;  3K70 C;  3VYR B;  3LMM A;  1MW7 A;  2AHQ A;  5JVG F;  1D8K A;  2DAO A;  1IV8 A;  4I09 A;  4OIO F;  4W1U A;  2VI6 A;  4PSX A;  1WFX A;  4WXD A;  2FBH A;  4A5N A;  3VYT B;  5JR3 A;  2WBM A;  2RRE A;  4EJV A;  2QF7 A;  2DYS H;  3TO9 A;  4RDU A;  3OIP A;  3M9A A;  4YEJ A;  3T8T A;  1XSV A;  2CFO A;  2DK5 A;  1MBG A;  4ZYG A;  4AYB N;  3E3V A;  3G4S I;  3N4M A;  2H09 A;  2Q8K A;  3R4K A;  1ZLJ A;  3MZ8 A;  2LBF B;  2NNY A;  2BY0 A;  2DA5 A;  4MO7 A;  2PQ8 A;  1JI8 A;  1WJC A;  4BL0 B;  3D1N I;  2R3S A;  3SDB A;  3W2W A;  4HNV A;  1SAX A;  5L3B A;  1QVU A;  4MTE A;  1OCP A;  3A4C A;  3E5Q A;  3LFK A;  2E35 A;  2MLG A;  2XAH A;  5HOD A;  2JA2 A;  2YSR A;  3F8C A;  3HYI A;  1J59 A;  2P5K A;  2CW7 A;  1MSF C;  2XGC A;  2L0K A;  3M1E A;  1P6R A;  4HST A;  5K1Y A;  2GWR A;  3TO6 A;  1YJN I;  2ZXI A;  3RZD J;  2DFI A;  1W36 D;  2QBY B;  2M87 A;  2R7X A;  1UHS A;  3I64 A;  4LY5 A;  4XOP A;  5H6Q A;  2XPU A;  5B1B H;  5FRO A;  1HC8 A;  3BOQ A;  4HSR A;  3HBL A;  2EPF A;  3K2Z A;  4CYC A;  1B59 A;  3FXQ A;  2VOP A;  4NC8 A;  1JKO C;  4BXU A;  4DYQ A;  1HBX G;  4F7Z A;  3MKY B;  5J1Y A;  1MDM B;  5B5E C;  3OYC A;  1ZRC A;  1VQ6 I;  4X1E A;  4ZDP A;  4X0G A;  5F6F A;  1LB2 A;  2IA0 A;  3H5N A;  4B09 A;  5ETE A;  4Q47 A;  3ZQI A;  3FWE A;  5GTH C;  3DEW A;  1TBX A;  3HUG B;  3ZQQ A;  2M8E A;  5E1X A;  1MBF A;  2JA5 J;  5F27 A;  2R7Z J;  4P1W A;  4J01 A;  2FXA A;  2EWN A;  4NC6 A;  4GGG A;  1O3S A;  1HKQ A;  2C6Y A;  3FF5 A;  3DPU A;  3K69 A;  3MKL A;  1Z6R A;  3PM1 A;  2LVS A;  3WGI A;  1TP4 A;  4XNF A;  1BIA A;  1PYV A;  2VBW A;  3K9T A;  2BBY A;  4P27 A;  4M73 A;  4RAZ A;  1JKR C;  1STZ A;  2KIQ A;  3MMY B;  4HEA 2;  1YIT I;  2NOJ B;  3B02 A;  1YX3 A;  1S7A A;  2QKM B;  3ERM A;  3E6D A;  5A2Q K;  1IW7 F;  2WTE A;  4A3M J;  1WGX A;  3BG6 A;  4HPQ A;  2BE5 F;  2LRE A;  2EH3 A;  1WWX A;  4RM3 A;  3AAF A;  3ROU A;  3CCS I;  2M7B A;  2FML A;  3K4C A;  1J75 A;  3RKX A;  1Y0N A;  1KQ8 A;  1FC3 A;  3U2R A;  3CJN A;  1QU3 A;  1Y8R B;  3I56 I;  3HTS B;  4CCK A;  4N9H A;  1RRJ A;  2X0L A;  2YX7 A;  3P9K A;  1KQ9 A;  5C4X J;  3ZRG A;  4RGX A;  2W4S A;  2HVS A;  2CO5 A;  3WTU C;  4JYK A;  4HX4 A;  5IP6 A;  3DCF A;  4M3F A;  5EGO B;  5DUK A;  3SZP A;  1K61 A;  1VI0 A;  1X19 A;  4KMF A;  4D0P A;  1XSD A;  1JUM A;  1O4X A;  4CZZ A;  3L2V A;  3KP7 A;  3S15 J;  2CV0 A;  5BMZ A;  2MSY A;  1NG6 A;  3IWZ A;  4MEX F;  1ZLK A;  4OOI A;  3BR6 A;  2KJB A;  2XAG A;  2XAJ A;  1VQK I;  3G1L A;  2KZG A;  4LFU A;  2FNA A;  4M71 A;  1FYK A;  1R5G A;  1KU7 A;  2PX9 A;  4KIB A;  1LEB A;  1USS A;  1D5V A;  1GLN A;  1QGP A;  4IFA A;  1DUX C;  1TQI A;  2AS5 F;  2O8K A;  1ORK A;  2HVQ A;  3QP6 A;  5J4V A;  1EH8 A;  3CMA I;  3H5A A;  4LJZ F;  4RGU A;  1YHQ I;  2UXN A;  1E3H A;  2VBX A;  1Y1V J;  1K79 A;  4JK1 X;  1L0O C;  2Y0S A;  3CJT B;  4V19 K;  3PJR A;  2JUC A;  3FXL A;  2X6W A;  1WKM A;  4U0Y A;  1G8X A;  2IXS A;  4PDK A;  2GXB A;  4C30 A;  3I53 A;  2DA7 A;  2HI3 A;  1TQM A;  1MMG A;  1ACI A;  1G3S A;  3HOZ J;  3J81 K;  1YRN A;  1JTY A;  2V1D A;  2ZXW H;  1W5C C;  4JP0 A;  1FYL A;  1D3Y A;  1QVT A;  2QEN A;  4II2 A;  1LDJ A;  3DWL E;  2KIM A;  4WXH A;  2L7K A;  3I71 A;  2CMP A;  1K4T A;  4PCQ A;  1U5T C;  3HRM A;  4DW6 A;  5EEG A;  2XRO A;  2DA3 A;  3K4K A;  3JRF A;  2QQ8 A;  3ECO A;  1MIJ A;  3Q0U A;  3S1M J;  2ICW G;  2ADU A;  3SJM A;  2AO9 A;  3EUH A;  2Y0M A;  2E2H J;  2VJ4 A;  1IAW A;  3LSK A;  3OYN A;  1MMS A;  3HOX J;  1HKT A;  1A35 A;  2O9L A;  3M4O J;  3AG4 H;  5A2Q Z;  4BHP A;  5LEJ A;  2JVH A;  5GP9 A;  3M1C A;  2PJR B;  3K1M A;  2O7O A;  2KRF A;  1XDS A;  5FB2 A;  1AKH A;  2KHM A;  3OWT A;  3V8L A;  3BR1 A;  2G0E A;  3QOP A;  1AHD P;  3Q9V A;  2QKL B;  2HVR A;  1DDN A;  1GVJ A;  3KX2 A;  2R7Q A;  4IZZ A;  3CZ6 A;  1KU3 A;  4L5J A;  1B72 B;  3CP2 A;  3CDH A;  3WU0 A;  2J5P A;  4C3I J;  2RKH A;  3R0J A;  2DPD A;  1IRX A;  1QQI A;  4CA0 A;  4MFD A;  2OAZ A;  2H27 A;  3SDG A;  1TWF J;  2XPW A;  4AIH A;  2G7U A;  2ZXH A;  3TP0 A;  2A68 F;  2EA4 A;  4IVN A;  3WTW C;  5FKM A;  2M0M A;  4HNT A;  2YU9 J;  3O8H A;  2VT2 A;  5GPA A;  2MA3 A;  2VJI A;  4HW0 A;  1X1B A;  2ESN A;  3RCO A;  4YIR X;  1E3O C;  1LUJ B;  3QPH A;  2EIN H;  2GOM A;  2IGN A;  4Z2Y A;  3OR1 C;  2R7U A;  3E6B A;  1JTX A;  3V8K A;  4E7H A;  3QYB A;  1TWA J;  4AWX B;  3W3C A;  3EUH C;  2FUG 2;  3F6V A;  3IRQ A;  1FOK A;  1CF7 A;  2Z3Y A;  3IV5 A;  4FX0 A;  3HEF A;  3TL4 X;  2VKH A;  3FMR A;  4A3E J;  2LKX A;  2ISZ A;  4XRM A;  2FJ1 A;  2X1C A;  3JRE A;  1BI2 A;  1Z0X A;  3IWF A;  3OIQ A;  1V5F A;  1E2X A;  3SHF A;  1IRZ A;  4UV9 A;  3S1R J;  2QSF X;  3T1B A;  5H2F C;  2WC2 A;  1HDP A;  1SC7 A;  4LMY A;  2ZO4 A;  2LKS A;  2P7V B;  1IDY A;  2BEO A;  4PSW A;  2VBY A;  3VDX A;  5DCM A;  4M6Y A;  3MWM A;  1ZRF A;  5EJC A;  3G1O A;  3GTQ J;  2Q0O A;  1B8I B;  2ISY A;  3R0A A;  3VYS B;  4PJN A;  3S16 J;  5EZH A;  5L3D A;  3J7Z I;  1BW5 A;  1TTY A;  4HLX A;  4R79 A;  4LG3 A;  4C2T A;  4AYB A;  2R92 J;  1SVL A; 
#chains in the Genus database with same CATH homology
 1XX5 A;  4NUN A;  3U3U C;  4G2U A;  2DDB A;  4NUK A;  3S6S A;  3U3L C;  1CFE A;  1SMB A;  4AIW A;  3MZ8 A;  5ETE A;  1XTA A;  1WVR A;  2VZN A;  4H0A A;  2DDA A;  3Q2R A;  1QNX A;  4IFA A;  4LY5 A;  3Q2U A;  5JYS A;  1U53 A;  3S6V A;  2EPF A;  3NT8 A;  1RC9 A;  4NUO A;  2GIZ A;  2A05 A;  4D53 A;  3U3N C;  4TPV A;  3S6U A;  4NUI A;  4P27 A;  2CQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...