2DDKA

Crystal structure of human myo-inositol monophosphatase 2 (impa2) (orthorhombic form)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
267
structure length
258
Chain Sequence
PWEECFQAAVQLALRAGQIIRKALTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase 2
publication title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 73
structure length 258
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2ddkA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2ddkA02
5EQAA 1KZ8A 5I3SA 2JJKA 1FRPA 2Q8MA 5J16A 4GWWA 4HE0A 1IMBA 5LDZA 1XI6A 1LBZA 2BJIA 4O7IA 2QVUA 4I40A 1FBPA 1LBXA 1IMAA 4FBPA 4I3YA 2VT5A 1NUXA 4GWYA 1NV3A 2P3NA 2F3BA 1NV1A 1NV5A 1FPLA 1YYZA 5F24A 1NUYA 2Y5KA 3RPLA 3RYDA 1K9ZA 4GX3A 1YZ0A 2F3DA 2QVVA 3QMFA 4MJOA 1FSAA 3KBZA 4KXPA 4GWUA 4HE1A 2WEFA 1NI9A 4QXDA 5IZ3A 1NV4A 1SPIA 2FIEA 1NUZA 2P3VA 2OX3A 5EYGA 1FPGA 1QGXA 4G61A 1FPJA 1LEVA 1LBWA 5EQ9A 4PTKA 1BK4A 2FVZA 1K9YA 1RDZA 1DBZA 1FBDA 2OWZA 3BIHA 5T3JA 1LBVA 2CZIA 1EYKA 3LUZA 4HE2A 4HXVA 1NUWA 4AS5A 1LBYA 1FJ6A 1AWBA 1RDXA 1FPEA 3A29A 1KA1A 1FPBA 4H45A 3T0JA 1CNQA 4GWXA 5EYHA 2FIXA 1FPDA 4H46A 1NV0A 2FHYA 3IFCA 4GWZA 1FJ9A 2R8TA 1FTAA 5ESYA 4GBVA 1G0IA 1EYIA 1FBCA 5ET8A 1DCUA 3IFAA 2WBBA 1D9QA 2CZKA 1EYJA 2Y5LA 3RPLB 5A5LA 2PCRA 1INPA 1DK4A 1JP4A 1RDYA 2QFLA 5FBPA 2HHMA 5ET7A 1FBEA 4GX6A 3KC1A 1Q9DA 1YXIA 3BIGA 5EQ7A 5IZ3B 1NV2A 3B8BA 3FBPA 5ET6A 2Q74A 1NV6A 3ROJA 2WBDA 5DW8A 5IZ1A 4IR8A 4GX4A 1FBGA 3LV0A 4I3EA 1IMDA 2FBPA 4GBWA 1IMFA 2GQ1A 2DDKA 2QVRA 2CZHA 5EQ8A 4GWSA 4AS4A 3KC0A 5ET5A 1IMEA 1FBFA 1FPFA 1NV7A 1VDWA 4N81A 1KA0A 1FPIA 1FBHA 3D1RA 1G0HA 1IMCA 1FPKA
chains in the Genus database with same CATH superfamily
2ZYNA 4PAFA 3DM0A 4HCWA 2ZYOA 4O7IA 1B05A 4GXSB 4IB2A 4I40A 1B7UA 3K01A 1R6ZA 4GWYA 1HSLA 2F97A 3TZAA 3CVGA 2UYFA 4F18A 2W7YA 3OO9A 2WEFA 3LUYA 4PGNA 4F1VA 1N76A 2UVHA 2QJEA 4F3PA 2PBWA 1LBWA 3SKPA 4BDMA 4JSOA 3E9XA 3EQ1A 1BIYA 4H67A 2UVGA 4OVJA 3LSLA 3MAMA 1B3EA 3PD9A 1FQCA 4DLDA 2F36A 4P0GA 1B32A 4G68B 5ELVA 3KJ7A 1MQHA 3VE1B 5KCJA 2ZZWA 2HHMA 3EHUA 1UTBA 3K1NA 3U92A 3O9PA 3FZVA 3SEYA 1SI0A 2UVJA 3TELA 1IZ1A 3EN3A 3O66A 2Q8JA 4RA1A 3K2DA 4P8BA 1OLAA 3PGFA 5TPAA 3TTKA 1OIBA 1FPIA 1N3WA 4IO5A 1IMCA 4MMPA 3IAZA 5EQAA 2VP1A 4YB7A 5ITPA 2THIA 1DMBA 4ZZAA 5AE4A 3V8XB 1US4A 3VXBA 4IGTA 4RYAA 3H6TA 1USYE 2B4MA 4Z0IA 4HW8A 2GFEA 1MRPA 4XEQA 4U2RA 3VFJA 2HPGA 3R26A 2VD2A 5IZ3A 4NWDA 4KHZE 1B4HA 3KN3A 2D3IA 5I56A 2VHAA 1F9BA 4M1VA 1XS5A 1B3HA 3FXUA 3VVDA 4LP2B 4H8IA 2GHBA 3MZBA 3U1OA 1SD3A 3FVGA 1XC1A 1I6QA 1B9JA 1MQIA 1KA1A 2XXKA 2A5TA 1B52A 3BBRA 4LUBA 4IGRA 4EQ9A 4I1DA 3H4ZA 1D9VA 3TTMA 5AA4B 4RJZA 3OMBA 4DDDA 3RPLB 1D4NA 2V93A 2QRYA 1RDYA 4LQ2A 3S9MC 2QFLA 3HPIA 1OQHA 2RC7A 4NAPA 3RY3A 2RC8A 4K3FA 1SYHA 2CMOA 3O6GA 2QMXA 1OLCA 2CEYA 5FTHA 1KWHA 1N7WA 5JK4A 4KCCA 2GQ1A 4O3AA 1TWYA 4AB5A 3RT6B 5ET5A 4N8GA 2ZXTA 2ABHA 1L5TA 2I58A 4U1OA 3G3FA 4G2ZA 5EYFA 3JYRA 4X8RA 1FQAA 3VLVA 1AMFA 4N8YA 1AL3A 3OENA 1A8FA 4FBPA 5H8FB 3CSGA 2YJPA 4HCYA 2R9JA 4H5GA 4G68A 3FVNA 4JBZA 1FPLA 5CMCA 3IOVA 3O6IA 3RTFB 4P56A 3CG3A 2RC9A 4R9GA 5EQ9A 4IY6A 2GHAA 3C32A 4QFOA 3O2AA 4RXLA 3AXFA 1LBYA 1JW4A 2CZLA 2DS9A 3KZGA 1RDXA 4GWXA 1JVXA 5TP9B 4H46A 2DVCA 3C36A 1G0IA 1XOCA 1EYIA 4YKJA 5B7DA 3TTRA 3IORA 3V83A 1POTA 5FHOA 2O7IA 2HFBA 5A5LA 1B3LA 3PD8A 3Q29A 3PPRA 3QUJA 2KLFA 3FASA 2V84A 1XVXA 5IZZA 1GTKA 3Q25A 1Y1MA 2DVZA 1B6HA 1NNTA 3SDFA 4AS4A 1JEUA 1MXWA 3MWBA 3KN7A 2Q89A 1IMEA 4PBHA 2O69A 1QKAA 1II5A 1EZOA 4PFYA 4HE0A 3PMWA 5JEIA 4PFWA 2DP8A 3A3UA 3ONMA 4R6YA 2FNCA 1NV1A 1I6AA 5AA4A 1SYIA 1A7LA 3RPLA 4OESA 4GX3A 3I5OA 3IOTA 5H8QB 2Q2AA 2F78A 3MC2A 1TT1A 1SPIA 4PFTA 4XKQA 4U4XA 4PDHA 3OXNA 4MX6A 5B70A 2FVZA 4HTGA 4AB6A 3K6XA 1NUWA 1IQ7A 3OELA 1M5DA 5I2NB 1FTLA 5CMKA 2GRVA 2OCUA 1FPDA 4GWZA 1B5HA 3MSTA 3H6WA 3OO6A 3FXRA 2WBBA 1FW0A 4Z7EA 5H8FA 1B7HA 1RKMA 3OD7A 5ITOA 3T9HB 3KC1A 1DTGA 4GL8A 1NMUA 2ALUA 2H4IA 3KFMA 3UIFA 3FBPA 4U23A 1M5FA 2H25A 3B6QA 4THIA 3K6WA 3H7MA 2I0CA 2Q2CA 1YCJA 4WXJA 1P99A 4XIGQ 3D1RA 3IK6B 1IXHA 4F39A 1ZTYA 3K6UA 5DT6A 5I3SA 4H6DA 3B50A 3RTWB 1IXCA 2F7CA 4GWWA 3B6WA 4OYVA 3T96B 5IGAA 2R6GE 4KPTA 4O3BA 4GXAA 4ZECA 2V4CA 2DWIA 1CE2A 1H76A 1UTHB 4GLIA 4F1YA 1ZIUA 3QMFA 1MQGA 2O51A 4KXPA 3O28A 4NE4A 1NFTA 4ZZEA 4XTCQ 2P3VA 3C31A 2PX1A 4GOTA 2XA5A 3PUYE 2F35A 3MPLA 3BIHA 4F19A 1FQBA 3OSQA 4ZE9A 4XF5A 2XD2A 2QS4A 3T0JA 1CNQA 2XXWA 5EYHA 2DQVA 2Y84A 4QFKA 4YMBA 4OVTA 3B6TA 2OJTA 3MQ9A 3MYUA 2OWTA 2XXHA 1D9QA 2CZKA 1IEJA 4MAGA 3USDA 3MPKA 1M5BA 3TQLA 3QIMA 2B3FA 4OXVA 3Q28A 1Q9DA 1QW0A 3CSBA 2DSFA 4ZEFA 1D3KA 3G3IA 5H8QA 2XXQA 5IZ1A 1B0HA 5M2VA 4G4PA 1LBCA 2NXOA 4PAKA 4ZEKA 4N13A 3TODA 3C9HA 2PT2A 4YICA 4POXA 4O3CA 4QFPA 4DE8A 2XX9A 4Q8RA 1MM7A 4P3LA 4OFLA 1POY1 1P1OA 1N0TA 1FRPA 5LDZA 3QAXA 3TTNA 2XWKA 2BJIA 3SEWA 5I2NA 1WVJA 3C33A 1B2HA 3FGSA 4Q0CA 1LCFA 4ESWA 1FBPA 1LBXA 2H9BA 3K00A 4PDDA 1NUXA 2P3NA 3U93A 4KR5A 1DOTA 2XWOA 3KG2A 5CC2A 5F24A 3MZ9A 1B1XA 5AA2B 1MG1A 2E0SA 4HE1A 1QUJA 2V3QA 4MH5A 1O63A 4KQPA 4FIMA 2F6PA 2FIEA 2ONRA 4ZDMA 4G61A 1OMPA 4PTKA 3FATA 4G8NA 3UORA 4AS5A 1QUKA 4R74A 5CBRA 4ELQA 1A8EA 1NV0A 2DE3A 2NVUB 2PFZA 4MIJA 1P1NA 1ZLQA 1LB8A 3KOSA 3PUZE 4PQJA 5CBSA 5K2XA 1AIVA 2G93A 2CEXA 3JV9A 4FEBA 1ELJA 3PMXA 4DCXA 4PF8A 1UTHA 3FJMA 1Y4TA 2RINA 1PB9A 3N94A 4O7MA 2XX8A 2XD3A 3LSXA 3T9UA 4ECFA 4LVQA 3RGYA 3SZPA 1MXXA 1N84A 2Z23A 4TLMB 1FBFA 4R2BA 4UACA 2I0BA 1VDWA 4BDOA 1MY2A 3VVEA 3RT8A 3MP1A 1FPKA 4F2QA 4F22A 3N26A 2JJKA 1SW5A 3MVYA 3QXMA 3IJXB 1B3FA 5H8NA 5HPQA 4YAHX 4POWA 4XFEA 4XKPA 1SI1A 4C1UA 3RN8A 3KOTA 3SESA 1ZJLA 3MP8A 4MJOA 4BDRA 1PB7A 2Y7IA 4X48A 3E13X 3VV5A 3K6VA 1EU8A 2M8CA 1Y20A 1PEBA 2XHDA 1BK4A 1RYOA 2OWZA 5TU0A 1S7YA 4HE2A 2UXAA 3UGWA 2XXXA 2A5SA 1DSNA 1FJ6A 2FA7A 4PE5B 2QS2A 1FCKA 3A29A 1PDAA 4PFIA 1MXYA 3IOWA 3UA8A 4BDNA 2QPQA 3TCHA 4LZ5A 2PCRA 4IO2A 1NNKA 3TDJA 1YXIA 1H44A 1MQDA 2XXRA 3I3VA 5BWJA 5I7IA 1LFIA 5AA2A 4N07A 4YB5A 3ZKKA 2XXUA 1RYXA 1R1NA 5I84A 1B5JA 2KR0A 4KYEA 3LSFB 1FQFA 4GQOA 3JZJA 3PV0E 4PCDA 3W9VA 3CFLA 2HAUA 4MF3A 4C0RA 2F34A 3NOHA 1ANFA 4NMYA 4ESXA 4H0WA 5CMMA 4YZZA 3T9XB 4NHBA 4LATA 1VFDA 3OOAA 3FXQA 1GV8A 4XKRA 5KZTA 5ICQA 1NV5A 4KCDA 4GL0A 3N6UA 2ZZXA 2OWSA 2B3BA 3PPNA 3E79A 3S9NC 2GH9A 5AA1A 3UN6A 1I69A 4BLAA 1LEVA 3OEMA 3K1MA 1B51A 1FTOA 3K4UA 5T3JA 3FJ7A 4ZEDA 2IA4A 4WEPA 4FE8A 1ZBMA 3SEUA 4JVIA 3TAJA 3FVKA 1JQFA 1MPDA 5AA3A 4OFJA 2F8DA 2FIXA 1GGGA 4ELPA 4QSDA 4G8HA 1FTJA 5ET8A 4M4GA 2PFYA 2KQZA 3KJTA 3VVFA 1S9TA 4ONYA 3DP8A 1XT8A 4ELOA 1MY3A 1EH3A 3EKIA 1TFDA 1OQGA 4YU0A 4JVDA 2I49A 1Y9UA 3KC0A 3T93B 4YKPA 2ZZVA 2DWAA 3GXAA 4N81A 1SW2A 4MFIA 5J1DA 2I6EA 2OPDA 1IMBA 3OSRA 4PAIA 3GBAA 2O1MA 5JTYB 4I3YA 1LGBC 2DE2A 4H1XA 4YKIA 3M3FA 4EDPA 4MEVA 3TQWA 3Q26A 4QXDA 1AOVA 4RK9A 5H8HB 3ZKLA 3TKDA 1BTJA 1J1NA 1MXZA 4PE3A 3VDFA 3ZSFA 2PT1A 2DE4A 4N6KA 4NWCA 4DXBA 2H5YA 2HAVA 3G3GA 2O6AA 2G29A 1WODA 2FYIA 2CZIA 1BLFA 4N6DA 4P47A 2BJJX 3MW0A 3G3HA 3PUWE 2RCBA 4KYSA 2I4BA 4EQ7A 5HM4B 4JDFA 2VD3A 3FV1A 3SEVA 1DTZA 2HZKA 3UP9A 5I59B 2NOOA 2NUVA 3S9EA 1HSJA 1N7XA 4RK2A 5EHSA 1EYJA 1Y3PA 5A5XB 5DYHA 5ET7A 4GX6A 4P9KA 1IITA 5CM6A 1EZPA 1NV2A 2Z8DA 1NV6A 3M8UA 4AQ4A 4PP0A 4Q5TA 3PUXE 1IMDA 4OWDA 4FORA 3WAEA 4P1LA 3IO6A 4IO4A 4XXUA 2NWJA 1QULA 1H45A 1USYH 5I58B 1NV7A 5ICTA 1Z7NE 3C4MA 3GBBA 3KGCA 3FV2A 4NF6B 4KYDA 4L17A 4MBPA 4PETA 3TUSA 4N6PA 4GD5A 3RUMA 3IB0A 2F3BA 4JXIA 4Q30B 4F3GA 4QF9A 4DI3D 1QKBA 1MPCA 4MNPA 4O8MA 2IEEA 1VR5A 2Z8FA 2QMWA 2Q88A 4OVQA 4X04A 1O7TA 2XXTA 1NV4A 1URGA 1NUZA 4PFUA 3IX1A 1QGXA 4F3SA 1FPJA 2X26A 3SEXA 1Y3QA 1FBDA 1DPPA 4LZ7A 1EYKA 3HHGA 1Z7ME 4UA8A 1IUDA 4ZEBA 4F3BA 1JW5A 1PBPA 1SDXA 2Z22A 4UABA 4NN3A 3M3LA 1O64A 4I62A 4OTEA 4EF2A 2UYEA 3HHFA 2PYYA 2RCAA 5JTYA 1A99A 4QSEA 3CIJA 1URDA 4QHQA 2REJA 1FBEA 5EHMA 1P1QA 1JEVA 4LZ8A 5H8NB 4WKMA 1VE4A 2DWHA 3LV0A 5H8HA 3MVWA 4PBQA 1JETA 3M3KA 3FJGA 4GWSA 1FTKA 3IOUA 4GRKA 4OVRA 4P1EA 4OEVA 1US5A 4JWYA 4DI4B 3F11A 4YMAA 2Q8MA 4FECA 2OZZA 4OFOA 2OPEA 5I59A 1B1HA 4R73A 1M5CA 4U21A 5LTCA 3RYDA 1K9ZA 4BDQA 1LAXA 2F3DA 5A5XA 1MY0A 3KBZA 4PC9A 2ZNSA 4R72A 2D5WA 4NGUA 3B7DA 2OX3A 2ZNUA 4OZ9A 2ONKE 3IO4A 2WYPA 1PB8A 2OK2A 5I58A 5F7VA 3G7WA 1AWBA 4NF4B 4ZE8A 3ISPA 2F7AA 1XHYA 2FHYA 2R8TA 4E0WA 1QVSA 3HO7A 4NF6A 2ZMBA 1DCUA 2HEUA 1HSEA 4NTLA 1JNFA 1SW1A 3ILUB 3TCGA 1YTVA 3MVZA 5ET6A 1MXVA 3HCQA 3A09A 1CB6A 1FTMA 1IMFA 3KSXA 1T0KA 2ZNTA 3IB1A 4WEDA 3FVOA 5ISUA 3PU5A 2ESNA 3IL1B 4FEDA 3SETA 3GZGA 4FAJA 1B5IA 4U22A 1Q1KA 2P0SA 4N17A 1MXUA 1B40A 1MH3A 5J16A 4NF5B 3BKIB 1LBZA 4RNSA 3KSJA 3Q27A 2QVUA 1IMAA 2OLBA 3TTLA 5L9SA 4RPNA 4QRZA 2DWJA 1YZ0A 3ODBA 4GWUA 3PMVA 1I6BA 4FJPA 2OBGA 5H8SA 4GIZA 3HN0A 4U1ZA 1EZ9A 1D9YA 3O6HA 5HBCA 5EYGA 4TQUQ 2DOJA 2RKMA 4ND9A 4PF6A 3PPPA 3U94A 4IO7A 3IR1A 1DBZA 1MY1A 2AIXA 3H06B 1MDP1 4OETA 1Y1ZA 3MUQA 1TFAA 4P0IA 4JB7A 5KDTB 2P2AA 3W9WA 1MM6A 4NF8B 2F5XA 3O97A 3MBPA 5ESYA 4MNIA 2QS1A 2O7UA 2Y7KA 1R9LA 4PGPA 3K1PA 4TOZA 1R9QA 1B4ZA 2X7PA 2I3VA 1INPA 4R9FA 4OEUA 5FTIA 1MS7A 3GYYA 4O94A 5FHNA 3MP6A 2XXVA 5L9OA 2Q74A 1Q35A 2DYXA 3MJNA 4ZS9A 1IXIA 3TCFA 2HZLA 2HXRA 2ZYMA 1NNPA 2VPOA 1SW4A 3PUVE 1FQDA 3QYTA 3RQTA 4EF1A 3PPOA 2AYSA 3FIRA 1FPFA 4EUOA 3D4GA 4FATA 4JWXA 3H3GA 2VPNA 5LOMA 1KZ8A 4NF4A 3S4UA 2Y7RA 4DCYA 3S2VA 2H98A 3P7IA 2VT5A 3HFUA 2AL4A 4X1BA 1GVCA 2HQ0A 4F29A 3LSWA 5I57B 1NUYA 3SERA 2Y5KA 1ZMGA 5L8DA 4DZ1A 3MVXA 4YB6A 2XWVA 1DPEA 2WKYA 5DVJA 4RPOA 3A3CA 4DXCA 1TXFA 1LBVA 4MLVA 1M5EA 4GF8A 3G3JA 3U72A 4HS7A 1IIWA 4H8JA 3TMGA 2YPNA 4NF0A 4QSCA 3LC8A 5DVFA 1FTAA 3DP4A 1LB9A 4NF5A 3IFAA 4IY5A 3EPEA 2Y5LA 1BP5A 1FQEA 3OO7A 5FBPA 3GLBA 4PFRA 1LBBA 2V3TA 2DXYA 2Y7WA 4PFBA 4IO6A 1N04A 5DW8A 5AA2D 3TPAA 4GX4A 1H43A 2XXPA 4X1DA 3N5LA 1NH8A 4I3EA 2XXIA 3CI8A 1UIVA 1A40A 2DDKA 5EQ8A 2D21A 1XVYA 2O84X 1B0LA 4EXLA 1GR2A 4P11A 4QFLA 1MY4A 5FHMA 4OVPA 2HXWA 1Y4CA 4G77A 4JWOA 3IJOB 1A54A 5KDTA 1H3DA 4NF8A 2VGQA 2WX9A 4ISUA 1LAHE 5IM2A 3PPQA 4OMBA 1OVTA 1NV3A 4E0XA 4GVOA 1YYZA 1MQJA 3KEIA 1VSOA 3CFZA 5I2KB 1ATGA 4XKNA 2QVVA 2QS3A 2V3UA 4H5FA 4N4UA 4NQ8A 2UVIA 1QUIA 3ILTB 1SVXB 3H6UA 4OHNA 1FPGA 4I8CA 3W15C 3MZ1A 3N6TA 3ZS6A 3O29A 2PMSA 5IAIA 4GWOA 1RDZA 3FD3A 2LAOA 2QSXA 3LUZA 3TFLA 3HV1A 3QSLA 2I48A 1LAFE 2MKZA 3V5AA 1FPEA 2WYKA 3E3KA 5L9MA 2X7QA 1LAGE 4GBVA 1P1WA 2AL5A 5CRYA 3UK4A 4DXUA 1MH4A 4GFRA 5CMBA 2F6GA 3VLWA 4LN5A 4EQBA 1B7ZA 2L5VA 4G8MA 2XX7A 5I57A 4ELRA 3S9LC 3ROJA 3BFUA 2HCAA 4IO3A 3TYHA 3RLFE 5IKBA 2CZHA 2O1LA 4X9TA 3EHSA 4EXKA 1NNFA 4R6HA 3TEPA 1NKXA 3T22A 1OVBA 1A55A 3LR1A 5F1QA 1AH5A 4BDLA 1LLSA 3I6VA 4KD5A 3QK6A 4QFNA 3FUZA 1PC3A 2I3WA 2RF1A 2XWIA 3E78A 3T66A 1B58A 1JVYA 4N91A 4F2OA 5DEXB 4OERA 3E4RA 1B46A 1S50A 4RY1A 4KI0E 2Y7PA 4OANA 4R6KA 2Q9TA 2B65A 1FSAA 2Z8EA 2R71A 1NI9A 4OQOA 4LQ5A 4NEDA 1LFGA 1NL5A 3T1BA 1UQWA 4LONB 2H99A 5BUUA 1K9YA 3WAFA 5DTBA 3VXCA 4TLLB 3DELB 4HXVA 3HSTA 3KN8A 2F7BA 1B3GA 1ZU0A 1SBPA 2P1SA 1JW1A 2ANJA 3IFCA 1FJ9A 1YPNA 3U8QA 2B4LA 2ZYKA 1FBCA 1MDQA 3CRBA 5CI5A 3OO8A 1DK4A 1JP4A 1LFHA 4I9DA 4G68C 4OENA 1IXGA 5I2KA 3BIGA 5EQ7A 2QL3A 3L6GA 4OVSA 1Y3NA 1BKAA 3PTYA 4IR8A 1FBGA 2DXRA 3DLNA 5TP9A 4GBWA 4F1UA 4R2FA 3ECRA 3K0VA 3H03A 3VLUA 1G0HA 3DP6A 3BFTA 2E1SA 3KBRA 3H6VA 3RPWA 1XI6A 2REGA 3CHGA 4NG7A 4ZEIA 3IB2A 5KCJB 3U65A 1NH7A 1SQYA 3R6UA 4DIGA 1MPBA 4JSDA 1LCTA 3THIA 1UTBB 4H65A 1LSTA 4LA9A 4R75A 2YLNA 1ZKBA 3CG1A 2VOZA 1P1UA 4C1TA 1VFEA 1WDNA 3LBSA 3T9VA 3CFXA 4MHFA 1UIUA 1PBQA 5TPAB 2PVUA 4KFQA 4YKKA 3QUFA 4U4SA 2ONSA 4MCOA 4NX1A 5K2YA 1FPBA 4JVCA 4H45A 1YAEA 3EF7A 4MLQA 3D4CA 3L6HA 4F31B 3C35A 2XXYA 3K02A 2V25A 3RNNA 5DEXA 2O68A 4MNCA 5IZ3B 1QJMA 2I4CA 3B8BA 3R7XA 3V89B 5I56B 3C34A 2WBDA 4N15A 5I5PA 1N3XA 2FBPA 2QVRA 4QBAA 3G3KA 3EHTA 3OEKA 5DVIA 4OA4A 3FXBA 1KA0A 1URSA 1FBHA 2A5TB 3CR9A
chains in the Genus database with same CATH topology
5J1DA 1KZ8A 5I3SA 3B50A 4PAFA 4GWWA 1IMBA 4HCWA 5IGAA 4PAIA 4O7IA 4I40A 4I3YA 2VT5A 3HFUA 2DE2A 4GWYA 2V4CA 1NUYA 2Y5KA 4MEVA 4F18A 3QMFA 4KXPA 2WEFA 4PGNA 4QXDA 4F1VA 2P3VA 4PE3A 1LBWA 2DE4A 2XWVA 4N6KA 2XA5A 3BIHA 1LBVA 2CZIA 4F19A 4N6DA 4P47A 4NF0A 4XF5A 3T0JA 1CNQA 5EYHA 4OVTA 1FTAA 2HZKA 3MYUA 3IFAA 1D9QA 2CZKA 4MAGA 1EYJA 2Y5LA 2ZZWA 5FBPA 2HHMA 4PFRA 5ET7A 4GX6A 4P9KA 5CM6A 1Q9DA 1NV2A 4PFBA 1NV6A 5DW8A 5IZ1A 4GX4A 4I3EA 1IMDA 4PAKA 2DDKA 5EQ8A 4P1LA 4YICA 4P8BA 1NV7A 4P3LA 1FPIA 4MMPA 1IMCA 4OVPA 5EQAA 1FRPA 5LDZA 2XWKA 2BJIA 4PETA 2WX9A 1FBPA 1LBXA 5IM2A 4PDDA 1NUXA 1NV3A 2P3NA 2F3BA 2B4MA 2XWOA 4DI3D 1YYZA 4MNPA 5F24A 4XEQA 4O8MA 2QVVA 2HPGA 4N4UA 4NQ8A 4HE1A 2V3QA 4OVQA 4X04A 5IZ3A 1NV4A 2FIEA 1NUZA 1FPGA 1QGXA 4G61A 1FPJA 4M1VA 4PTKA 1RDZA 1FBDA 1EYKA 3LUZA 4AS5A 2MKZA 1FPEA 1KA1A 4UABA 2XXKA 4NN3A 2WYKA 1NV0A 2DE3A 4GBVA 2PFZA 4MIJA 3RPLB 2CEXA 1RDYA 2QFLA 4LN5A 1FBEA 4PF8A 2L5VA 4NAPA 3ROJA 4O7MA 2CEYA 5JK4A 3LV0A 2GQ1A 4PBQA 3SZPA 2CZHA 4X9TA 4GWSA 5ET5A 4N8GA 4OVRA 1FBFA 1VDWA 4P1EA 1FPKA 4DI4B 2JJKA 4X8RA 2Q8MA 4N8YA 2XWIA 3E78A 4FBPA 4N91A 4XFEA 4HCYA 1FPLA 5LTCA 3RYDA 1K9ZA 4OANA 2Q9TA 2F3DA 4MJOA 1FSAA 3KBZA 4PC9A 1NI9A 4P56A 4NGUA 2OX3A 3T1BA 5EQ9A 1BK4A 1K9YA 2OWZA 4HE2A 4HXVA 2WYPA 1LBYA 1FJ6A 1AWBA 1RDXA 3ISPA 3A29A 4GWXA 4H46A 2FHYA 3IFCA 1FJ9A 2R8TA 4PFIA 1G0IA 2B4LA 1EYIA 1FBCA 1DCUA 2QPQA 5A5LA 2PCRA 1DK4A 1JP4A 1YXIA 3BIGA 5EQ7A 5IZZA 5I7IA 5ET6A 4OVSA 3PTYA 4IR8A 1FBGA 2KR0A 4GBWA 2DVZA 1IMFA 4F1UA 4AS4A 4PCDA 1IMEA 3W9VA 4PBHA 1G0HA 3NOHA 4N17A 5J16A 4HE0A 4YZZA 4NHBA 1XI6A 1LBZA 3CHGA 4NG7A 2QVUA 1IMAA 3U65A 1NV1A 1NV5A 3RPLA 4GX3A 1YZ0A 2ZZXA 4GWUA 3E79A 1SPIA 5EYGA 1LEVA 4MHFA 4PDHA 4PF6A 4MX6A 2FVZA 1DBZA 5T3JA 1NUWA 4JVIA 4MCOA 4NX1A 1FPBA 4JVCA 4H45A 3W9WA 2FIXA 1FPDA 2F5XA 4GWZA 5ESYA 4MNIA 5ET8A 3MSTA 2PFYA 4PGPA 2KQZA 2WBBA 1INPA 4MNCA 3GYYA 4O94A 3KC1A 5IZ3B 3EKIA 3B8BA 3FBPA 2Q74A 2WBDA 4N15A 5I5PA 2HZLA 2HXRA 2FBPA 2QVRA 2VPOA 4JVDA 4QBAA 3KC0A 2ZZVA 1FPFA 4N81A 4OA4A 3FXBA 1KA0A 1FBHA 2VPNA 3D1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQA A;  1KZ8 A;  5I3S A;  2JJK A;  1FRP A;  2Q8M A;  5J16 A;  4GWW A;  4HE0 A;  1IMB A;  5LDZ A;  1XI6 A;  1LBZ A;  2BJI A;  4O7I A;  2QVU A;  4I40 A;  1FBP A;  1LBX A;  1IMA A;  4FBP A;  4I3Y A;  2VT5 A;  1NUX A;  4GWY A;  1NV3 A;  2P3N A;  2F3B A;  1NV1 A;  1NV5 A;  1FPL A;  1YYZ A;  5F24 A;  1NUY A;  2Y5K A;  3RPL A;  3RYD A;  1K9Z A;  4GX3 A;  1YZ0 A;  2F3D A;  2QVV A;  3QMF A;  4MJO A;  1FSA A;  3KBZ A;  4KXP A;  4GWU A;  4HE1 A;  2WEF A;  1NI9 A;  4QXD A;  5IZ3 A;  1NV4 A;  1SPI A;  2FIE A;  1NUZ A;  2P3V A;  2OX3 A;  5EYG A;  1FPG A;  1QGX A;  4G61 A;  1FPJ A;  1LEV A;  1LBW A;  5EQ9 A;  4PTK A;  1BK4 A;  2FVZ A;  1K9Y A;  1RDZ A;  1DBZ A;  1FBD A;  2OWZ A;  3BIH A;  5T3J A;  1LBV A;  2CZI A;  1EYK A;  3LUZ A;  4HE2 A;  4HXV A;  1NUW A;  4AS5 A;  1LBY A;  1FJ6 A;  1AWB A;  1RDX A;  1FPE A;  3A29 A;  1KA1 A;  1FPB A;  4H45 A;  3T0J A;  1CNQ A;  4GWX A;  5EYH A;  2FIX A;  1FPD A;  4H46 A;  1NV0 A;  2FHY A;  3IFC A;  4GWZ A;  1FJ9 A;  2R8T A;  1FTA A;  5ESY A;  4GBV A;  1G0I A;  1EYI A;  1FBC A;  5ET8 A;  1DCU A;  3IFA A;  2WBB A;  1D9Q A;  2CZK A;  1EYJ A;  2Y5L A;  3RPL B;  5A5L A;  2PCR A;  1INP A;  1DK4 A;  1JP4 A;  1RDY A;  2QFL A;  5FBP A;  2HHM A;  5ET7 A;  1FBE A;  4GX6 A;  3KC1 A;  1Q9D A;  1YXI A;  3BIG A;  5EQ7 A;  5IZ3 B;  1NV2 A;  3B8B A;  3FBP A;  5ET6 A;  2Q74 A;  1NV6 A;  3ROJ A;  2WBD A;  5DW8 A;  5IZ1 A;  4IR8 A;  4GX4 A;  1FBG A;  3LV0 A;  4I3E A;  1IMD A;  2FBP A;  4GBW A;  1IMF A;  2GQ1 A;  2DDK A;  2QVR A;  2CZH A;  5EQ8 A;  4GWS A;  4AS4 A;  3KC0 A;  5ET5 A;  1IME A;  1FBF A;  1FPF A;  1NV7 A;  1VDW A;  4N81 A;  1KA0 A;  1FPI A;  1FBH A;  3D1R A;  1G0H A;  1IMC A;  1FPK A; 
#chains in the Genus database with same CATH topology
 2ZYN A;  4PAF A;  3DM0 A;  4HCW A;  2ZYO A;  4O7I A;  1B05 A;  4GXS B;  4IB2 A;  4I40 A;  1B7U A;  3K01 A;  1R6Z A;  4GWY A;  1HSL A;  2F97 A;  3TZA A;  3CVG A;  2UYF A;  4F18 A;  2W7Y A;  3OO9 A;  2WEF A;  3LUY A;  4PGN A;  4F1V A;  1N76 A;  2UVH A;  2QJE A;  4F3P A;  2PBW A;  1LBW A;  3SKP A;  4BDM A;  4JSO A;  3E9X A;  3EQ1 A;  1BIY A;  4H67 A;  2UVG A;  4OVJ A;  3LSL A;  3MAM A;  1B3E A;  3PD9 A;  1FQC A;  4DLD A;  2F36 A;  4P0G A;  1B32 A;  4G68 B;  5ELV A;  3KJ7 A;  1MQH A;  3VE1 B;  5KCJ A;  2ZZW A;  2HHM A;  3EHU A;  1UTB A;  3K1N A;  3U92 A;  3O9P A;  3FZV A;  3SEY A;  1SI0 A;  2UVJ A;  3TEL A;  1IZ1 A;  3EN3 A;  3O66 A;  2Q8J A;  4RA1 A;  3K2D A;  4P8B A;  1OLA A;  3PGF A;  5TPA A;  3TTK A;  1OIB A;  1FPI A;  1N3W A;  4IO5 A;  1IMC A;  4MMP A;  3IAZ A;  5EQA A;  2VP1 A;  4YB7 A;  5ITP A;  2THI A;  1DMB A;  4ZZA A;  5AE4 A;  3V8X B;  1US4 A;  3VXB A;  4IGT A;  4RYA A;  3H6T A;  1USY E;  2B4M A;  4Z0I A;  4HW8 A;  2GFE A;  1MRP A;  4XEQ A;  4U2R A;  3VFJ A;  2HPG A;  3R26 A;  2VD2 A;  5IZ3 A;  4NWD A;  4KHZ E;  1B4H A;  3KN3 A;  2D3I A;  5I56 A;  2VHA A;  1F9B A;  4M1V A;  1XS5 A;  1B3H A;  3FXU A;  3VVD A;  4LP2 B;  4H8I A;  2GHB A;  3MZB A;  3U1O A;  1SD3 A;  3FVG A;  1XC1 A;  1I6Q A;  1B9J A;  1MQI A;  1KA1 A;  2XXK A;  2A5T A;  1B52 A;  3BBR A;  4LUB A;  4IGR A;  4EQ9 A;  4I1D A;  3H4Z A;  1D9V A;  3TTM A;  5AA4 B;  4RJZ A;  3OMB A;  4DDD A;  3RPL B;  1D4N A;  2V93 A;  2QRY A;  1RDY A;  4LQ2 A;  3S9M C;  2QFL A;  3HPI A;  1OQH A;  2RC7 A;  4NAP A;  3RY3 A;  2RC8 A;  4K3F A;  1SYH A;  2CMO A;  3O6G A;  2QMX A;  1OLC A;  2CEY A;  5FTH A;  1KWH A;  1N7W A;  5JK4 A;  4KCC A;  2GQ1 A;  4O3A A;  1TWY A;  4AB5 A;  3RT6 B;  5ET5 A;  4N8G A;  2ZXT A;  2ABH A;  1L5T A;  2I58 A;  4U1O A;  3G3F A;  4G2Z A;  5EYF A;  3JYR A;  4X8R A;  1FQA A;  3VLV A;  1AMF A;  4N8Y A;  1AL3 A;  3OEN A;  1A8F A;  4FBP A;  5H8F B;  3CSG A;  2YJP A;  4HCY A;  2R9J A;  4H5G A;  4G68 A;  3FVN A;  4JBZ A;  1FPL A;  5CMC A;  3IOV A;  3O6I A;  3RTF B;  4P56 A;  3CG3 A;  2RC9 A;  4R9G A;  5EQ9 A;  4IY6 A;  2GHA A;  3C32 A;  4QFO A;  3O2A A;  4RXL A;  3AXF A;  1LBY A;  1JW4 A;  2CZL A;  2DS9 A;  3KZG A;  1RDX A;  4GWX A;  1JVX A;  5TP9 B;  4H46 A;  2DVC A;  3C36 A;  1G0I A;  1XOC A;  1EYI A;  4YKJ A;  5B7D A;  3TTR A;  3IOR A;  3V83 A;  1POT A;  5FHO A;  2O7I A;  2HFB A;  5A5L A;  1B3L A;  3PD8 A;  3Q29 A;  3PPR A;  3QUJ A;  2KLF A;  3FAS A;  2V84 A;  1XVX A;  5IZZ A;  1GTK A;  3Q25 A;  1Y1M A;  2DVZ A;  1B6H A;  1NNT A;  3SDF A;  4AS4 A;  1JEU A;  1MXW A;  3MWB A;  3KN7 A;  2Q89 A;  1IME A;  4PBH A;  2O69 A;  1QKA A;  1II5 A;  1EZO A;  4PFY A;  4HE0 A;  3PMW A;  5JEI A;  4PFW A;  2DP8 A;  3A3U A;  3ONM A;  4R6Y A;  2FNC A;  1NV1 A;  1I6A A;  5AA4 A;  1SYI A;  1A7L A;  3RPL A;  4OES A;  4GX3 A;  3I5O A;  3IOT A;  5H8Q B;  2Q2A A;  2F78 A;  3MC2 A;  1TT1 A;  1SPI A;  4PFT A;  4XKQ A;  4U4X A;  4PDH A;  3OXN A;  4MX6 A;  5B70 A;  2FVZ A;  4HTG A;  4AB6 A;  3K6X A;  1NUW A;  1IQ7 A;  3OEL A;  1M5D A;  5I2N B;  1FTL A;  5CMK A;  2GRV A;  2OCU A;  1FPD A;  4GWZ A;  1B5H A;  3MST A;  3H6W A;  3OO6 A;  3FXR A;  2WBB A;  1FW0 A;  4Z7E A;  5H8F A;  1B7H A;  1RKM A;  3OD7 A;  5ITO A;  3T9H B;  3KC1 A;  1DTG A;  4GL8 A;  1NMU A;  2ALU A;  2H4I A;  3KFM A;  3UIF A;  3FBP A;  4U23 A;  1M5F A;  2H25 A;  3B6Q A;  4THI A;  3K6W A;  3H7M A;  2I0C A;  2Q2C A;  1YCJ A;  4WXJ A;  1P99 A;  4XIG Q;  3D1R A;  3IK6 B;  1IXH A;  4F39 A;  1ZTY A;  3K6U A;  5DT6 A;  5I3S A;  4H6D A;  3B50 A;  3RTW B;  1IXC A;  2F7C A;  4GWW A;  3B6W A;  4OYV A;  3T96 B;  5IGA A;  2R6G E;  4KPT A;  4O3B A;  4GXA A;  4ZEC A;  2V4C A;  2DWI A;  1CE2 A;  1H76 A;  1UTH B;  4GLI A;  4F1Y A;  1ZIU A;  3QMF A;  1MQG A;  2O51 A;  4KXP A;  3O28 A;  4NE4 A;  1NFT A;  4ZZE A;  4XTC Q;  2P3V A;  3C31 A;  2PX1 A;  4GOT A;  2XA5 A;  3PUY E;  2F35 A;  3MPL A;  3BIH A;  4F19 A;  1FQB A;  3OSQ A;  4ZE9 A;  4XF5 A;  2XD2 A;  2QS4 A;  3T0J A;  1CNQ A;  2XXW A;  5EYH A;  2DQV A;  2Y84 A;  4QFK A;  4YMB A;  4OVT A;  3B6T A;  2OJT A;  3MQ9 A;  3MYU A;  2OWT A;  2XXH A;  1D9Q A;  2CZK A;  1IEJ A;  4MAG A;  3USD A;  3MPK A;  1M5B A;  3TQL A;  3QIM A;  2B3F A;  4OXV A;  3Q28 A;  1Q9D A;  1QW0 A;  3CSB A;  2DSF A;  4ZEF A;  1D3K A;  3G3I A;  5H8Q A;  2XXQ A;  5IZ1 A;  1B0H A;  5M2V A;  4G4P A;  1LBC A;  2NXO A;  4PAK A;  4ZEK A;  4N13 A;  3TOD A;  3C9H A;  2PT2 A;  4YIC A;  4POX A;  4O3C A;  4QFP A;  4DE8 A;  2XX9 A;  4Q8R A;  1MM7 A;  4P3L A;  4OFL A;  1POY 1;  1P1O A;  1N0T A;  1FRP A;  5LDZ A;  3QAX A;  3TTN A;  2XWK A;  2BJI A;  3SEW A;  5I2N A;  1WVJ A;  3C33 A;  1B2H A;  3FGS A;  4Q0C A;  1LCF A;  4ESW A;  1FBP A;  1LBX A;  2H9B A;  3K00 A;  4PDD A;  1NUX A;  2P3N A;  3U93 A;  4KR5 A;  1DOT A;  2XWO A;  3KG2 A;  5CC2 A;  5F24 A;  3MZ9 A;  1B1X A;  5AA2 B;  1MG1 A;  2E0S A;  4HE1 A;  1QUJ A;  2V3Q A;  4MH5 A;  1O63 A;  4KQP A;  4FIM A;  2F6P A;  2FIE A;  2ONR A;  4ZDM A;  4G61 A;  1OMP A;  4PTK A;  3FAT A;  4G8N A;  3UOR A;  4AS5 A;  1QUK A;  4R74 A;  5CBR A;  4ELQ A;  1A8E A;  1NV0 A;  2DE3 A;  2NVU B;  2PFZ A;  4MIJ A;  1P1N A;  1ZLQ A;  1LB8 A;  3KOS A;  3PUZ E;  4PQJ A;  5CBS A;  5K2X A;  1AIV A;  2G93 A;  2CEX A;  3JV9 A;  4FEB A;  1ELJ A;  3PMX A;  4DCX A;  4PF8 A;  1UTH A;  3FJM A;  1Y4T A;  2RIN A;  1PB9 A;  3N94 A;  4O7M A;  2XX8 A;  2XD3 A;  3LSX A;  3T9U A;  4ECF A;  4LVQ A;  3RGY A;  3SZP A;  1MXX A;  1N84 A;  2Z23 A;  4TLM B;  1FBF A;  4R2B A;  4UAC A;  2I0B A;  1VDW A;  4BDO A;  1MY2 A;  3VVE A;  3RT8 A;  3MP1 A;  1FPK A;  4F2Q A;  4F22 A;  3N26 A;  2JJK A;  1SW5 A;  3MVY A;  3QXM A;  3IJX B;  1B3F A;  5H8N A;  5HPQ A;  4YAH X;  4POW A;  4XFE A;  4XKP A;  1SI1 A;  4C1U A;  3RN8 A;  3KOT A;  3SES A;  1ZJL A;  3MP8 A;  4MJO A;  4BDR A;  1PB7 A;  2Y7I A;  4X48 A;  3E13 X;  3VV5 A;  3K6V A;  1EU8 A;  2M8C A;  1Y20 A;  1PEB A;  2XHD A;  1BK4 A;  1RYO A;  2OWZ A;  5TU0 A;  1S7Y A;  4HE2 A;  2UXA A;  3UGW A;  2XXX A;  2A5S A;  1DSN A;  1FJ6 A;  2FA7 A;  4PE5 B;  2QS2 A;  1FCK A;  3A29 A;  1PDA A;  4PFI A;  1MXY A;  3IOW A;  3UA8 A;  4BDN A;  2QPQ A;  3TCH A;  4LZ5 A;  2PCR A;  4IO2 A;  1NNK A;  3TDJ A;  1YXI A;  1H44 A;  1MQD A;  2XXR A;  3I3V A;  5BWJ A;  5I7I A;  1LFI A;  5AA2 A;  4N07 A;  4YB5 A;  3ZKK A;  2XXU A;  1RYX A;  1R1N A;  5I84 A;  1B5J A;  2KR0 A;  4KYE A;  3LSF B;  1FQF A;  4GQO A;  3JZJ A;  3PV0 E;  4PCD A;  3W9V A;  3CFL A;  2HAU A;  4MF3 A;  4C0R A;  2F34 A;  3NOH A;  1ANF A;  4NMY A;  4ESX A;  4H0W A;  5CMM A;  4YZZ A;  3T9X B;  4NHB A;  4LAT A;  1VFD A;  3OOA A;  3FXQ A;  1GV8 A;  4XKR A;  5KZT A;  5ICQ A;  1NV5 A;  4KCD A;  4GL0 A;  3N6U A;  2ZZX A;  2OWS A;  2B3B A;  3PPN A;  3E79 A;  3S9N C;  2GH9 A;  5AA1 A;  3UN6 A;  1I69 A;  4BLA A;  1LEV A;  3OEM A;  3K1M A;  1B51 A;  1FTO A;  3K4U A;  5T3J A;  3FJ7 A;  4ZED A;  2IA4 A;  4WEP A;  4FE8 A;  1ZBM A;  3SEU A;  4JVI A;  3TAJ A;  3FVK A;  1JQF A;  1MPD A;  5AA3 A;  4OFJ A;  2F8D A;  2FIX A;  1GGG A;  4ELP A;  4QSD A;  4G8H A;  1FTJ A;  5ET8 A;  4M4G A;  2PFY A;  2KQZ A;  3KJT A;  3VVF A;  1S9T A;  4ONY A;  3DP8 A;  1XT8 A;  4ELO A;  1MY3 A;  1EH3 A;  3EKI A;  1TFD A;  1OQG A;  4YU0 A;  4JVD A;  2I49 A;  1Y9U A;  3KC0 A;  3T93 B;  4YKP A;  2ZZV A;  2DWA A;  3GXA A;  4N81 A;  1SW2 A;  4MFI A;  5J1D A;  2I6E A;  2OPD A;  1IMB A;  3OSR A;  4PAI A;  3GBA A;  2O1M A;  5JTY B;  4I3Y A;  1LGB C;  2DE2 A;  4H1X A;  4YKI A;  3M3F A;  4EDP A;  4MEV A;  3TQW A;  3Q26 A;  4QXD A;  1AOV A;  4RK9 A;  5H8H B;  3ZKL A;  3TKD A;  1BTJ A;  1J1N A;  1MXZ A;  4PE3 A;  3VDF A;  3ZSF A;  2PT1 A;  2DE4 A;  4N6K A;  4NWC A;  4DXB A;  2H5Y A;  2HAV A;  3G3G A;  2O6A A;  2G29 A;  1WOD A;  2FYI A;  2CZI A;  1BLF A;  4N6D A;  4P47 A;  2BJJ X;  3MW0 A;  3G3H A;  3PUW E;  2RCB A;  4KYS A;  2I4B A;  4EQ7 A;  5HM4 B;  4JDF A;  2VD3 A;  3FV1 A;  3SEV A;  1DTZ A;  2HZK A;  3UP9 A;  5I59 B;  2NOO A;  2NUV A;  3S9E A;  1HSJ A;  1N7X A;  4RK2 A;  5EHS A;  1EYJ A;  1Y3P A;  5A5X B;  5DYH A;  5ET7 A;  4GX6 A;  4P9K A;  1IIT A;  5CM6 A;  1EZP A;  1NV2 A;  2Z8D A;  1NV6 A;  3M8U A;  4AQ4 A;  4PP0 A;  4Q5T A;  3PUX E;  1IMD A;  4OWD A;  4FOR A;  3WAE A;  4P1L A;  3IO6 A;  4IO4 A;  4XXU A;  2NWJ A;  1QUL A;  1H45 A;  1USY H;  5I58 B;  1NV7 A;  5ICT A;  1Z7N E;  3C4M A;  3GBB A;  3KGC A;  3FV2 A;  4NF6 B;  4KYD A;  4L17 A;  4MBP A;  4PET A;  3TUS A;  4N6P A;  4GD5 A;  3RUM A;  3IB0 A;  2F3B A;  4JXI A;  4Q30 B;  4F3G A;  4QF9 A;  4DI3 D;  1QKB A;  1MPC A;  4MNP A;  4O8M A;  2IEE A;  1VR5 A;  2Z8F A;  2QMW A;  2Q88 A;  4OVQ A;  4X04 A;  1O7T A;  2XXT A;  1NV4 A;  1URG A;  1NUZ A;  4PFU A;  3IX1 A;  1QGX A;  4F3S A;  1FPJ A;  2X26 A;  3SEX A;  1Y3Q A;  1FBD A;  1DPP A;  4LZ7 A;  1EYK A;  3HHG A;  1Z7M E;  4UA8 A;  1IUD A;  4ZEB A;  4F3B A;  1JW5 A;  1PBP A;  1SDX A;  2Z22 A;  4UAB A;  4NN3 A;  3M3L A;  1O64 A;  4I62 A;  4OTE A;  4EF2 A;  2UYE A;  3HHF A;  2PYY A;  2RCA A;  5JTY A;  1A99 A;  4QSE A;  3CIJ A;  1URD A;  4QHQ A;  2REJ A;  1FBE A;  5EHM A;  1P1Q A;  1JEV A;  4LZ8 A;  5H8N B;  4WKM A;  1VE4 A;  2DWH A;  3LV0 A;  5H8H A;  3MVW A;  4PBQ A;  1JET A;  3M3K A;  3FJG A;  4GWS A;  1FTK A;  3IOU A;  4GRK A;  4OVR A;  4P1E A;  4OEV A;  1US5 A;  4JWY A;  4DI4 B;  3F11 A;  4YMA A;  2Q8M A;  4FEC A;  2OZZ A;  4OFO A;  2OPE A;  5I59 A;  1B1H A;  4R73 A;  1M5C A;  4U21 A;  5LTC A;  3RYD A;  1K9Z A;  4BDQ A;  1LAX A;  2F3D A;  5A5X A;  1MY0 A;  3KBZ A;  4PC9 A;  2ZNS A;  4R72 A;  2D5W A;  4NGU A;  3B7D A;  2OX3 A;  2ZNU A;  4OZ9 A;  2ONK E;  3IO4 A;  2WYP A;  1PB8 A;  2OK2 A;  5I58 A;  5F7V A;  3G7W A;  1AWB A;  4NF4 B;  4ZE8 A;  3ISP A;  2F7A A;  1XHY A;  2FHY A;  2R8T A;  4E0W A;  1QVS A;  3HO7 A;  4NF6 A;  2ZMB A;  1DCU A;  2HEU A;  1HSE A;  4NTL A;  1JNF A;  1SW1 A;  3ILU B;  3TCG A;  1YTV A;  3MVZ A;  5ET6 A;  1MXV A;  3HCQ A;  3A09 A;  1CB6 A;  1FTM A;  1IMF A;  3KSX A;  1T0K A;  2ZNT A;  3IB1 A;  4WED A;  3FVO A;  5ISU A;  3PU5 A;  2ESN A;  3IL1 B;  4FED A;  3SET A;  3GZG A;  4FAJ A;  1B5I A;  4U22 A;  1Q1K A;  2P0S A;  4N17 A;  1MXU A;  1B40 A;  1MH3 A;  5J16 A;  4NF5 B;  3BKI B;  1LBZ A;  4RNS A;  3KSJ A;  3Q27 A;  2QVU A;  1IMA A;  2OLB A;  3TTL A;  5L9S A;  4RPN A;  4QRZ A;  2DWJ A;  1YZ0 A;  3ODB A;  4GWU A;  3PMV A;  1I6B A;  4FJP A;  2OBG A;  5H8S A;  4GIZ A;  3HN0 A;  4U1Z A;  1EZ9 A;  1D9Y A;  3O6H A;  5HBC A;  5EYG A;  4TQU Q;  2DOJ A;  2RKM A;  4ND9 A;  4PF6 A;  3PPP A;  3U94 A;  4IO7 A;  3IR1 A;  1DBZ A;  1MY1 A;  2AIX A;  3H06 B;  1MDP 1;  4OET A;  1Y1Z A;  3MUQ A;  1TFA A;  4P0I A;  4JB7 A;  5KDT B;  2P2A A;  3W9W A;  1MM6 A;  4NF8 B;  2F5X A;  3O97 A;  3MBP A;  5ESY A;  4MNI A;  2QS1 A;  2O7U A;  2Y7K A;  1R9L A;  4PGP A;  3K1P A;  4TOZ A;  1R9Q A;  1B4Z A;  2X7P A;  2I3V A;  1INP A;  4R9F A;  4OEU A;  5FTI A;  1MS7 A;  3GYY A;  4O94 A;  5FHN A;  3MP6 A;  2XXV A;  5L9O A;  2Q74 A;  1Q35 A;  2DYX A;  3MJN A;  4ZS9 A;  1IXI A;  3TCF A;  2HZL A;  2HXR A;  2ZYM A;  1NNP A;  2VPO A;  1SW4 A;  3PUV E;  1FQD A;  3QYT A;  3RQT A;  4EF1 A;  3PPO A;  2AYS A;  3FIR A;  1FPF A;  4EUO A;  3D4G A;  4FAT A;  4JWX A;  3H3G A;  2VPN A;  5LOM A;  1KZ8 A;  4NF4 A;  3S4U A;  2Y7R A;  4DCY A;  3S2V A;  2H98 A;  3P7I A;  2VT5 A;  3HFU A;  2AL4 A;  4X1B A;  1GVC A;  2HQ0 A;  4F29 A;  3LSW A;  5I57 B;  1NUY A;  3SER A;  2Y5K A;  1ZMG A;  5L8D A;  4DZ1 A;  3MVX A;  4YB6 A;  2XWV A;  1DPE A;  2WKY A;  5DVJ A;  4RPO A;  3A3C A;  4DXC A;  1TXF A;  1LBV A;  4MLV A;  1M5E A;  4GF8 A;  3G3J A;  3U72 A;  4HS7 A;  1IIW A;  4H8J A;  3TMG A;  2YPN A;  4NF0 A;  4QSC A;  3LC8 A;  5DVF A;  1FTA A;  3DP4 A;  1LB9 A;  4NF5 A;  3IFA A;  4IY5 A;  3EPE A;  2Y5L A;  1BP5 A;  1FQE A;  3OO7 A;  5FBP A;  3GLB A;  4PFR A;  1LBB A;  2V3T A;  2DXY A;  2Y7W A;  4PFB A;  4IO6 A;  1N04 A;  5DW8 A;  5AA2 D;  3TPA A;  4GX4 A;  1H43 A;  2XXP A;  4X1D A;  3N5L A;  1NH8 A;  4I3E A;  2XXI A;  3CI8 A;  1UIV A;  1A40 A;  2DDK A;  5EQ8 A;  2D21 A;  1XVY A;  2O84 X;  1B0L A;  4EXL A;  1GR2 A;  4P11 A;  4QFL A;  1MY4 A;  5FHM A;  4OVP A;  2HXW A;  1Y4C A;  4G77 A;  4JWO A;  3IJO B;  1A54 A;  5KDT A;  1H3D A;  4NF8 A;  2VGQ A;  2WX9 A;  4ISU A;  1LAH E;  5IM2 A;  3PPQ A;  4OMB A;  1OVT A;  1NV3 A;  4E0X A;  4GVO A;  1YYZ A;  1MQJ A;  3KEI A;  1VSO A;  3CFZ A;  5I2K B;  1ATG A;  4XKN A;  2QVV A;  2QS3 A;  2V3U A;  4H5F A;  4N4U A;  4NQ8 A;  2UVI A;  1QUI A;  3ILT B;  1SVX B;  3H6U A;  4OHN A;  1FPG A;  4I8C A;  3W15 C;  3MZ1 A;  3N6T A;  3ZS6 A;  3O29 A;  2PMS A;  5IAI A;  4GWO A;  1RDZ A;  3FD3 A;  2LAO A;  2QSX A;  3LUZ A;  3TFL A;  3HV1 A;  3QSL A;  2I48 A;  1LAF E;  2MKZ A;  3V5A A;  1FPE A;  2WYK A;  3E3K A;  5L9M A;  2X7Q A;  1LAG E;  4GBV A;  1P1W A;  2AL5 A;  5CRY A;  3UK4 A;  4DXU A;  1MH4 A;  4GFR A;  5CMB A;  2F6G A;  3VLW A;  4LN5 A;  4EQB A;  1B7Z A;  2L5V A;  4G8M A;  2XX7 A;  5I57 A;  4ELR A;  3S9L C;  3ROJ A;  3BFU A;  2HCA A;  4IO3 A;  3TYH A;  3RLF E;  5IKB A;  2CZH A;  2O1L A;  4X9T A;  3EHS A;  4EXK A;  1NNF A;  4R6H A;  3TEP A;  1NKX A;  3T22 A;  1OVB A;  1A55 A;  3LR1 A;  5F1Q A;  1AH5 A;  4BDL A;  1LLS A;  3I6V A;  4KD5 A;  3QK6 A;  4QFN A;  3FUZ A;  1PC3 A;  2I3W A;  2RF1 A;  2XWI A;  3E78 A;  3T66 A;  1B58 A;  1JVY A;  4N91 A;  4F2O A;  5DEX B;  4OER A;  3E4R A;  1B46 A;  1S50 A;  4RY1 A;  4KI0 E;  2Y7P A;  4OAN A;  4R6K A;  2Q9T A;  2B65 A;  1FSA A;  2Z8E A;  2R71 A;  1NI9 A;  4OQO A;  4LQ5 A;  4NED A;  1LFG A;  1NL5 A;  3T1B A;  1UQW A;  4LON B;  2H99 A;  5BUU A;  1K9Y A;  3WAF A;  5DTB A;  3VXC A;  4TLL B;  3DEL B;  4HXV A;  3HST A;  3KN8 A;  2F7B A;  1B3G A;  1ZU0 A;  1SBP A;  2P1S A;  1JW1 A;  2ANJ A;  3IFC A;  1FJ9 A;  1YPN A;  3U8Q A;  2B4L A;  2ZYK A;  1FBC A;  1MDQ A;  3CRB A;  5CI5 A;  3OO8 A;  1DK4 A;  1JP4 A;  1LFH A;  4I9D A;  4G68 C;  4OEN A;  1IXG A;  5I2K A;  3BIG A;  5EQ7 A;  2QL3 A;  3L6G A;  4OVS A;  1Y3N A;  1BKA A;  3PTY A;  4IR8 A;  1FBG A;  2DXR A;  3DLN A;  5TP9 A;  4GBW A;  4F1U A;  4R2F A;  3ECR A;  3K0V A;  3H03 A;  3VLU A;  1G0H A;  3DP6 A;  3BFT A;  2E1S A;  3KBR A;  3H6V A;  3RPW A;  1XI6 A;  2REG A;  3CHG A;  4NG7 A;  4ZEI A;  3IB2 A;  5KCJ B;  3U65 A;  1NH7 A;  1SQY A;  3R6U A;  4DIG A;  1MPB A;  4JSD A;  1LCT A;  3THI A;  1UTB B;  4H65 A;  1LST A;  4LA9 A;  4R75 A;  2YLN A;  1ZKB A;  3CG1 A;  2VOZ A;  1P1U A;  4C1T A;  1VFE A;  1WDN A;  3LBS A;  3T9V A;  3CFX A;  4MHF A;  1UIU A;  1PBQ A;  5TPA B;  2PVU A;  4KFQ A;  4YKK A;  3QUF A;  4U4S A;  2ONS A;  4MCO A;  4NX1 A;  5K2Y A;  1FPB A;  4JVC A;  4H45 A;  1YAE A;  3EF7 A;  4MLQ A;  3D4C A;  3L6H A;  4F31 B;  3C35 A;  2XXY A;  3K02 A;  2V25 A;  3RNN A;  5DEX A;  2O68 A;  4MNC A;  5IZ3 B;  1QJM A;  2I4C A;  3B8B A;  3R7X A;  3V89 B;  5I56 B;  3C34 A;  2WBD A;  4N15 A;  5I5P A;  1N3X A;  2FBP A;  2QVR A;  4QBA A;  3G3K A;  3EHT A;  3OEK A;  5DVI A;  4OA4 A;  3FXB A;  1KA0 A;  1URS A;  1FBH A;  2A5T B;  3CR9 A; 
#chains in the Genus database with same CATH homology
 5J1D A;  1KZ8 A;  5I3S A;  3B50 A;  4PAF A;  4GWW A;  1IMB A;  4HCW A;  5IGA A;  4PAI A;  4O7I A;  4I40 A;  4I3Y A;  2VT5 A;  3HFU A;  2DE2 A;  4GWY A;  2V4C A;  1NUY A;  2Y5K A;  4MEV A;  4F18 A;  3QMF A;  4KXP A;  2WEF A;  4PGN A;  4QXD A;  4F1V A;  2P3V A;  4PE3 A;  1LBW A;  2DE4 A;  2XWV A;  4N6K A;  2XA5 A;  3BIH A;  1LBV A;  2CZI A;  4F19 A;  4N6D A;  4P47 A;  4NF0 A;  4XF5 A;  3T0J A;  1CNQ A;  5EYH A;  4OVT A;  1FTA A;  2HZK A;  3MYU A;  3IFA A;  1D9Q A;  2CZK A;  4MAG A;  1EYJ A;  2Y5L A;  2ZZW A;  5FBP A;  2HHM A;  4PFR A;  5ET7 A;  4GX6 A;  4P9K A;  5CM6 A;  1Q9D A;  1NV2 A;  4PFB A;  1NV6 A;  5DW8 A;  5IZ1 A;  4GX4 A;  4I3E A;  1IMD A;  4PAK A;  2DDK A;  5EQ8 A;  4P1L A;  4YIC A;  4P8B A;  1NV7 A;  4P3L A;  1FPI A;  4MMP A;  1IMC A;  4OVP A;  5EQA A;  1FRP A;  5LDZ A;  2XWK A;  2BJI A;  4PET A;  2WX9 A;  1FBP A;  1LBX A;  5IM2 A;  4PDD A;  1NUX A;  1NV3 A;  2P3N A;  2F3B A;  2B4M A;  2XWO A;  4DI3 D;  1YYZ A;  4MNP A;  5F24 A;  4XEQ A;  4O8M A;  2QVV A;  2HPG A;  4N4U A;  4NQ8 A;  4HE1 A;  2V3Q A;  4OVQ A;  4X04 A;  5IZ3 A;  1NV4 A;  2FIE A;  1NUZ A;  1FPG A;  1QGX A;  4G61 A;  1FPJ A;  4M1V A;  4PTK A;  1RDZ A;  1FBD A;  1EYK A;  3LUZ A;  4AS5 A;  2MKZ A;  1FPE A;  1KA1 A;  4UAB A;  2XXK A;  4NN3 A;  2WYK A;  1NV0 A;  2DE3 A;  4GBV A;  2PFZ A;  4MIJ A;  3RPL B;  2CEX A;  1RDY A;  2QFL A;  4LN5 A;  1FBE A;  4PF8 A;  2L5V A;  4NAP A;  3ROJ A;  4O7M A;  2CEY A;  5JK4 A;  3LV0 A;  2GQ1 A;  4PBQ A;  3SZP A;  2CZH A;  4X9T A;  4GWS A;  5ET5 A;  4N8G A;  4OVR A;  1FBF A;  1VDW A;  4P1E A;  1FPK A;  4DI4 B;  2JJK A;  4X8R A;  2Q8M A;  4N8Y A;  2XWI A;  3E78 A;  4FBP A;  4N91 A;  4XFE A;  4HCY A;  1FPL A;  5LTC A;  3RYD A;  1K9Z A;  4OAN A;  2Q9T A;  2F3D A;  4MJO A;  1FSA A;  3KBZ A;  4PC9 A;  1NI9 A;  4P56 A;  4NGU A;  2OX3 A;  3T1B A;  5EQ9 A;  1BK4 A;  1K9Y A;  2OWZ A;  4HE2 A;  4HXV A;  2WYP A;  1LBY A;  1FJ6 A;  1AWB A;  1RDX A;  3ISP A;  3A29 A;  4GWX A;  4H46 A;  2FHY A;  3IFC A;  1FJ9 A;  2R8T A;  4PFI A;  1G0I A;  2B4L A;  1EYI A;  1FBC A;  1DCU A;  2QPQ A;  5A5L A;  2PCR A;  1DK4 A;  1JP4 A;  1YXI A;  3BIG A;  5EQ7 A;  5IZZ A;  5I7I A;  5ET6 A;  4OVS A;  3PTY A;  4IR8 A;  1FBG A;  2KR0 A;  4GBW A;  2DVZ A;  1IMF A;  4F1U A;  4AS4 A;  4PCD A;  1IME A;  3W9V A;  4PBH A;  1G0H A;  3NOH A;  4N17 A;  5J16 A;  4HE0 A;  4YZZ A;  4NHB A;  1XI6 A;  1LBZ A;  3CHG A;  4NG7 A;  2QVU A;  1IMA A;  3U65 A;  1NV1 A;  1NV5 A;  3RPL A;  4GX3 A;  1YZ0 A;  2ZZX A;  4GWU A;  3E79 A;  1SPI A;  5EYG A;  1LEV A;  4MHF A;  4PDH A;  4PF6 A;  4MX6 A;  2FVZ A;  1DBZ A;  5T3J A;  1NUW A;  4JVI A;  4MCO A;  4NX1 A;  1FPB A;  4JVC A;  4H45 A;  3W9W A;  2FIX A;  1FPD A;  2F5X A;  4GWZ A;  5ESY A;  4MNI A;  5ET8 A;  3MST A;  2PFY A;  4PGP A;  2KQZ A;  2WBB A;  1INP A;  4MNC A;  3GYY A;  4O94 A;  3KC1 A;  5IZ3 B;  3EKI A;  3B8B A;  3FBP A;  2Q74 A;  2WBD A;  4N15 A;  5I5P A;  2HZL A;  2HXR A;  2FBP A;  2QVR A;  2VPO A;  4JVD A;  4QBA A;  3KC0 A;  2ZZV A;  1FPF A;  4N81 A;  4OA4 A;  3FXB A;  1KA0 A;  1FBH A;  2VPN A;  3D1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...