2DDMA

Crystal structure of pyridoxal kinase from the escherichia coli pdxk gene at 2.1 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
271
structure length
264
Chain Sequence
KSRALQADIVAVQSQVVYGSVGNSIAVPAIKQNGLNVFAVPTVLLSNTPHYDTFYGGAIPDEWFSGYLRALQERDALRQLRAVTTGYMGTASQIKILAEWLTALRKDHPDLLIMVDPVIGDIDSGIYVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDTLKWVVVTSQEMQVVVVTADSVNVISHSRVKTDLKGTGDLFCAQLISGLLKGKALTDAVHRAGLRVLEVMRYTQQHESDELILPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pyridoxal kinase from the Escherichia coli pdxK gene: implications for the classification of pyridoxal kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Pyridoxine kinase
total genus 90
structure length 264
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2ddmA00
3IQ0A 2DDOA 1EKKA 3B1QA 4C5LA 1TZ3A 4EUMA 3B1NA 4K8CA 1L2LA 2QHPA 4PVVA 3VASA 4KALA 2ABSA 4U7XA 3RQ5A 3RS8A 2HQQA 2A9ZA 4C5NA 3RY7A 4EBUA 3N1CA 1LHPA 3IH0A 4E3AA 4E8YA 4N08A 2DDWA 4JJPA 1JXIA 3GO6A 3KEUA 4O1LA 2DDMA 2NWHA 3MBHA 3Q1YA 4LBXA 3B1PA 4E84A 2YXTA 5BYCA 3RTAA 4B8SA 3RTEA 2XTBA 3LHXA 4N09A 3RT7A 3RQ2A 3RPZA 3NL2A 3DRWA 3GO7A 5C40A 2JGVA 4E69A 3NL3A 4XDAA 1YGJA 3UMPA 3IBQA 3PZSA 3LJSA 3JULA 1VM7A 4KBEA 1LIOA 3VAQA 4YWRA 4C5KA 3RQ6A 5CM5A 3HICA 3NBVA 1RK2A 2R3BA 1V1BA 3H74A 2AA0A 1BX4A 4EN4A 1KYHA 3UQEA 4YL5A 3MBJA 5CGAA 4S1MA 4GM6A 3NM1A 2JG5A 5BYDA 3W4SA 2QCVA 2C49A 1GQTA 4XF6A 3RQ8A 3UMOA 3OTXA 2F02A 4WJMA 1V1AA 1YGKA 3UQDA 3HYOA 3CQDA 4K8PA 4LBGA 3RT9A 1C3QA 1ESQA 3IKHA 4LCAA 4O1GA 3RRJA 1RKDA 2AFBA 2PKMA 2PKNA 3RS9A 3RREA 2DCNA 3NM3A 3PL2A 3KZHA 3NC2A 3QAIA 4K8KA 3RTCA 3RU3A 2PKKA 4C5MA 4KADA 1EKQA 3RPHA 3RQQA 1LIKA 5EY7A 5C3YA 3KD6A 2Q5RA 1RFTA 3B1RA 2I6BA 2PKFA 2RBCA 3RSSA 4E8WA 1RKSA 1WYEA 3RTDA 2AX3A 2YXUA 4X8FA 2F7KA 4S1IA 3I3YA 2C4EA 3LKIA 3NL5A 3RSFA 3IN1A 1RKAA 5C41A 4S1HA 2ABQA 5COJA 3B3LA 3NBWA 4K9IA 3RRBA 1U2XA 4C5JA 3LOOA 1V1SA 1LHRA 3K9EA 5B6AA 1JXHA 1TZ6A 3RM5A 3NCAA 2I6AA 4DU5A 3BF5A 5EYNA 1VI9A 4UBEA 3RSQA 2AJPA 2FV7A 1V19A 2VARA 3BGKA 4JKSA 1GC5A 3H49A 3FHYA 1ESJA 3UQ9A 5BYEA 2AJRA 2V78A 1RFUA 3IE7A 3QA2A 3B1OA 5F11A 4K9CA 2A9YA 3UBOA 1LIIA 4KAHA 4XCKA 3Q92A 5TQIA 5C3ZA 1TD2A 5TRWA 3RRFA 4S1IB 3EWMA 4KANA 2HW1A 2I5BA 3RQXA 4B8RA 4E8ZA 3ZS7A 5CGEA 3RTGA 1TYYA 1VK4A 3DZVA 1UB0A 2AB8A 4XF7A 3RQHA 3RSGA 2JG1A 4JKUA 3UQ6A 3HPDA 3NC9A 3NL6A 5BYFA 1YHJA 2AWDA 2R3EA 3RU2A 4EOHA 3K5WA 3RO4A 4K8TA 1UA4A 3RTBA 2HLZA 3KTNA 4LC4A 1DGMA 4K93A 5F0ZA 1LIJA 3FHXA 4DC3A 1RFVA 3GBUA
chains in the Genus database with same CATH superfamily
3IQ0A 2DDOA 1EKKA 3B1QA 4C5LA 1TZ3A 3PYZA 4EUMA 3B1NA 4K8CA 1L2LA 2QHPA 4PVVA 3VASA 4KALA 2ABSA 4U7XA 3RQ5A 3RS8A 2HQQA 2A9ZA 4C5NA 3RY7A 4EBUA 2Y1OA 3HJ6A 3N1CA 1LHPA 3IH0A 4E3AA 4E8YA 2Y66A 4N08A 2DDWA 4JJPA 1JXIA 3GO6A 3KEUA 3N2AA 2DDMA 2NWHA 3MBHA 2AM2A 3Q1YA 3B1PA 4LBXA 2YXTA 5BYCA 3RTAA 4B8SA 3RTEA 2XTBA 4CVMA 1E8CA 4BUBA 3LHXA 2X5OA 4N09A 3RT7A 1GQQA 3RQ2A 3RPZA 3NL2A 3DRWA 3GO7A 3ZM5A 2JGVA 4E69A 5C40A 3NL3A 4XDAA 1YGJA 3RT9A 3UMPA 3IBQA 3PZSA 3LJSA 3JULA 4E84A 1VM7A 4KBEA 1LIOA 3ZL8A 3VAQA 2VOSA 1GG4A 4YWRA 3RQ6A 4C5KA 2VTEA 5CM5A 3HICA 1EEHA 3NBVA 1RK2A 1O5ZA 2R3BA 1V1BA 3H74A 2AA0A 1BX4A 4EN4A 1KYHA 2VORA 3UQEA 4HV4A 2XJAA 4YL5A 3MBJA 5A5FA 3EAGA 1FGSA 5CGAA 4S1MA 4GM6A 2GCAA 3NM1A 2JG5A 5BYDA 3W4SA 2QCVA 2C49A 1GQTA 4XF6A 3RQ8A 3UMOA 3OTXA 2F02A 4WJMA 1V1AA 1YGKA 4O1LA 3UQDA 3HYOA 3CQDA 4K8PA 4LBGA 1W7KA 2UUOA 1C3QA 1ESQA 3IKHA 4LCAA 4O1GA 3NRSA 1RKDA 2AFBA 2PKMA 2PKNA 3RS9A 3RREA 4C13A 2DCNA 3NM3A 3PL2A 3KZHA 3NC2A 3QAIA 3QCZA 4K8KA 1JBWA 3RTCA 2PKKA 4QDIA 4KADA 1EKQA 4UAGA 3RPHA 3RQQA 1LIKA 1JBVA 5EY7A 4C5MA 3KD6A 5C3YA 1W78A 2Q5RA 1RFTA 3B1RA 2I6BA 2PKFA 2RBCA 3RSSA 4BUCA 4E8WA 1RKSA 1WYEA 2VTDA 3RTDA 2AX3A 2YXUA 4X8FA 2F7KA 4S1IA 3I3YA 2C4EA 1P31A 3LKIA 3NL5A 3RSFA 3IN1A 4CVKA 2JFFA 3UAGA 1RKAA 2GC5A 5C41A 4S1HA 2ABQA 5COJA 1P3DA 2F00A 3RRJA 3B3LA 3NBWA 1GQYA 4K9IA 3RRBA 3LK7A 1U2XA 4C5JA 3LOOA 1V1SA 1LHRA 2XPCA 3K9EA 5B6AA 1JXHA 1TZ6A 3RM5A 3NCAA 2I6AA 4CVLA 4DU5A 3BF5A 5A5EA 5EYNA 1VI9A 4UBEA 3RSGA 3RSQA 3RU3A 2AJPA 2FV7A 1V19A 2VARA 3BGKA 4JKSA 4ZIYA 1GC5A 3H49A 2JFGA 3FHYA 1ESJA 2JFHA 3UQ9A 5BYEA 2AJRA 2V78A 5BYFA 1RFUA 3IE7A 3QA2A 3B1OA 5F11A 2AM1A 4K9CA 2A9YA 3ZM6A 3UBOA 2GCBA 1LIIA 4KAHA 4XCKA 3Q92A 5TQIA 5C3ZA 1TD2A 2WJPA 5TRWA 3RRFA 4S1IB 3EWMA 4KANA 2HW1A 2I5BA 3RQXA 4B8RA 4E8ZA 3ZS7A 5CGEA 3RTGA 3UQ6A 1TYYA 1VK4A 3DZVA 1UB0A 2AB8A 1J6UA 2Y68A 4XF7A 1UAGA 3RQHA 2JG1A 2WTZA 4JKUA 3HPDA 3NC9A 3HN7A 3NL6A 1YHJA 2AWDA 2R3EA 3RU2A 4EOHA 1E0DA 2Y67A 2GC6A 3K5WA 3RO4A 4K8TA 1UA4A 2UUPA 2HLZA 3KTNA 4LC4A 3RTBA 4QF5A 1DGMA 4K93A 5F0ZA 1LIJA 2UAGA 4C12A 3FHXA 4DC3A 1RFVA 3GBUA
chains in the Genus database with same CATH topology
3IQ0A 2DDOA 1EKKA 3B1QA 4C5LA 1TZ3A 4EUMA 3B1NA 4K8CA 1L2LA 2QHPA 4PVVA 3VASA 4KALA 2ABSA 4U7XA 3RQ5A 3RS8A 2HQQA 2A9ZA 4C5NA 3RY7A 4EBUA 3HJ6A 3N1CA 1LHPA 3IH0A 4E3AA 4E8YA 4N08A 2DDWA 4JJPA 1JXIA 3GO6A 3KEUA 4O1LA 2DDMA 2NWHA 3MBHA 3Q1YA 4LBXA 3B1PA 4E84A 2YXTA 5BYCA 3RTAA 4B8SA 3RTEA 2XTBA 3LHXA 4N09A 3RT7A 3RQ2A 3RPZA 3NL2A 3DRWA 3GO7A 5C40A 2JGVA 4E69A 3NL3A 4XDAA 1YGJA 3UMPA 3IBQA 3PZSA 3LJSA 3JULA 1VM7A 4KBEA 1LIOA 3VAQA 4YWRA 4C5KA 3RQ6A 5CM5A 3HICA 3NBVA 1RK2A 2R3BA 1V1BA 3H74A 2AA0A 1BX4A 4EN4A 1KYHA 3UQEA 4YL5A 3MBJA 5CGAA 4S1MA 4GM6A 3NM1A 2JG5A 5BYDA 3W4SA 2QCVA 2C49A 1GQTA 4XF6A 3RQ8A 3UMOA 3OTXA 2F02A 4WJMA 1V1AA 1YGKA 3UQDA 3HYOA 3CQDA 4K8PA 4LBGA 3RT9A 1C3QA 1ESQA 3IKHA 4LCAA 4O1GA 3RRJA 1RKDA 2AFBA 2PKMA 2PKNA 3RS9A 3RREA 2DCNA 3NM3A 3PL2A 3KZHA 3NC2A 3QAIA 4K8KA 3RTCA 3RU3A 2PKKA 4C5MA 4KADA 1EKQA 3RPHA 3RQQA 1LIKA 5EY7A 5C3YA 3KD6A 2Q5RA 1RFTA 3B1RA 2I6BA 2PKFA 2RBCA 3RSSA 4E8WA 1RKSA 1WYEA 3RTDA 2AX3A 2YXUA 4X8FA 2F7KA 4S1IA 3I3YA 2C4EA 3LKIA 3NL5A 3RSFA 3IN1A 1RKAA 5C41A 4S1HA 2ABQA 5COJA 3B3LA 3NBWA 4K9IA 3RRBA 1U2XA 4C5JA 3LOOA 1V1SA 1LHRA 3K9EA 5B6AA 1JXHA 1TZ6A 3RM5A 3NCAA 2I6AA 4DU5A 3BF5A 5EYNA 1VI9A 4UBEA 3RSQA 2AJPA 2FV7A 1V19A 2VARA 3BGKA 4JKSA 1GC5A 3H49A 3FHYA 1ESJA 3UQ9A 5BYEA 2AJRA 2V78A 1RFUA 3IE7A 3QA2A 3B1OA 5F11A 4K9CA 2A9YA 3UBOA 1LIIA 4KAHA 4XCKA 3Q92A 5TQIA 5C3ZA 1TD2A 5TRWA 3RRFA 4S1IB 3EWMA 4KANA 2HW1A 2I5BA 3RQXA 4B8RA 4E8ZA 3ZS7A 5CGEA 3RTGA 1TYYA 1VK4A 3DZVA 1UB0A 2AB8A 4XF7A 3RQHA 3RSGA 2JG1A 4JKUA 3UQ6A 3HPDA 3NC9A 3NL6A 5BYFA 1YHJA 2AWDA 2R3EA 3RU2A 4EOHA 3K5WA 3RO4A 4K8TA 1UA4A 3RTBA 2HLZA 3KTNA 4LC4A 1DGMA 4K93A 5F0ZA 1LIJA 3FHXA 4DC3A 1RFVA 3GBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQ0 A;  2DDO A;  1EKK A;  3B1Q A;  4C5L A;  1TZ3 A;  4EUM A;  3B1N A;  4K8C A;  1L2L A;  2QHP A;  4PVV A;  3VAS A;  4KAL A;  2ABS A;  4U7X A;  3RQ5 A;  3RS8 A;  2HQQ A;  2A9Z A;  4C5N A;  3RY7 A;  4EBU A;  3N1C A;  1LHP A;  3IH0 A;  4E3A A;  4E8Y A;  4N08 A;  2DDW A;  4JJP A;  1JXI A;  3GO6 A;  3KEU A;  4O1L A;  2DDM A;  2NWH A;  3MBH A;  3Q1Y A;  4LBX A;  3B1P A;  4E84 A;  2YXT A;  5BYC A;  3RTA A;  4B8S A;  3RTE A;  2XTB A;  3LHX A;  4N09 A;  3RT7 A;  3RQ2 A;  3RPZ A;  3NL2 A;  3DRW A;  3GO7 A;  5C40 A;  2JGV A;  4E69 A;  3NL3 A;  4XDA A;  1YGJ A;  3UMP A;  3IBQ A;  3PZS A;  3LJS A;  3JUL A;  1VM7 A;  4KBE A;  1LIO A;  3VAQ A;  4YWR A;  4C5K A;  3RQ6 A;  5CM5 A;  3HIC A;  3NBV A;  1RK2 A;  2R3B A;  1V1B A;  3H74 A;  2AA0 A;  1BX4 A;  4EN4 A;  1KYH A;  3UQE A;  4YL5 A;  3MBJ A;  5CGA A;  4S1M A;  4GM6 A;  3NM1 A;  2JG5 A;  5BYD A;  3W4S A;  2QCV A;  2C49 A;  1GQT A;  4XF6 A;  3RQ8 A;  3UMO A;  3OTX A;  2F02 A;  4WJM A;  1V1A A;  1YGK A;  3UQD A;  3HYO A;  3CQD A;  4K8P A;  4LBG A;  3RT9 A;  1C3Q A;  1ESQ A;  3IKH A;  4LCA A;  4O1G A;  3RRJ A;  1RKD A;  2AFB A;  2PKM A;  2PKN A;  3RS9 A;  3RRE A;  2DCN A;  3NM3 A;  3PL2 A;  3KZH A;  3NC2 A;  3QAI A;  4K8K A;  3RTC A;  3RU3 A;  2PKK A;  4C5M A;  4KAD A;  1EKQ A;  3RPH A;  3RQQ A;  1LIK A;  5EY7 A;  5C3Y A;  3KD6 A;  2Q5R A;  1RFT A;  3B1R A;  2I6B A;  2PKF A;  2RBC A;  3RSS A;  4E8W A;  1RKS A;  1WYE A;  3RTD A;  2AX3 A;  2YXU A;  4X8F A;  2F7K A;  4S1I A;  3I3Y A;  2C4E A;  3LKI A;  3NL5 A;  3RSF A;  3IN1 A;  1RKA A;  5C41 A;  4S1H A;  2ABQ A;  5COJ A;  3B3L A;  3NBW A;  4K9I A;  3RRB A;  1U2X A;  4C5J A;  3LOO A;  1V1S A;  1LHR A;  3K9E A;  5B6A A;  1JXH A;  1TZ6 A;  3RM5 A;  3NCA A;  2I6A A;  4DU5 A;  3BF5 A;  5EYN A;  1VI9 A;  4UBE A;  3RSQ A;  2AJP A;  2FV7 A;  1V19 A;  2VAR A;  3BGK A;  4JKS A;  1GC5 A;  3H49 A;  3FHY A;  1ESJ A;  3UQ9 A;  5BYE A;  2AJR A;  2V78 A;  1RFU A;  3IE7 A;  3QA2 A;  3B1O A;  5F11 A;  4K9C A;  2A9Y A;  3UBO A;  1LII A;  4KAH A;  4XCK A;  3Q92 A;  5TQI A;  5C3Z A;  1TD2 A;  5TRW A;  3RRF A;  4S1I B;  3EWM A;  4KAN A;  2HW1 A;  2I5B A;  3RQX A;  4B8R A;  4E8Z A;  3ZS7 A;  5CGE A;  3RTG A;  1TYY A;  1VK4 A;  3DZV A;  1UB0 A;  2AB8 A;  4XF7 A;  3RQH A;  3RSG A;  2JG1 A;  4JKU A;  3UQ6 A;  3HPD A;  3NC9 A;  3NL6 A;  5BYF A;  1YHJ A;  2AWD A;  2R3E A;  3RU2 A;  4EOH A;  3K5W A;  3RO4 A;  4K8T A;  1UA4 A;  3RTB A;  2HLZ A;  3KTN A;  4LC4 A;  1DGM A;  4K93 A;  5F0Z A;  1LIJ A;  3FHX A;  4DC3 A;  1RFV A;  3GBU A; 
#chains in the Genus database with same CATH topology
 3IQ0 A;  2DDO A;  1EKK A;  3B1Q A;  4C5L A;  1TZ3 A;  3PYZ A;  4EUM A;  3B1N A;  4K8C A;  1L2L A;  2QHP A;  4PVV A;  3VAS A;  4KAL A;  2ABS A;  4U7X A;  3RQ5 A;  3RS8 A;  2HQQ A;  2A9Z A;  4C5N A;  3RY7 A;  4EBU A;  2Y1O A;  3HJ6 A;  3N1C A;  1LHP A;  3IH0 A;  4E3A A;  4E8Y A;  2Y66 A;  4N08 A;  2DDW A;  4JJP A;  1JXI A;  3GO6 A;  3KEU A;  3N2A A;  2DDM A;  2NWH A;  3MBH A;  2AM2 A;  3Q1Y A;  3B1P A;  4LBX A;  2YXT A;  5BYC A;  3RTA A;  4B8S A;  3RTE A;  2XTB A;  4CVM A;  1E8C A;  4BUB A;  3LHX A;  2X5O A;  4N09 A;  3RT7 A;  1GQQ A;  3RQ2 A;  3RPZ A;  3NL2 A;  3DRW A;  3GO7 A;  3ZM5 A;  2JGV A;  4E69 A;  5C40 A;  3NL3 A;  4XDA A;  1YGJ A;  3RT9 A;  3UMP A;  3IBQ A;  3PZS A;  3LJS A;  3JUL A;  4E84 A;  1VM7 A;  4KBE A;  1LIO A;  3ZL8 A;  3VAQ A;  2VOS A;  1GG4 A;  4YWR A;  3RQ6 A;  4C5K A;  2VTE A;  5CM5 A;  3HIC A;  1EEH A;  3NBV A;  1RK2 A;  1O5Z A;  2R3B A;  1V1B A;  3H74 A;  2AA0 A;  1BX4 A;  4EN4 A;  1KYH A;  2VOR A;  3UQE A;  4HV4 A;  2XJA A;  4YL5 A;  3MBJ A;  5A5F A;  3EAG A;  1FGS A;  5CGA A;  4S1M A;  4GM6 A;  2GCA A;  3NM1 A;  2JG5 A;  5BYD A;  3W4S A;  2QCV A;  2C49 A;  1GQT A;  4XF6 A;  3RQ8 A;  3UMO A;  3OTX A;  2F02 A;  4WJM A;  1V1A A;  1YGK A;  4O1L A;  3UQD A;  3HYO A;  3CQD A;  4K8P A;  4LBG A;  1W7K A;  2UUO A;  1C3Q A;  1ESQ A;  3IKH A;  4LCA A;  4O1G A;  3NRS A;  1RKD A;  2AFB A;  2PKM A;  2PKN A;  3RS9 A;  3RRE A;  4C13 A;  2DCN A;  3NM3 A;  3PL2 A;  3KZH A;  3NC2 A;  3QAI A;  3QCZ A;  4K8K A;  1JBW A;  3RTC A;  2PKK A;  4QDI A;  4KAD A;  1EKQ A;  4UAG A;  3RPH A;  3RQQ A;  1LIK A;  1JBV A;  5EY7 A;  4C5M A;  3KD6 A;  5C3Y A;  1W78 A;  2Q5R A;  1RFT A;  3B1R A;  2I6B A;  2PKF A;  2RBC A;  3RSS A;  4BUC A;  4E8W A;  1RKS A;  1WYE A;  2VTD A;  3RTD A;  2AX3 A;  2YXU A;  4X8F A;  2F7K A;  4S1I A;  3I3Y A;  2C4E A;  1P31 A;  3LKI A;  3NL5 A;  3RSF A;  3IN1 A;  4CVK A;  2JFF A;  3UAG A;  1RKA A;  2GC5 A;  5C41 A;  4S1H A;  2ABQ A;  5COJ A;  1P3D A;  2F00 A;  3RRJ A;  3B3L A;  3NBW A;  1GQY A;  4K9I A;  3RRB A;  3LK7 A;  1U2X A;  4C5J A;  3LOO A;  1V1S A;  1LHR A;  2XPC A;  3K9E A;  5B6A A;  1JXH A;  1TZ6 A;  3RM5 A;  3NCA A;  2I6A A;  4CVL A;  4DU5 A;  3BF5 A;  5A5E A;  5EYN A;  1VI9 A;  4UBE A;  3RSG A;  3RSQ A;  3RU3 A;  2AJP A;  2FV7 A;  1V19 A;  2VAR A;  3BGK A;  4JKS A;  4ZIY A;  1GC5 A;  3H49 A;  2JFG A;  3FHY A;  1ESJ A;  2JFH A;  3UQ9 A;  5BYE A;  2AJR A;  2V78 A;  5BYF A;  1RFU A;  3IE7 A;  3QA2 A;  3B1O A;  5F11 A;  2AM1 A;  4K9C A;  2A9Y A;  3ZM6 A;  3UBO A;  2GCB A;  1LII A;  4KAH A;  4XCK A;  3Q92 A;  5TQI A;  5C3Z A;  1TD2 A;  2WJP A;  5TRW A;  3RRF A;  4S1I B;  3EWM A;  4KAN A;  2HW1 A;  2I5B A;  3RQX A;  4B8R A;  4E8Z A;  3ZS7 A;  5CGE A;  3RTG A;  3UQ6 A;  1TYY A;  1VK4 A;  3DZV A;  1UB0 A;  2AB8 A;  1J6U A;  2Y68 A;  4XF7 A;  1UAG A;  3RQH A;  2JG1 A;  2WTZ A;  4JKU A;  3HPD A;  3NC9 A;  3HN7 A;  3NL6 A;  1YHJ A;  2AWD A;  2R3E A;  3RU2 A;  4EOH A;  1E0D A;  2Y67 A;  2GC6 A;  3K5W A;  3RO4 A;  4K8T A;  1UA4 A;  2UUP A;  2HLZ A;  3KTN A;  4LC4 A;  3RTB A;  4QF5 A;  1DGM A;  4K93 A;  5F0Z A;  1LIJ A;  2UAG A;  4C12 A;  3FHX A;  4DC3 A;  1RFV A;  3GBU A; 
#chains in the Genus database with same CATH homology
 3IQ0 A;  2DDO A;  1EKK A;  3B1Q A;  4C5L A;  1TZ3 A;  4EUM A;  3B1N A;  4K8C A;  1L2L A;  2QHP A;  4PVV A;  3VAS A;  4KAL A;  2ABS A;  4U7X A;  3RQ5 A;  3RS8 A;  2HQQ A;  2A9Z A;  4C5N A;  3RY7 A;  4EBU A;  3HJ6 A;  3N1C A;  1LHP A;  3IH0 A;  4E3A A;  4E8Y A;  4N08 A;  2DDW A;  4JJP A;  1JXI A;  3GO6 A;  3KEU A;  4O1L A;  2DDM A;  2NWH A;  3MBH A;  3Q1Y A;  4LBX A;  3B1P A;  4E84 A;  2YXT A;  5BYC A;  3RTA A;  4B8S A;  3RTE A;  2XTB A;  3LHX A;  4N09 A;  3RT7 A;  3RQ2 A;  3RPZ A;  3NL2 A;  3DRW A;  3GO7 A;  5C40 A;  2JGV A;  4E69 A;  3NL3 A;  4XDA A;  1YGJ A;  3UMP A;  3IBQ A;  3PZS A;  3LJS A;  3JUL A;  1VM7 A;  4KBE A;  1LIO A;  3VAQ A;  4YWR A;  4C5K A;  3RQ6 A;  5CM5 A;  3HIC A;  3NBV A;  1RK2 A;  2R3B A;  1V1B A;  3H74 A;  2AA0 A;  1BX4 A;  4EN4 A;  1KYH A;  3UQE A;  4YL5 A;  3MBJ A;  5CGA A;  4S1M A;  4GM6 A;  3NM1 A;  2JG5 A;  5BYD A;  3W4S A;  2QCV A;  2C49 A;  1GQT A;  4XF6 A;  3RQ8 A;  3UMO A;  3OTX A;  2F02 A;  4WJM A;  1V1A A;  1YGK A;  3UQD A;  3HYO A;  3CQD A;  4K8P A;  4LBG A;  3RT9 A;  1C3Q A;  1ESQ A;  3IKH A;  4LCA A;  4O1G A;  3RRJ A;  1RKD A;  2AFB A;  2PKM A;  2PKN A;  3RS9 A;  3RRE A;  2DCN A;  3NM3 A;  3PL2 A;  3KZH A;  3NC2 A;  3QAI A;  4K8K A;  3RTC A;  3RU3 A;  2PKK A;  4C5M A;  4KAD A;  1EKQ A;  3RPH A;  3RQQ A;  1LIK A;  5EY7 A;  5C3Y A;  3KD6 A;  2Q5R A;  1RFT A;  3B1R A;  2I6B A;  2PKF A;  2RBC A;  3RSS A;  4E8W A;  1RKS A;  1WYE A;  3RTD A;  2AX3 A;  2YXU A;  4X8F A;  2F7K A;  4S1I A;  3I3Y A;  2C4E A;  3LKI A;  3NL5 A;  3RSF A;  3IN1 A;  1RKA A;  5C41 A;  4S1H A;  2ABQ A;  5COJ A;  3B3L A;  3NBW A;  4K9I A;  3RRB A;  1U2X A;  4C5J A;  3LOO A;  1V1S A;  1LHR A;  3K9E A;  5B6A A;  1JXH A;  1TZ6 A;  3RM5 A;  3NCA A;  2I6A A;  4DU5 A;  3BF5 A;  5EYN A;  1VI9 A;  4UBE A;  3RSQ A;  2AJP A;  2FV7 A;  1V19 A;  2VAR A;  3BGK A;  4JKS A;  1GC5 A;  3H49 A;  3FHY A;  1ESJ A;  3UQ9 A;  5BYE A;  2AJR A;  2V78 A;  1RFU A;  3IE7 A;  3QA2 A;  3B1O A;  5F11 A;  4K9C A;  2A9Y A;  3UBO A;  1LII A;  4KAH A;  4XCK A;  3Q92 A;  5TQI A;  5C3Z A;  1TD2 A;  5TRW A;  3RRF A;  4S1I B;  3EWM A;  4KAN A;  2HW1 A;  2I5B A;  3RQX A;  4B8R A;  4E8Z A;  3ZS7 A;  5CGE A;  3RTG A;  1TYY A;  1VK4 A;  3DZV A;  1UB0 A;  2AB8 A;  4XF7 A;  3RQH A;  3RSG A;  2JG1 A;  4JKU A;  3UQ6 A;  3HPD A;  3NC9 A;  3NL6 A;  5BYF A;  1YHJ A;  2AWD A;  2R3E A;  3RU2 A;  4EOH A;  3K5W A;  3RO4 A;  4K8T A;  1UA4 A;  3RTB A;  2HLZ A;  3KTN A;  4LC4 A;  1DGM A;  4K93 A;  5F0Z A;  1LIJ A;  3FHX A;  4DC3 A;  1RFV A;  3GBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...