2DDOA

Crystal structure of pyridoxal kinase from the escherichia coli pdxk gene at 2.6 a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
271
structure length
263
Chain Sequence
KSRALQADIVAVQSQVVYGSVGNSIAVPAIKQNGLNVFAVPTVLLSNTPHYDTFYGGAIPDEWFSGYLRALQERDALRQLRAVTTGYMGTASQIKILAEWLTALRKDHPDLLIMVDPVIGDIDSGIYVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDTLKWVVVTSEMQVVVVTADSVNVISHSRVKTDLKGTGDLFCAQLISGLLKGKALTDAVHRAGLRVLEVMRYTQQHESDELILPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pyridoxal kinase from the Escherichia coli pdxK gene: implications for the classification of pyridoxal kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Pyridoxine kinase
total genus 86
structure length 263
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2ddoA00
1WYEA 3IQ0A 3ZS7A 3DZVA 3IN1A 5CGEA 3NBWA 3RQ2A 3I3YA 2ABQA 4C5JA 5TQIA 3RPHA 1V1AA 1RFVA 2F02A 3MBHA 2PKNA 3MBJA 4KANA 1YGJA 2QHPA 4KAHA 5BYEA 3RTBA 3B1QA 2DDWA 1L2LA 1ESQA 4K9CA 1GQTA 3B1RA 4XDAA 4YL5A 3RTEA 3VASA 1RFTA 3NM1A 4C5LA 4YWRA 5CGAA 3GO7A 4K8CA 3HICA 3RQHA 2XTBA 4KBEA 5EYNA 3KEUA 3UQEA 1UA4A 2JG1A 2JGVA 3RSGA 4XF7A 3KZHA 3HYOA 5BYCA 3FHYA 4XF6A 3RPZA 3RTDA 5TRWA 1V1BA 3RTAA 3EWMA 2YXUA 3Q1YA 4S1IA 4XCKA 1U2XA 1V19A 3B3LA 3RQXA 4K8TA 3IKHA 3RRFA 3CQDA 2PKFA 1LHRA 4O1LA 1BX4A 3NCAA 3NBVA 5BYFA 2A9ZA 1V1SA 4C5MA 5F0ZA 3KTNA 4C5KA 3UQDA 1UB0A 3B1NA 3RSSA 2ABSA 2I5BA 4EUMA 4KADA 1VI9A 1VM7A 2PKMA 4K93A 4LBGA 4X8FA 3NL2A 3RY7A 3UMOA 3UMPA 3UQ9A 1JXHA 3BGKA 3RTCA 4E8ZA 1DGMA 5BYDA 3N1CA 2HLZA 3Q92A 4K9IA 4UBEA 5B6AA 3RM5A 4WJMA 3NL6A 2R3BA 1VK4A 2HW1A 1LIKA 4U7XA 5COJA 1KYHA 3IBQA 3RS9A 3RREA 2AJRA 4EN4A 3RRBA 2AA0A 2C49A 4N08A 1EKKA 3UQ6A 2FV7A 3RT7A 4C5NA 4E8YA 1ESJA 4E69A 4PVVA 3OTXA 3RQ5A 4N09A 1RKAA 1EKQA 3NL3A 3RT9A 2V78A 1RKDA 1LHPA 3H49A 3QA2A 3GO6A 3RRJA 4B8RA 2YXTA 3PL2A 3RQQA 3IH0A 2DDOA 4E84A 2I6AA 4K8PA 4DU5A 2VARA 4K8KA 3VAQA 4LC4A 3QAIA 1LIJA 3JULA 3RU2A 3NC2A 3RTGA 4E3AA 3IE7A 2RBCA 2C4EA 2F7KA 3UBOA 5C41A 4DC3A 3LKIA 3NL5A 3DRWA 3NC9A 4JJPA 3LJSA 4JKUA 1YGKA 4LBXA 1LIIA 1TYYA 3PZSA 2AX3A 3B1PA 3K9EA 2DDMA 1TZ6A 1GC5A 5C3ZA 5F11A 3RS8A 2DCNA 3RQ8A 3GBUA 3LHXA 3RU3A 4JKSA 3RSQA 4S1IB 1C3QA 4E8WA 1RFUA 2NWHA 3RSFA 1RKSA 4KALA 4S1HA 5C40A 3HPDA 3NM3A 5EY7A 2I6BA 3RQ6A 1TD2A 4B8SA 3LOOA 1TZ3A 2AB8A 3FHXA 2A9YA 4GM6A 4EBUA 4LCAA 2R3EA 4EOHA 3H74A 3B1OA 4O1GA 4S1MA 2Q5RA 3K5WA 1YHJA 5C3YA 3BF5A 3RO4A 2AJPA 3W4SA 2HQQA 1RK2A 2AFBA 2PKKA 1LIOA 2JG5A 2QCVA 1JXIA 5CM5A 3KD6A 2AWDA
chains in the Genus database with same CATH superfamily
1WYEA 1J6UA 3IQ0A 3ZS7A 3DZVA 2UUOA 1JBVA 3IN1A 3NBWA 4CVKA 3RQ2A 5CGEA 3I3YA 2ABQA 1W7KA 4C5JA 4CVLA 3HN7A 5TQIA 3RPHA 1V1AA 1RFVA 2F02A 2XJAA 3MBHA 2PKNA 3MBJA 1EEHA 1YGJA 2QHPA 4KAHA 4KANA 5BYEA 3RTBA 4BUCA 3B1QA 2DDWA 1L2LA 1ESQA 4K9CA 1GQTA 3B1RA 4XDAA 4YL5A 3RTEA 3VASA 1RFTA 3NM1A 4C5LA 1P3DA 2X5OA 4YWRA 5CGAA 2Y1OA 3GO7A 4K8CA 3HICA 3RQHA 2XTBA 4KBEA 1GQQA 5EYNA 3ZM6A 1E0DA 3KEUA 3UQEA 1FGSA 1UA4A 2F00A 2JG1A 2JGVA 2VTDA 3NRSA 3RSGA 1JBWA 4XF7A 3KZHA 3N2AA 4QDIA 3HYOA 5BYCA 3FHYA 4XF6A 2GC5A 3RPZA 5TRWA 3RTDA 1V1BA 3RTAA 3EWMA 2YXUA 3Q1YA 4S1IA 4XCKA 1U2XA 1V19A 3B3LA 4UAGA 3RQXA 4K8TA 3IKHA 4QF5A 3RRFA 2AM2A 2JFFA 3CQDA 2PKFA 1LHRA 4O1LA 1BX4A 3NCAA 4CVMA 3NBVA 5BYFA 2A9ZA 1V1SA 4C5MA 5F0ZA 3KTNA 4C5KA 3UQDA 1UB0A 3B1NA 3RSSA 3EAGA 2ABSA 2I5BA 4EUMA 4KADA 4C13A 1VI9A 1VM7A 2PKMA 4K93A 4LBGA 4X8FA 3NL2A 1UAGA 3RY7A 3UMOA 3UMPA 3UQ9A 1JXHA 3BGKA 3RTCA 4E8ZA 2Y66A 1DGMA 5BYDA 3N1CA 2HLZA 3Q92A 4K9IA 4UBEA 5B6AA 3RM5A 4WJMA 2GCBA 3NL6A 2R3BA 1VK4A 2HW1A 1LIKA 1O5ZA 4U7XA 1KYHA 3IBQA 5COJA 3RS9A 3RREA 2AJRA 4EN4A 3ZM5A 3RRBA 2AA0A 2C49A 4N08A 1EKKA 3UQ6A 2FV7A 3RT7A 4C5NA 3LK7A 4E8YA 1ESJA 4E69A 4PVVA 3OTXA 3RQ5A 3HJ6A 4N09A 5CM5A 1RKAA 1EKQA 3NL3A 3RT9A 2V78A 1RKDA 1LHPA 2VOSA 2WJPA 3GO6A 3H49A 3QA2A 3RRJA 4B8RA 2YXTA 3PL2A 3RQQA 3IH0A 2DDOA 4E84A 2I6AA 4K8PA 4DU5A 2VARA 4K8KA 3VAQA 4LC4A 3QAIA 1LIJA 2JFHA 3JULA 3NC2A 3RTGA 3RU2A 3IE7A 4E3AA 3ZL8A 2RBCA 2UUPA 2C4EA 2F7KA 3UBOA 5C41A 4DC3A 2JFGA 1GG4A 3LKIA 3NL5A 3DRWA 3NC9A 4JJPA 3LJSA 4JKUA 1YGKA 4LBXA 4BUBA 1LIIA 1TYYA 3PZSA 2AM1A 2AX3A 2GC6A 3B1PA 3K9EA 4ZIYA 2DDMA 2UAGA 5A5EA 1TZ6A 1GC5A 1W78A 5C3ZA 5F11A 3RS8A 2DCNA 3RQ8A 3GBUA 3LHXA 3RU3A 5A5FA 4JKSA 3RSQA 4S1IB 1C3QA 4E8WA 1RFUA 2NWHA 3RSFA 1RKSA 2WTZA 4KALA 4S1HA 2Y67A 3UAGA 2VTEA 5C40A 1P31A 3HPDA 3NM3A 5EY7A 2I6BA 3RQ6A 1TD2A 4B8SA 3LOOA 1TZ3A 2AB8A 3FHXA 2A9YA 4GM6A 4EBUA 2Y68A 4LCAA 2R3EA 4EOHA 1GQYA 3B1OA 3H74A 4O1GA 2GCAA 4C12A 4S1MA 4HV4A 2Q5RA 3K5WA 1YHJA 3QCZA 5C3YA 3BF5A 3RO4A 2AJPA 3W4SA 2VORA 2HQQA 1RK2A 2AFBA 1LIOA 2JG5A 2PKKA 2QCVA 1JXIA 2XPCA 1E8CA 3KD6A 3PYZA 2AWDA
chains in the Genus database with same CATH topology
1WYEA 3IQ0A 3ZS7A 3DZVA 3IN1A 5CGEA 3NBWA 3RQ2A 3I3YA 2ABQA 4C5JA 5TQIA 3RPHA 1V1AA 1RFVA 2F02A 3MBHA 2PKNA 3MBJA 4KANA 1YGJA 2QHPA 4KAHA 5BYEA 3RTBA 3B1QA 2DDWA 1L2LA 1ESQA 4K9CA 1GQTA 3B1RA 4XDAA 4YL5A 3RTEA 3VASA 1RFTA 3NM1A 4C5LA 4YWRA 5CGAA 3GO7A 4K8CA 3HICA 3RQHA 2XTBA 4KBEA 5EYNA 3KEUA 3UQEA 1UA4A 2JG1A 2JGVA 3RSGA 4XF7A 3KZHA 3HYOA 5BYCA 3FHYA 4XF6A 3RPZA 3RTDA 5TRWA 1V1BA 3RTAA 3EWMA 2YXUA 3Q1YA 4S1IA 4XCKA 1U2XA 1V19A 3B3LA 3RQXA 4K8TA 3IKHA 3RRFA 3CQDA 2PKFA 1LHRA 4O1LA 1BX4A 3NCAA 3NBVA 5BYFA 2A9ZA 1V1SA 4C5MA 5F0ZA 3KTNA 4C5KA 3UQDA 1UB0A 3B1NA 3RSSA 2ABSA 2I5BA 4EUMA 4KADA 1VI9A 1VM7A 2PKMA 4K93A 4LBGA 4X8FA 3NL2A 3RY7A 3UMOA 3UMPA 3UQ9A 1JXHA 3BGKA 3RTCA 4E8ZA 1DGMA 5BYDA 3N1CA 2HLZA 3Q92A 4K9IA 4UBEA 5B6AA 3RM5A 4WJMA 3NL6A 2R3BA 1VK4A 2HW1A 1LIKA 4U7XA 5COJA 1KYHA 3IBQA 3RS9A 3RREA 2AJRA 4EN4A 3RRBA 2AA0A 2C49A 4N08A 1EKKA 3UQ6A 2FV7A 3RT7A 4C5NA 4E8YA 1ESJA 4E69A 4PVVA 3OTXA 3RQ5A 3HJ6A 4N09A 1RKAA 1EKQA 3NL3A 3RT9A 2V78A 1RKDA 1LHPA 3H49A 3QA2A 3GO6A 3RRJA 4B8RA 2YXTA 3PL2A 3RQQA 3IH0A 2DDOA 4E84A 2I6AA 4K8PA 4DU5A 2VARA 4K8KA 3VAQA 4LC4A 3QAIA 1LIJA 3JULA 3RU2A 3NC2A 3RTGA 4E3AA 3IE7A 2RBCA 2C4EA 2F7KA 3UBOA 5C41A 4DC3A 3LKIA 3NL5A 3DRWA 3NC9A 4JJPA 3LJSA 4JKUA 1YGKA 4LBXA 1LIIA 1TYYA 3PZSA 2AX3A 3B1PA 3K9EA 2DDMA 1TZ6A 1GC5A 5C3ZA 5F11A 3RS8A 2DCNA 3RQ8A 3GBUA 3LHXA 3RU3A 4JKSA 3RSQA 4S1IB 1C3QA 4E8WA 1RFUA 2NWHA 3RSFA 1RKSA 4KALA 4S1HA 5C40A 3HPDA 3NM3A 5EY7A 2I6BA 3RQ6A 1TD2A 4B8SA 3LOOA 1TZ3A 2AB8A 3FHXA 2A9YA 4GM6A 4EBUA 4LCAA 2R3EA 4EOHA 3H74A 3B1OA 4O1GA 4S1MA 2Q5RA 3K5WA 1YHJA 5C3YA 3BF5A 3RO4A 2AJPA 3W4SA 2HQQA 1RK2A 2AFBA 2PKKA 1LIOA 2JG5A 2QCVA 1JXIA 5CM5A 3KD6A 2AWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYE A;  3IQ0 A;  3ZS7 A;  3DZV A;  3IN1 A;  5CGE A;  3NBW A;  3RQ2 A;  3I3Y A;  2ABQ A;  4C5J A;  5TQI A;  3RPH A;  1V1A A;  1RFV A;  2F02 A;  3MBH A;  2PKN A;  3MBJ A;  4KAN A;  1YGJ A;  2QHP A;  4KAH A;  5BYE A;  3RTB A;  3B1Q A;  2DDW A;  1L2L A;  1ESQ A;  4K9C A;  1GQT A;  3B1R A;  4XDA A;  4YL5 A;  3RTE A;  3VAS A;  1RFT A;  3NM1 A;  4C5L A;  4YWR A;  5CGA A;  3GO7 A;  4K8C A;  3HIC A;  3RQH A;  2XTB A;  4KBE A;  5EYN A;  3KEU A;  3UQE A;  1UA4 A;  2JG1 A;  2JGV A;  3RSG A;  4XF7 A;  3KZH A;  3HYO A;  5BYC A;  3FHY A;  4XF6 A;  3RPZ A;  3RTD A;  5TRW A;  1V1B A;  3RTA A;  3EWM A;  2YXU A;  3Q1Y A;  4S1I A;  4XCK A;  1U2X A;  1V19 A;  3B3L A;  3RQX A;  4K8T A;  3IKH A;  3RRF A;  3CQD A;  2PKF A;  1LHR A;  4O1L A;  1BX4 A;  3NCA A;  3NBV A;  5BYF A;  2A9Z A;  1V1S A;  4C5M A;  5F0Z A;  3KTN A;  4C5K A;  3UQD A;  1UB0 A;  3B1N A;  3RSS A;  2ABS A;  2I5B A;  4EUM A;  4KAD A;  1VI9 A;  1VM7 A;  2PKM A;  4K93 A;  4LBG A;  4X8F A;  3NL2 A;  3RY7 A;  3UMO A;  3UMP A;  3UQ9 A;  1JXH A;  3BGK A;  3RTC A;  4E8Z A;  1DGM A;  5BYD A;  3N1C A;  2HLZ A;  3Q92 A;  4K9I A;  4UBE A;  5B6A A;  3RM5 A;  4WJM A;  3NL6 A;  2R3B A;  1VK4 A;  2HW1 A;  1LIK A;  4U7X A;  5COJ A;  1KYH A;  3IBQ A;  3RS9 A;  3RRE A;  2AJR A;  4EN4 A;  3RRB A;  2AA0 A;  2C49 A;  4N08 A;  1EKK A;  3UQ6 A;  2FV7 A;  3RT7 A;  4C5N A;  4E8Y A;  1ESJ A;  4E69 A;  4PVV A;  3OTX A;  3RQ5 A;  4N09 A;  1RKA A;  1EKQ A;  3NL3 A;  3RT9 A;  2V78 A;  1RKD A;  1LHP A;  3H49 A;  3QA2 A;  3GO6 A;  3RRJ A;  4B8R A;  2YXT A;  3PL2 A;  3RQQ A;  3IH0 A;  2DDO A;  4E84 A;  2I6A A;  4K8P A;  4DU5 A;  2VAR A;  4K8K A;  3VAQ A;  4LC4 A;  3QAI A;  1LIJ A;  3JUL A;  3RU2 A;  3NC2 A;  3RTG A;  4E3A A;  3IE7 A;  2RBC A;  2C4E A;  2F7K A;  3UBO A;  5C41 A;  4DC3 A;  3LKI A;  3NL5 A;  3DRW A;  3NC9 A;  4JJP A;  3LJS A;  4JKU A;  1YGK A;  4LBX A;  1LII A;  1TYY A;  3PZS A;  2AX3 A;  3B1P A;  3K9E A;  2DDM A;  1TZ6 A;  1GC5 A;  5C3Z A;  5F11 A;  3RS8 A;  2DCN A;  3RQ8 A;  3GBU A;  3LHX A;  3RU3 A;  4JKS A;  3RSQ A;  4S1I B;  1C3Q A;  4E8W A;  1RFU A;  2NWH A;  3RSF A;  1RKS A;  4KAL A;  4S1H A;  5C40 A;  3HPD A;  3NM3 A;  5EY7 A;  2I6B A;  3RQ6 A;  1TD2 A;  4B8S A;  3LOO A;  1TZ3 A;  2AB8 A;  3FHX A;  2A9Y A;  4GM6 A;  4EBU A;  4LCA A;  2R3E A;  4EOH A;  3H74 A;  3B1O A;  4O1G A;  4S1M A;  2Q5R A;  3K5W A;  1YHJ A;  5C3Y A;  3BF5 A;  3RO4 A;  2AJP A;  3W4S A;  2HQQ A;  1RK2 A;  2AFB A;  2PKK A;  1LIO A;  2JG5 A;  2QCV A;  1JXI A;  5CM5 A;  3KD6 A;  2AWD A; 
#chains in the Genus database with same CATH topology
 1WYE A;  1J6U A;  3IQ0 A;  3ZS7 A;  3DZV A;  2UUO A;  1JBV A;  3IN1 A;  3NBW A;  4CVK A;  3RQ2 A;  5CGE A;  3I3Y A;  2ABQ A;  1W7K A;  4C5J A;  4CVL A;  3HN7 A;  5TQI A;  3RPH A;  1V1A A;  1RFV A;  2F02 A;  2XJA A;  3MBH A;  2PKN A;  3MBJ A;  1EEH A;  1YGJ A;  2QHP A;  4KAH A;  4KAN A;  5BYE A;  3RTB A;  4BUC A;  3B1Q A;  2DDW A;  1L2L A;  1ESQ A;  4K9C A;  1GQT A;  3B1R A;  4XDA A;  4YL5 A;  3RTE A;  3VAS A;  1RFT A;  3NM1 A;  4C5L A;  1P3D A;  2X5O A;  4YWR A;  5CGA A;  2Y1O A;  3GO7 A;  4K8C A;  3HIC A;  3RQH A;  2XTB A;  4KBE A;  1GQQ A;  5EYN A;  3ZM6 A;  1E0D A;  3KEU A;  3UQE A;  1FGS A;  1UA4 A;  2F00 A;  2JG1 A;  2JGV A;  2VTD A;  3NRS A;  3RSG A;  1JBW A;  4XF7 A;  3KZH A;  3N2A A;  4QDI A;  3HYO A;  5BYC A;  3FHY A;  4XF6 A;  2GC5 A;  3RPZ A;  5TRW A;  3RTD A;  1V1B A;  3RTA A;  3EWM A;  2YXU A;  3Q1Y A;  4S1I A;  4XCK A;  1U2X A;  1V19 A;  3B3L A;  4UAG A;  3RQX A;  4K8T A;  3IKH A;  4QF5 A;  3RRF A;  2AM2 A;  2JFF A;  3CQD A;  2PKF A;  1LHR A;  4O1L A;  1BX4 A;  3NCA A;  4CVM A;  3NBV A;  5BYF A;  2A9Z A;  1V1S A;  4C5M A;  5F0Z A;  3KTN A;  4C5K A;  3UQD A;  1UB0 A;  3B1N A;  3RSS A;  3EAG A;  2ABS A;  2I5B A;  4EUM A;  4KAD A;  4C13 A;  1VI9 A;  1VM7 A;  2PKM A;  4K93 A;  4LBG A;  4X8F A;  3NL2 A;  1UAG A;  3RY7 A;  3UMO A;  3UMP A;  3UQ9 A;  1JXH A;  3BGK A;  3RTC A;  4E8Z A;  2Y66 A;  1DGM A;  5BYD A;  3N1C A;  2HLZ A;  3Q92 A;  4K9I A;  4UBE A;  5B6A A;  3RM5 A;  4WJM A;  2GCB A;  3NL6 A;  2R3B A;  1VK4 A;  2HW1 A;  1LIK A;  1O5Z A;  4U7X A;  1KYH A;  3IBQ A;  5COJ A;  3RS9 A;  3RRE A;  2AJR A;  4EN4 A;  3ZM5 A;  3RRB A;  2AA0 A;  2C49 A;  4N08 A;  1EKK A;  3UQ6 A;  2FV7 A;  3RT7 A;  4C5N A;  3LK7 A;  4E8Y A;  1ESJ A;  4E69 A;  4PVV A;  3OTX A;  3RQ5 A;  3HJ6 A;  4N09 A;  5CM5 A;  1RKA A;  1EKQ A;  3NL3 A;  3RT9 A;  2V78 A;  1RKD A;  1LHP A;  2VOS A;  2WJP A;  3GO6 A;  3H49 A;  3QA2 A;  3RRJ A;  4B8R A;  2YXT A;  3PL2 A;  3RQQ A;  3IH0 A;  2DDO A;  4E84 A;  2I6A A;  4K8P A;  4DU5 A;  2VAR A;  4K8K A;  3VAQ A;  4LC4 A;  3QAI A;  1LIJ A;  2JFH A;  3JUL A;  3NC2 A;  3RTG A;  3RU2 A;  3IE7 A;  4E3A A;  3ZL8 A;  2RBC A;  2UUP A;  2C4E A;  2F7K A;  3UBO A;  5C41 A;  4DC3 A;  2JFG A;  1GG4 A;  3LKI A;  3NL5 A;  3DRW A;  3NC9 A;  4JJP A;  3LJS A;  4JKU A;  1YGK A;  4LBX A;  4BUB A;  1LII A;  1TYY A;  3PZS A;  2AM1 A;  2AX3 A;  2GC6 A;  3B1P A;  3K9E A;  4ZIY A;  2DDM A;  2UAG A;  5A5E A;  1TZ6 A;  1GC5 A;  1W78 A;  5C3Z A;  5F11 A;  3RS8 A;  2DCN A;  3RQ8 A;  3GBU A;  3LHX A;  3RU3 A;  5A5F A;  4JKS A;  3RSQ A;  4S1I B;  1C3Q A;  4E8W A;  1RFU A;  2NWH A;  3RSF A;  1RKS A;  2WTZ A;  4KAL A;  4S1H A;  2Y67 A;  3UAG A;  2VTE A;  5C40 A;  1P31 A;  3HPD A;  3NM3 A;  5EY7 A;  2I6B A;  3RQ6 A;  1TD2 A;  4B8S A;  3LOO A;  1TZ3 A;  2AB8 A;  3FHX A;  2A9Y A;  4GM6 A;  4EBU A;  2Y68 A;  4LCA A;  2R3E A;  4EOH A;  1GQY A;  3B1O A;  3H74 A;  4O1G A;  2GCA A;  4C12 A;  4S1M A;  4HV4 A;  2Q5R A;  3K5W A;  1YHJ A;  3QCZ A;  5C3Y A;  3BF5 A;  3RO4 A;  2AJP A;  3W4S A;  2VOR A;  2HQQ A;  1RK2 A;  2AFB A;  1LIO A;  2JG5 A;  2PKK A;  2QCV A;  1JXI A;  2XPC A;  1E8C A;  3KD6 A;  3PYZ A;  2AWD A; 
#chains in the Genus database with same CATH homology
 1WYE A;  3IQ0 A;  3ZS7 A;  3DZV A;  3IN1 A;  5CGE A;  3NBW A;  3RQ2 A;  3I3Y A;  2ABQ A;  4C5J A;  5TQI A;  3RPH A;  1V1A A;  1RFV A;  2F02 A;  3MBH A;  2PKN A;  3MBJ A;  4KAN A;  1YGJ A;  2QHP A;  4KAH A;  5BYE A;  3RTB A;  3B1Q A;  2DDW A;  1L2L A;  1ESQ A;  4K9C A;  1GQT A;  3B1R A;  4XDA A;  4YL5 A;  3RTE A;  3VAS A;  1RFT A;  3NM1 A;  4C5L A;  4YWR A;  5CGA A;  3GO7 A;  4K8C A;  3HIC A;  3RQH A;  2XTB A;  4KBE A;  5EYN A;  3KEU A;  3UQE A;  1UA4 A;  2JG1 A;  2JGV A;  3RSG A;  4XF7 A;  3KZH A;  3HYO A;  5BYC A;  3FHY A;  4XF6 A;  3RPZ A;  3RTD A;  5TRW A;  1V1B A;  3RTA A;  3EWM A;  2YXU A;  3Q1Y A;  4S1I A;  4XCK A;  1U2X A;  1V19 A;  3B3L A;  3RQX A;  4K8T A;  3IKH A;  3RRF A;  3CQD A;  2PKF A;  1LHR A;  4O1L A;  1BX4 A;  3NCA A;  3NBV A;  5BYF A;  2A9Z A;  1V1S A;  4C5M A;  5F0Z A;  3KTN A;  4C5K A;  3UQD A;  1UB0 A;  3B1N A;  3RSS A;  2ABS A;  2I5B A;  4EUM A;  4KAD A;  1VI9 A;  1VM7 A;  2PKM A;  4K93 A;  4LBG A;  4X8F A;  3NL2 A;  3RY7 A;  3UMO A;  3UMP A;  3UQ9 A;  1JXH A;  3BGK A;  3RTC A;  4E8Z A;  1DGM A;  5BYD A;  3N1C A;  2HLZ A;  3Q92 A;  4K9I A;  4UBE A;  5B6A A;  3RM5 A;  4WJM A;  3NL6 A;  2R3B A;  1VK4 A;  2HW1 A;  1LIK A;  4U7X A;  5COJ A;  1KYH A;  3IBQ A;  3RS9 A;  3RRE A;  2AJR A;  4EN4 A;  3RRB A;  2AA0 A;  2C49 A;  4N08 A;  1EKK A;  3UQ6 A;  2FV7 A;  3RT7 A;  4C5N A;  4E8Y A;  1ESJ A;  4E69 A;  4PVV A;  3OTX A;  3RQ5 A;  3HJ6 A;  4N09 A;  1RKA A;  1EKQ A;  3NL3 A;  3RT9 A;  2V78 A;  1RKD A;  1LHP A;  3H49 A;  3QA2 A;  3GO6 A;  3RRJ A;  4B8R A;  2YXT A;  3PL2 A;  3RQQ A;  3IH0 A;  2DDO A;  4E84 A;  2I6A A;  4K8P A;  4DU5 A;  2VAR A;  4K8K A;  3VAQ A;  4LC4 A;  3QAI A;  1LIJ A;  3JUL A;  3RU2 A;  3NC2 A;  3RTG A;  4E3A A;  3IE7 A;  2RBC A;  2C4E A;  2F7K A;  3UBO A;  5C41 A;  4DC3 A;  3LKI A;  3NL5 A;  3DRW A;  3NC9 A;  4JJP A;  3LJS A;  4JKU A;  1YGK A;  4LBX A;  1LII A;  1TYY A;  3PZS A;  2AX3 A;  3B1P A;  3K9E A;  2DDM A;  1TZ6 A;  1GC5 A;  5C3Z A;  5F11 A;  3RS8 A;  2DCN A;  3RQ8 A;  3GBU A;  3LHX A;  3RU3 A;  4JKS A;  3RSQ A;  4S1I B;  1C3Q A;  4E8W A;  1RFU A;  2NWH A;  3RSF A;  1RKS A;  4KAL A;  4S1H A;  5C40 A;  3HPD A;  3NM3 A;  5EY7 A;  2I6B A;  3RQ6 A;  1TD2 A;  4B8S A;  3LOO A;  1TZ3 A;  2AB8 A;  3FHX A;  2A9Y A;  4GM6 A;  4EBU A;  4LCA A;  2R3E A;  4EOH A;  3H74 A;  3B1O A;  4O1G A;  4S1M A;  2Q5R A;  3K5W A;  1YHJ A;  5C3Y A;  3BF5 A;  3RO4 A;  2AJP A;  3W4S A;  2HQQ A;  1RK2 A;  2AFB A;  2PKK A;  1LIO A;  2JG5 A;  2QCV A;  1JXI A;  5CM5 A;  3KD6 A;  2AWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...