2DDQH

Crystal structure of the fab fragment of a r310 antibody complexed with (r)-hne-histidine adduct
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
211
Chain Sequence
b'KVKLQESGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCAPYGGYWGQGTTVTVSSAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R310 antibody heavy chain
molecule tags Immune system
source organism Mus musculus
publication title Bispecific abs against modified protein and DNA with oxidized lipids
pubmed doi rcsb
total genus 40
structure length 211
sequence length 213
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ddqH02
3T4AB 1AKJA 4Z7UA 5CIPA 5DFVC 4GMTL 4M6MH 1I7UA 4KJYA 3FO2B 2X44D 4ZO8A 1Q72L 2P5WA 1UWEH 1KCLA 2CIKB 5CINH 3V6OA 2DQIL 2VQUA 1VCAA 1YEKL 4CW1A 2X4QB 1JF5A 4KK6C 1QPPA 5DS8B 1JCKA 2AJVH 5EU5A 3OTTA 3DRTB 4PJIA 4IHOA 1Z0MA 3QIWD 1KCSL 2CR3A 2DQIH 3DVIA 5CINL 1OW0C 1A3RL 4QHKI 5JQ6H 1MCWW 3V0WH 4ZOCA 3PHSA 2DIBA 3GNML 2A73A 3LQZB 5ICXB 4JKMA 2OMBA 4Q9QH 3SE8H 5I8EA 4WI3A 1NC4B 3CDGA 3RTQD 1WEJL 1D6EB 4OLEA 1RZIB 3CFIC 3BW9A 2BY0A 3GBML 5FK9B 5I1DB 1D9KB 2FYYB 4HJGA 5I1IH 4IRSB 4DKEL 2D7TH 4Z76A 5F97E 1H8SA 5SWZB 2PTTA 4QGTA 3IDJB 4YFLI 4G6ML 5I1KH 1H5BB 3WUWA 4WCYL 1CI5A 3L5IA 4GRWF 4ONGL 2GTZA 4OGYL 3QFJD 2ZOKB 3AVEA 4LSVL 4BUHA 2IEPA 4YHYB 5IVNA 1CXKA 4APQA 3MLWL 3D2UA 5FYKH 2AXFB 4RNRA 5JLZB 3TYGL 5CEZD 3V79C 4GLRH 5L2KA 2C4FU 3G6JB 2Q20A 2IH1A 4EN3C 4HDIB 5E8NA 3L7EB 5IESL 4XNYL 4XPBL 5KVEL 3QHZL 4KROB 1ZWIB 2M2DA 4K23H 3QUMB 1DN2A 4CNIB 4NQEA 4GRWE 3QO0B 2XQYG 3DIFA 1INEH 4XXDB 1CS6A 1FNAA 2QKIB 4FQJH 4JRYE 1T20B 1CCZA 3UP1A 5BVPH 4ZS7L 3BUYA 3IXAA 3HRZA 3SHSA 3ZKMC 4XMLL 3ILPB 1QQDB 3W82A 1T66D 1IGCH 2GY5A 1T0MA 4YC2B 3GB7A 5D5MA 5DRWA 2AK4D 5DRNA 3FONA 3MJ9A 3MV01 5FO7B 1P7QD 2IPKA 1AXTH 1DQJB 2AEWA 5KVDL 2ADFL 2AJYL 5C09B 2YK1L 4YHIA 5TDOB 2DD8H 3T4YA 3GI9H 1U8IA 4JFEA 4JB9H 5DJYB 4KUCD 4MJ5A 4P59L 4WGWB 1BD2A 4NKMA 3WNLA 1VFMA 3MRQA 1P84K 5GGUB 3U4EA 5JZ7C 2YN5A 2Z4QB 4W4OA 3UTTB 3MREB 4PRIE 4WW2B 1AXSA 5C0IB 5J56B 4R26L 2NYYD 3IDNB 3L3IB 4ALAL 4LHUG 4G8GD 4MNQA 2DLGA 2PYFB 5D2NE 4R2GB 4JFED 3PABA 5J1SC 4MJIE 1NKRA 1U8HA 1I7TA 2YEZB 3M17B 2DKUA 3PL6C 4Z7UB 5CIPB 4G8IB 4XCEB 2DF3A 4PJAE 2UYLA 3QH3B 3WIIH 1TNNA 4K7PX 3T0WA 2X4RB 3QA3A 3NFNA 5SX5K 4WWKA 1QR4A 4AK1A 4MVBD 2D0FA 3WLWC 4YK4B 4L3AA 1A9BA 1Y18B 2XWBA 1IGIL 3HMXA 5ID0A 4OM1L 3O2DH 4G6JL 3RY6C 4IOSD 3WFDL 3LQZA 3QHTC 4KK5C 3FRUB 4GRLB 2IMMA 4WHTB 1PEWA 1NBVL 1R3JB 1CK0L 2FB4H 4R0LA 5DMJB 5TE7H 5GGTL 4CADB 3SDAA 2DQHL 2BRQA 3E6HB 5ISZD 5F1SA 5LAXA 3HI1A 3MV8D 4LIQH 4XP4L 2VLRA 4UV7H 2OR9L 1AO7A 5HHOE 4AMKH 4ZO7A 4XC1L 5DUBA 4BSJA 3MO1B 3QNXA 4XPHH 3DX6B 5IV2B 3IDIB 3QXTA 5KS9A 5KVEH 1DUYB 3V4VH 1T22A 4EI6B 2QL1A 2BOCB 3IAPA 1E6JL 2P47B 3LN5B 3O8XC 5SWZE 3GBLA 5DJDA 5HVWA 1M05A 1INDH 4XXCA 3WO4C 1I9RL 4ZNCD 3RNQA 2GFBB 4XCYA 4X6DE 4UIKH 1CGTA 4WJ5B 5HHME 1QP1A 3QG6A 3QZWG 3SN6N 2GQHA 4JFHE 3NCBB 2OCFD 2BVOB 2AABH 1A7OL 4OCNC 1YDPB 3VXUD 1OWRM 2O5YL 3H9HA 5I8KH 1ZWIA 1LE5B 2R0ZL 1NAMH 4KZEL 2YD6A 1FVEB 1Y6NR 5F89B 2D7TL 4GRLC 3VFNB 2C9AA 2Q76B 4L3EA 3DIFB 3KS0J 5FYKE 3UPRA 5BJTA 3GBMH 4QNPF 4O2FB 3UJTH 3B9AA 3TFKC 5LWYH 4LOUC 3EYVB 3LEVL 2MJWA 3MSPA 4F7PB 4ZOEA 2R2HA 1WWBX 3L3HB 1XF2B 5FYKD 3IXTA 4APQD 1XGTA 3VW3H 4MCZA 5CGTA 2WUBH 3STLA 4OB5H 4HCRA 3R8QA 3PWVA 1HQRA 1NGQH 3EO9H 5IM7B 4X7TB 1ADQL 3VXPA 2C3VA 3DGGB 3ZKQD 3P9WB 3FB5A 2NMSA 5HVFB 5T1MA 2AJVL 5GJSH 3P9LA 3SEPA 3DMMB 1A02N 3CLFH 3FQNA 2VOTA 1YEKH 2XZAH 3BD3A 5HI5D 4WEBL 4TUJA 3TN0C 1X6NA 1RHFA 1I8MA 5FM8A 2R23A 2XI9A 4ZPVA 2X89D 3S8WA 3RPIA 1Q0XH 1CICB 3ARQA 3AM8C 5GGVH 3RU8L 3QDJA 5E8OA 3EYFA 5BW7A 4NNXB 2V2XA 2WUCL 5ESQA 1J0HA 4QHMB 3RX7A 4JDZA 1QYGL 2A38A 5EU6B 3JTSB 3QZWB 3TWCL 1WBXB 3EYOA 3FOMB 5EC1B 3SOBH 4I3SH 1ZOXA 4WV1A 3G6DL 4KXZH 3ZE1F 4ISVA 1LO3L 2HVKA 5E8PB 5HI4D 2VDKL 3QWOB 4FZEL 5I8OH 1R3KA 4GW5B 4I4WA 4WTWA 1UYWL 4L8BA 2A6DA 4GKNB 3QUXA 5CZXD 4UT7L 2DBJA 4PJEE 3U48A 3DXAA 5I30L 2A0LD 3MNVA 1OAYL 1QPXA 5JXEC 1ZT4B 2FEEI 4XWGH 4YHZH 3ZL4L 4O00A 1BOGB 2MCG1 3TC9A 4DUWA 3VI3F 1WF5A 3FMGL 5EO9A 4OGAC 1WT5C 2XWTA 4XCFH 5F7EH 4K3EH 4R4FH 1IGTA 1IGYA 2WWMC 4Y4FA 4PIRF 1SYSA 1A9EA 1UH3A 2OJEA 3ETBF 5D7KE 4WW2C 5JW4N 1XGYH 3LB6D 1QSVA 4U6TA 1UM5H 5GSVB 4BQ8A 3S7GA 1F3RB 4P2QA 5IB1B 5I1LB 3O6FC 4GKZB 3IS1X 4RA0C 1SEBA 4BKLB 1XGRB 2AKRA 4GQPH 5IQ9A 4R3SA 3O41A 1T03L 3QNXB 5D7LE 3H9YA 1U0QA 1F4XH 3FN0H 4PJ5B 5GHWL 4UT9H 1BQSA 2W0PA 4ODVL 1QRND 1R5VB 5D2LA 3T4AA 2P49B 1OT2A 2D7QA 1RULL 4KMTL 4X4YA 5GGSY 2GJZB 1A7BA 4ODUB 1J87A 2UV3A 4OZGE 5K33A 3LEXA 4GAYA 3VGDA 3GMOB 1OAUH 4HKBA 1ITBB 4HX1B 1A1NA 4IOFC 1SYVB 5C3LD 1U92B 4LPCA 2QBWA 4P23A 3J7HA 4Q6YA 2HJKA 4DFIA 2IFFH 4IHOB 2N1KA 5SX5H 3C60B 4J1UA 4CBPA 5EG6C 3NVQA 2AV7B 3GRWH 1I3UA 2NZ9D 5L88H 3MRRB 1F6AB 3IFLL 2C3HA 5F70A 3SGKA 2OSLB 3SE3A 3QQ3A 3HPLA 4U31A 5H94B 4AL8H 1RV6X 1MY5A 3TN0B 1MELA 4ZUWB 1S5IH 4YXKH 1KN4L 1R3IL 5GRVK 4ZNEE 2CMRH 1IKNC 4PG9B 2OZ4H 4XMKL 2DQDH 5IHZA 2VXQH 4YGVA 5DC0A 4HBCL 4P4RB 4NZTH 1FN4A 4HXBL 4WY7H 1QUNA 3PP4L 5CGYD 3KYOB 3UO1L 3VXUA 1F13A 5IFHH 4WU5A 3IDJA 2APTA 4YR6A 5LXGL 3VFUA 5GIRB 4O2EA 1NEZG 4CDHA 2C3VB 3MJ7B 3C2AH 5KN5B 5FGBC 43CAA 5AAWA 1MI5E 2VXVH 2HA1A 2ZOKA 1FZJA 1LP9F 2CKBL 4X99A 3HPJB 1BP3B 2DAVA 1JNLL 1TNMA 5C0DB 4MA3A 4LRIC 1CU4L 3BEWB 1SEQH 1GL4B 4D8PB 1YY9D 5E2TL 4J3XA 3WO4B 1F90H 3K8LA 4R7NB 2ITCB 4JGJA 3DHJA 2P7TA 4Q7DA 1IM9D 1BF8A 1CFVH 5D72H 5D8JH 2EH7H 1HHJA 5AYUL 1QHOA 2CDGA 2PYED 1Q0YH 1IL1A 4FTVA 1KPVA 5HDOA 4X80L 3KYMB 1CD9B 4XNUH 3QUZB 4YBQD 2AGJL 3V4UH 4WU7B 4A6YA 4NQEE 1U91B 2X7LA 5J3HC 5HYSG 4QY8B 3OR6B 3BI9X 1NGPH 5EOTB 4U6VH 3WDHA 4M1DL 1LE9A 5CP7A 4BSVB 1YPZF 2HTKD 4HD9A 4K3JH 4LVNC 4ZXBA 2P8MB 5C0CB 5BQ7A 2W60A 3AAZB 1BVZA 4JCLA 1AGDB 2UWEB 4YHIB 2HFFA 2XQYK 2FX9H 3CFBA 2R9HD 3O45A 1XH3A 2XG5A 3QPQD 4WFHD 2H32A 4GJTB 1F8TH 4ZDHA 4CN4A 4J6RH 3WLWD 1X6LA 3X17A 1I1YB 4TNVF 4ZXBD 1IM9B 4DUVA 3L3GB 5I15H 3CCHB 2ZCKL 4J3OC 4CKVX 4LP5A 4LLWB 3RL2A 3QIUB 4OZFG 5EZIL 2ORBH 4OI8A 1KTLA 5J3HD 2EE6A 4CRPA 3C6LA 3VRLF 4XAKE 2VLJA 4LCCA 5DJAA 4JM4L 4LFHG 5JOEA 2EIEA 5DR5H 4J8RB 4YDVA 2W65B 3MRGB 3ULUE 2DDQH 3OG6B 1E6OL 2J6EH 4M7JH 3RUGA 1ZA3A 4OLVL 5B3JF 2DQFA 2UYLB 4NQSB 2GJZA 5D1QC 1X4ZA 4KC3B 3SDDD 4HH8A 5JA9A 1SJVA 4UT6L 2B8OT 5ICXA 5J6GA 1Q9OA 1P1ZA 2NQCA 4OCWL 5JPMB 4PY7B 4RGND 4YIQB 5IF0B 5TE6H 3H42L 2VYRE 2R9HC 5DRXA 2E7CA 2L7JA 2VDQH 1CDUA 3LN4A 2OI9B 1P2CB 1BFVH 5F88B 1QLEL 4RISH 3QB7C 4X5WA 3HB3D 4BZ2H 4QWWC 5E7BA 1RY7B 1D5MA 2CIIB 4UQ3A 1UADC 2AEPH 1UQSA 4NN7C 4R0LB 3FQWA 1H5BA 3QRGH 3WUWB 1J0ZA 1TZIA 3CFKB 1UM4H 3O11B 3TN0A 5CJQL 4K7FA 4G8GB 1SJEA 2B4CH 3SKJL 1QKZH 1VA9A 1K4DA 4LDLB 4OLUH 4ZOBA 1HILA 3GSNB 2JJTC 3WFCL 2IBBA 1DBMH 4KGJA 5DEGB 1M6OA 3BRDA 3U9PH 4ODTL 4D0BB 3CGTA 5CHNA 1F58L 2XFXB 4IRZL 1MCDA 3H0TA 4YHML 1JV5B 1V8HA 25C8H 3VXSB 5CP3H 1XEDA 3GK8H 5DUML 15C8H 2XTLA 1FZJB 1PX4A 2LQRA 3ZT6A 5EFIA 1FAIH 1ACZA 2FEEL 1VFAA 2D7OA 1QFHA 2BP3A 4FXLA 2E9BA 4MCYA 1K85A 3PWPA 4P99A 1IAMA 1BD2D 2NNAB 3VWKC 4HS3A 4R8WL 4ODWA 5EU7E 3DX7A 1T21A 4NWUL 3V7AE 4HWBA 4LRIA 3TBTB 3S4SA 2ZP0T 3EFFA 4NP4L 4JKWA 5IMKB 1URLA 2HVJB 2ED7A 3TCXA 2QQLH 4ORZC 3P30H 4U0QB 5DDHA 4PP2B 2VISB 3HI6L 3RWDA 3TBVA 1DQJA 5HVHB 5IR1A 4UILL 2MFNA 4HJ0C 3MRFB 4HS6B 4QXTB 1K6QL 1E0OB 4MB3A 5E4EC 3OKLA 3GIVA 1NGZA 5FECB 5ACZB 3GSNH 4OFIA 2YPKB 1L4IA 4P2YA 1OM3L 2YSSB 2W9EL 1KYOJ 1U8OA 3BISA 1LE9B 4K3HA 3Q1SL 1PQZA 1FPTH 4NWTH 3IF1B 3HR6A 1CLZH 5EU4B 5IM7A 3CLEL 4Y1AA 5JHLL 1RVFH 1VFBA 4UDUA 5I8CB 4WNQA 5FYJD 3P9LB 4F7TA 2JLLA 2EDHA 3IAQA 1TJGL 3DSFH 5JXED 1SY6A 5E08H 1ZT1A 1ACYH 2CLZB 3C6SA 4M4RA 3VXTB 2D0HA 1CGXA 3HMXL 2IBGA 3RX8A 2GYSA 3NCEB 1IEBA 5MERB 1G1YA 4RDQG 5I66B 3X12B 1JFQH 3DO7B 1XCTA 4UNUA 3O6KL 3QUKA 2B2XL 3D39A 3BPOB 4EVNB 3BRFA 1RZJH 3VGHA 3ULUD 1TPXC 1EHAA 1J0YA 5JHDA 4BFEA 4UNVA 3SQOH 1CL7I 3QEQA 5J9PB 4XNMB 1MQKH 4F37K 1J05B 5EBLB 3F8UB 1SQ2N 5ITFB 4TUKH 2VE6B 1ZT4A 3M8OL 3JV6A 3PIQB 5AD0A 3RIFK 4OLYL 5HYQB 1JPSH 4L4VD 2HT4C 3ORJA 4PJIB 3KPSE 1WWWX 4CVZB 4HPYL 1DSFL 1G6RH 3LHPH 3QEHA 2ICWJ 2YPLA 5CUSL 3DGCR 1IVLA 3NPSC 4N8VA 5IIEA 3BYTA 4LKCB 5L8KB 3WIFA 4F7EB 3MOAL 4UQ3B 3D2UD 3FQWB 3MA7B 5GSVA 2AVGA 1JBJA 4GKZA 4KTDH 3PDOB 5LCVL 1S8DB 4GRWH 4BYHA 4NO5B 5MENA 2FECI 3THMH 1N3NB 1RIHH 4LLAA 2WIMA 1QTYT 2HKHL 1P9MA 4MD4A 2BC4B 3FO9B 3SGDI 2Y36L 1QVOA 1FNFA 4OD2B 3WUZA 4MQSB 2X41A 4CW1B 1KEGH 4GAJH 2HRPL 1WV7T 3QPXH 1BIIA 3SBWA 2PNDA 3VXSA 1CFBA 3KPMA 3ARDA 1FZMB 1FGVL 4HF5H 2JCCE 4H8WL 3MFFB 1FNGA 4KK9D 5MEND 1GAFH 5JR1H 5IJKC 2O5ZH 5F1OB 4H26B 1N4XL 4PTUB 1OGAA 4RNRB 5LG1A 1SM3H 4F3FA 4TTDC 1K8IA 5J06A 4RGMC 4NM4H 1GOFA 2QSTA 4IRJB 1J7VR 4YXHH 3IJHA 2HYMA 4ODWB 3WNNA 1JRHH 2QQKH 2K7PA 4XRCB 3TN0D 4MQXC 1EFXA 3RJQB 4XGZA 2R2HB 1U36A 2VMFA 1JZ4A 1ZLUK 3ARVA 2A2QT 3GRWA 3FT4A 1YEFH 4DW2L 3HE7B 5FHAL 1RUML 3QWRA 3QQ3B 2HLFD 2HTLC 4HW6A 1EUUA 1NFKA 4JZOA 1MY7A 2D7MA 1FNSL 2IG2L 1NL0H 1M7XA 4PB9L 2XZQL 5DWUH 3BQUC 1PZUB 4LGRB 5EOCL 4U1MA 1E4JA 2WLYA 5IQ7H 3JWDH 3L3JB 1RK1B 3ESVF 3DURB 1KPUB 1PQZB 3LH2H 2PCPB 3NZ8A 5JW5B 5ERWA 4JHAL 5C0AB 3A67H 3RWGA 1RUMH 1N5AB 2JIXD 4Q0XL 3VWKB 3NFPA 2HH0L 4OFYD 3CZFA 3W9DB 3DXAE 4K2UH 1ZHBA 4X7EC 4XCCL 3V0VA 4Y16C 1P4IL 5C08E 4X6EB 4G6FD 4QYOB 2W9DH 5E8PA 2CLZA 1A21A 1X7QB 2R8SH 3V4PH 3QHFH 1J8HD 4LDEB 1Q9LB 3VXRA 3RAJH 2IQ9L 1KG0B 1CFNB 5FUCE 5BVJA 5IFAL 3VWJA 5I1JL 3ZDZF 1PD6A 5BRZB 1B2WL 4G7VH 2H9GA 2VKWA 5C0IA 1T0MB 3F12B 5FYJE 3T1FB 4OLWL 2MMXA 3P0YH 4I77H 1UVQA 2CDFA 1G0YR 4OZHA 4X98A 5T3XL 3GMQA 2X1QA 3UX9B 5F72S 2ED9A 2WANA 3FB7B 1C5BH 3D0VB 1HSAA 2O61B 3GSVB 4Z7VB 4GG6B 5ALBH 1RIHL 4E9LA 3MBEA 1O7SA 3UYRH 5E03A 1YN6B 4PJAA 3NFNB 4OCYL 1NDGA 2LABA 1U8JA 1WBYB 2WSKA 3RVXC 5L8JB 1P4LA 3DV6B 3GM8A 1WFOA 4RIRA 3RDTA 2IAMB 3W0WD 1JWUB 5GZOD 3TBWA 3WO3B 2ZKHH 4FRWA 1IC7H 5CSBA 3DPBA 4U0RB 3MMEB 4N8VB 4U1GB 1MRFL 5CEXB 5LGJA 3JVGA 4MNQB 4FXKA 4RGNB 3ROLB 3PABB 3IGAB 3QCUH 4OF8A 1TTFA 4DN3L 4ZDHB 5CEYB 1J0JA 2RFXA 4U49A 4HIEA 5LAXB 4JM2F 3OJ2C 3WE6B 4L4JA 3BWAB 3PDOA 4QTIL 4MNGE 1CE1L 4MJ6B 4OAWB 4L8DA 4NQVB 4FFVD 1MQKL 4HZLB 4N9OB 4WUKH 3I75A 1L0YA 3B9KC 5KSBF 5E6ZA 4NRXA 5IG7B 5SWSB 2VZ1A 3MLYH 3ZKXC 2BY1A 3MV8E 5L7XL 2J88H 3MTRA 4P5TD 4Y1AD 5L8LB 1G7MA 1OW0A 2P5WE 4LBEB 5EOCJ 3MV9B 1FZMA 3IDYC 1F2QA 3SGEI 3KLSA 5J12B 5BZDB 3DX8A 2Z31B 3WJLA 4UU9B 5T3ZD 2W0KA 4YNYA 1NCBH 1UACH 3ES6B 1RZFL 1C5DB 3MPCA 4XCNA 5E00A 3LKNA 4JQXC 3BT2L 2E27L 2JELH 3C5SB 3FFCB 3ZHLA 4RGMB 4EQ3A 5BV7H 1IGML 4KZDL 2VXSH 2J8OA 4Z5RB 3DBXA 1KB5H 2A74B 4IMLB 4ZYKA 3O3DA 2ERJB 4QRRA 3ZYZA 5HI3D 1R3HA 2Z91B 1JGEA 3HKFA 2JELL 3BT2H 2YHGA 5F1KC 3ZE0E 1NCTA 1K3ZA 1PZ5B 2ICEA 1X4YA 4N5UA 5JHLH 3LAFA 3QDGE 3VD3A 3VFTB 1CVRA 1NCDH 3WS6A 2R2EB 1JUFB 3DI3B 5T33H 2NY0B 4RGNE 2C26A 3QO1B 1GGIH 1IBGL 4TNVK 1KF9B 5F44A 4GW1A 4W70A 1S9YB 3T0ED 4ZFZA 1ZVSA 5L7XH 4A2LA 4PLKC 3GI8L 5I74C 4HIJB 2XQBH 1HH6A 2QADB 1CLCA 1IT9L 3IDXL 4FQLH 4I0PA 4PJAF 5HGBA 3ZKSD 2AJ3A 3EYSL 3RWGB 4HH9A 4OBSA 5D1QA 2G2RA 4M8VA 5HHVL 1G7QB 2QR0A 1IZJA 2IAMD 3NA9H 2DTSA 2ICWA 3CSYA 2PR4H 3DUUB 5I16B 1KSRA 1L7TH 5DMGD 3QRFM 4JVUA 1I9JH 3FZUD 1KB5A 2FZ3B 5DQJA 3JV5A 3MUGA 1RZ7L 3L3OA 4Z7OF 2FGWL 1Y0LB 5C0CE 2ESVB 1CQYA 1G9NL 1W72H 4YPGB 5FO9A 3RVXD 2DQUL 4JO3L 4TPRL 4KKNA 3OHXB 3S35H 5DSCB 1OD9A 3UJJL 4JY5L 3UJJH 4G9DA 3ARGB 3U7YH 3BPNC 4D9RE 4HKXB 1U9KA 3RWHA 3GMQB 1BAFL 3VD9A 2DQUH 3FN3A 4JO3H 5EZLA 4JRYD 3CFDA 2DLHA 5IJVA 4CU6A 4W6XB 1CE6B 1DBBL 5FECA 3DTXB 3DMMA 3ARYA 1ORSB 1OSPH 1J8HA 1QKZL 1YEIH 3MNVB 4XMPH 4Y4HC 2ICWI 4YXLL 1NDGB 4LCWD 5T1LB 5FGSA 4MAYA 1R24B 2ESVE 3BP6A 1NJ9B 1QR1B 2L4OA 1I8LA 2UWEF 4PJEB 5C09A 4QHMA 2Y23A 5IBUB 2XY1A 5DJCA 4ZTOH 3EW3B 3RQ3A 3K2UH 2FJFA 3HZYA 1A6VH 1WBXA 4XTRD 5IGXH 3C6LB 3QIBC 2OTWA 4PD4J 3RDTC 1BBJA 5FM4A 2NY2D 4HSQA 4S1SH 1SJHB 1UXSB 1RJCA 4PRHA 4I4WB 5HHXL 2JJUA 4G42A 1XGRA 3GKZA 3DWTA 4UT6H 3AU1B 3GMLB 2EE9A 3RWCB 3P9MA 3PQYE 3SDAC 4NQDB 4PD4K 3MROA 3HG1D 5MEQA 4HK3J 5I0ZA 4RGOL 3KPTA 3QCVH 2MHAA 4M48L 1HIML 5C7XH 5KS9F 1RIUL 3V5KB 3HZMA 3JTTA 1OAZL 2NY3B 1Z3GL 2AK4B 2APBA 1QFPA 1SYSB 3RY4A 4DW2H 2E27H 1AGBB 4AH2A 2BVYA 2IF7A 3TNMA 5I1AA 4R4BA 5ADPH 1NKOA 2BNRB 1S9XA 3O11A 2XKNB 5IB1A 3BW9B 3I85A 3O9WC 1NCWL 2IGFL 3FRPA 2EDBA 3VMPA 2WNGA 1PY4A 1GOGA 3FOLA 5JUEH 1JGEB 4JZNB 4HJGB 1EO5A 3CK0L 2EYTB 4YBHA 4PJXA 1PSKL 4NKOA 3AY4A 1EMTH 4Z76B 4NFBA 1Q38A 1A6ZB 4X0KA 1QBLH 3VFTA 3BO8B 1JTPA 1XR9B 3HE6C 1DUZA 4ZODA 4HCRH 2DMCA 3PQYD 1CIDA 1MJ8L 3TZVC 4GG6E 3MV9E 2IANA 4U6VL 1HH9A 3H3PH 1HI6A 1ZVSB 1MFAH 1JF1A 1IRAY 4DKFH 4ZSOA 3CX2A 4ACPA 4PJIE 4ZFFA 1Z9MA 4BFIB 5MENE 3OB0H 4LCIL 1WWCA 4NN7B 4MD5A 4M3JA 3I84A 1P7KB 4LPVA 2ATPA 4MSWA 2V5RA 3TT1L 4ERSH 1FDLH 4BZ1H 1H5BC 4NUGH 1YNTA 5AZEL 5CD3B 1NGXB 1PG7L 2DM7A 4WFGE 2X1WL 2YPLE 3W39A 1MPAL 5ADOH 5AUMB 5B3NA 4MQ7B 2FNBA 2Q1EA 1G6VK 3CPLB 2DWDB 3QXDB 4GQ9H 2K9UA 2P1YA 3EJYC 3PXHA 4NNPH 3BUYB 3FQRB 4JM2A 3BVNB 2JK5A 4ZFGH 3TV3H 4GRMA 1JPSL 3BD5A 2FR4A 4R6UA 1CVSC 2NY6B 1AHWC 1A3LH 3A0OA 2ENSA 5C0EA 5EZOL 1JHTA 1KPVB 2DIJA 3G5YA 4PRHE 3S34H 1TXKA 1WK0A 4WU5B 1FG2A 3OSKA 4OZFB 4WU7A 3CUPB 5GIRA 2OZ4A 1BOYA 3Q5TA 1HOCA 2VDLH 1CDCA 3GSUB 2CDEB 3TT3L 3QQNA 4XBGA 4JFQB 1JGDA 4IBLT 1PSKH 1XF2A 2QQQA 1KPRA 3HUJA 5EO1B 3LS4L 2YD9A 5T1LA 1CFTB 5LJYH 5JA8B 4P9ML 1NCWH 2IGFH 1DVFB 1MCEA 4MB5A 3MGOB 3VGAC 2BMKA 3UJIH 3WFEL 4BH7A 4HK0B 1ZGLB 3VE0A 3MNZB 3SKNB 2OL3B 3G08B 1JWSA 3DRQB 2A6IB 1CGUA 1XH3B 2PXYA 4NQDD 4H1LB 1J8KA 3CX5J 3MLUH 1F45A 1UGNA 3QDJB 5E8OB 2D03H 4APQC 3GO1L 5EOQH 5D71H 3UCRA 1MJJB 4M48H 1YNKL 2ZPKH 2C1OB 3VH8A 4N0UA 2R56H 5MP6H 5C0AE 2LV4A 4N8CH 3P9MB 3RWEB 1ZS8A 1JGLL 5DD1H 2ATKB 4QXUL 2NW3A 4WWKB 4FXGA 1LO5B 2W9EH 3IDGA 4NKQB 2CDFB 2MKWA 3BQUA 4J8RA 3KXFE 2V2WB 3TCLA 3QCTL 2J8UB 1F4YL 5ID0B 1S9WB 4KDTC 5EIQA 1IE5A 1HEZA 3MLPA 3BAEL 3EDFA 3WHE0 3IU3B 1AGEA 4PJGA 4U1NB 1ROWA 2ZUYA 3CFEB 3QWQB 4YXHL 5DC4B 3I6GB 2EDRA 1QOKA 1T5XB 3TNMB 5I1AB 1JZ2A 2YD4A 3DLQR 3QCTH 3O6FA 4NUJA 3F65A 1S9XB 3EFDL 4XAWL 3OX8A 2R1WB 4PJBB 1LP9A 4ELKA 4K71C 1JWUA 3ARFD 3SE9H 4C83A 4U1GC 5TDNB 1WCBB 5K9QG 1A8JH 4XCFL 3MRNB 4OCSH 2BC4A 2ITDA 3FO9A 5D70H 2JF1A 5MP6L 3EKCA 1PKQB 4JG0H 1YNKH 3MRKB 3VFVA 4EDXA 1ZT7B 1ADQA 5FUZH 4PJ9D 4P2QB 2A0LC 1I9IL 3QP3A 3KLHC 2A83A 4L4TD 1DEEB 1V7MH 2Z8VC 4YHKH 4UT7H 1DN0B 4ZTPL 4M02A 1A4JA 4D0BA 3I6KB 4MJID 5FDWA 1RUKH 3BDYH 4P2RA 2X4QA 4NJAL 3ULVL 4JFDA 4PJ5A 4NFDA 3MGTA 4FZEH 3WFCH 3TIDB 3BRGC 4B7IA 4R2GD 3V6OC 4YHPA 1LO3H 3N50A 1I9JL 2JIXA 2D4FA 3LN4B 4LSRL 1OP9A 1KC5L 3T0BA 3BP5B 3LHPL 1YNTB 1L7TL 1NC2B 3UPCA 1K2DA 5HSFA 4Y5XA 4MDIA 2ARJB 4XCNB 5C6WH 3X14A 1EBAA 5D9SB 2BSSB 2BNQB 5AAMA 1H15A 2FSEA 4HMCA 4XP5L 4Z7WF 5CLTA 1N2RB 5FYLE 3VFWB 4L5FL 1AH1A 5CBEA 2Q7YA 3TPUA 1OL0A 5E9DE 4KDWA 4W6WB 3P11L 2XTJB 2FR4B 1D9KA 4DUXA 4PLOB 4M7ZB 4OCWH 4KJQC 3ARDC 4IRSA 5HDLA 5KVFL 3M45A 4ONHA 5INCB 1ADQH 2DICA 2V5SA 3BGMA 4PR5B 2CO7B 5EUKB 4XVSH 2Z9TA 2BFVH 3QUZD 3DARA 3MRIB 4I5BB 4NQCD 1DLFL 1QSEA 5F3HA 5IROC 1MVUB 2J4WL 4APQB 2AXHA 3QIBD 5D2NB 4XBEH 1HH6B 1MHEB 1WT5A 2BCKA 2X40A 5LWYL 4ZPVB 3B43A 3ZTNH 4P5MB 3T8XA 4PLNC 5KVGH 1EVTC 1J1OL 4LRNH 1AE6L 1RIVH 1VFOA 2V7NB 1FFRA 5C0BD 5HYSB 2YXFA 2XZCH 4M6OL 3KNBB 4BELD 5TPWH 5I19L 4KUCF 4FFWD 3RVUD 4MA3B 4WV1B 2YWYA 1RUQH 4NQEB 3MRMB 5HYEA 3BEWA 4D8PA 1TQBB 4P5KB 1WAAF 2VB5A 4AEEA 4HUXA 1XR8A 2CK0H 5D6CB 4XXCC 2G60H 4TUOA 2VH5H 1WTLA 3GSNL 2ILLA 2G60L 4XZUA 5E5MA 3B9VA 1EMTL 4OF0A 5C0BA 1EEYA 1J5OH 2FO4B 2YA1A 4UILH 1E6JH 4XPAL 1P7HL 4R9HA 1U58B 2QQLL 5F7DB 5FB8A 2A6JA 2IAMA 2X7LB 2HT3C 3HAEB 5FHBL 4PJCB 1N7MH 1RIVL 5JO5B 4TVSa 4AY0A 4LIQL 1EEUA 5E2UH 4YE4L 5E2VH 1S7VA 3CU1A 1KLUB 1H3GA 4FQQB 3MRPB 5BZWB 4PB0L 3MLRL 3LPGA 1TZHB 3SGKC 1JTOA 2DJ4A 2H2SD 1I7RA 4GOSA 5D72L 3K2MC 3OZ9H 1HIMH 3HRPA 5J0BA 1XGQA 1A14H 2OX5A 2GI7A 4YHLH 4LSPL 3TBYA 4OCYH 1LNUA 3GSQB 2XTJE 4WFFD 4G6JH 4PGBA 2BFVL 3ZYIA 1I3RB 1U3YA 2Y1VA 1MFEH 3P4MA 4OCMC 4AZ8A 1ZT7A 1QRNB 1U42A 1F58H 2CKBH 2F8XC 4WWKC 1I7TB 3ZYJA 2IANE 3RVWD 2IQAB 1YYLL 4G8IA 3VXUE 4KJPD 3CVHH 1JYWA 2X10A 1XT5A 4OLWH 4JQIL 1Q9KA 4K9EL 3BIKA 1EK3A 3ZE1E 4JKKA 5E6IC 5FDWB 4RFOL 5L2JB 3OQ3B 2FH6A 4JFDB 4HBCH 1VEMA 3L6FB 3P4OB 1S5HB 4U1HA 5BS0A 35C8H 2HWZL 3VFMB 2JIXB 4J1UB 1IARB 3WIHL 4K9EH 1JRHI 4MJ2A 2H2SC 4LQ1A 3T08A 4JKPH 2YKLH 1TDQA 3H9SB 3CZJA 1T1YA 3GSOA 2P8PB 1O0VA 2BRRL 2BOBB 1RUKL 2BNQA 3BDYL 2ZWLT 4U6HB 1MCBA 3SE4A 3IFLH 4MZ3A 5EZJB 3U6RB 2BXYA 2V2TB 3LQAC 4XVUC 2Q6WA 4MMZC 1BJMA 1V7ML 4XRCA 1U8KA 1YUHB 1AR1D 1XGUA 4JQVA 1HXMB 1QFUL 4ODXA 1S7UB 1ZHLA 2J6EL 4GRWB 5DJ0B 1N8ZB 4R7DA 5DRZA 3MXWH 1VENA 5E6IA 4OD2A 5A40E 1AO7D 4JG0L 4Y16B 2OR8A 1X5KA 1WZ1L 3CFKA 2G2RB 3OL2A 4J3UA 3GBNH 3MJ6A 2VR9A 3ARXA 1FNHA 1OLLA 4G8GA 4NSKB 5CJ8A 2F54A 4PJFA 1KFAH 3RY5A 1GXEA 3G6AB 4N68A 4H26A 1BIHA 5GHWH 5I16A 5DEGA 3VGAB 3DURA 5J13B 4PV9B 5D4QA 3NOIA 5C9JA 3HC0A 1OARH 1U8LB 2QQKL 5IROA 2ITCA 3EYSH 3AFLA 1JZ8A 3BAEH 5DHYA 4QHKJ 3ZE2E 1UM5L 2WV3A 3EHBD 3FT4B 4S0TD 4OKDA 5GS3A 1J10A 4G43A 1DQTA 2WINA 5GRZA 3NBNA 2H3NB 1FGVH 3BESR 3QXDA 1TQBC 4G6KL 4MNHB 3RWHB 3B6SA 3QPXL 2X9YA 3S36L 5GS1B 1EEYB 2ZUUA 4QRPD 2Q8AH 4LP4A 4OGYH 5GS0D 3OMZA 3FO1A 5FA4A 2KBGA 1CFSB 4Y88A 5ESAB 1BZQK 1W8OA 5J11C 4G8EA 1UYWH 4GXVH 1E4KA 1VHPA 4LLDB 3V0VB 3G04B 3O4OC 3QAZB 3SO3B 4V1DB 1F02I 4FTVD 3RI5K 1U8JB 4XVSL 3VRIA 4Y2OA 4DGVL 1CU4H 4PJ9C 1P4LB 1FAKT 1ND0B 2MPAH 3SDYL 2J88L 2AJUL 5FDYA 4PS4H 4D9LL 1LMKA 3HLAB 3ZKXB 1YY9C 2YUZA 4JDZB 4HK0A 4PUBL 2ZSVA 3LRHA 3MMEA 2Z31D 5ICZB 5IMMB 5HDBF 2DJUA 5FGRA 4LHQB 5GXBB 5INDB 2NCMA 3WNOA 3U1SL 3MRGA 1KCKA 5F3BA 1OAKL 1ZA3B 4GKNA 4U33A 2MPAL 1S7RA 1DQQB 1KC5H 3MBEB 1YYMH 4XHJC 1P7QA 4GMTH 4M6ML 4L4TE 3VGBA 4KJWC 5F7MC 5IB2B 3D39B 5DS8A 4EVNA 2A9NH 1YEEH 3L6FA 5ID1A 1FNEB 1JI2A 1WBZB 4NUGL 3UAJD 5JHDB 1JYNA 5IUSA 4LARH 5DGQA 2Y06L 5I1CL 3SDXB 4JFDE 1RZJC 4OIBA 4WWID 4TYUA 3PUCA 3Q0HA 5FGCE 4RAVB 2RJMA 1TJGH 3ES6A 5ITFA 1RJZA 3W0WB 3W5MA 2OJEB 4KZEH 4Q9RH 4MA1C 5EBWA 3F6LA 4LEOB 5T3XH 1BGXL 5HYQA 1EEQA 3W11C 2V2TA 4XH2B 1C16A 2Y5TA 4GW4B 3T65B 3D69B 4C83B 4NWTL 1IC5L 4ZSOB 4R3SB 1B2WH 4G7VL 1BZ9B 1JGVL 4YWGH 3BKML 5L2KD 4MA8H 4XAKD 1QBLL 4UT9L 5IG7A 3DVNA 3FN0L 1VADA 4L3CA 3ZDZE 1PG7W 2EXWC 3MLSL 1R5VA 1MI5A 5D2LB 3OKDB 4PGJA 4NSKA 1IM3B 1OARL 2C4XA 5EB9A 1T1XA 4WI4A 3V4VL 4TSCL 5FKPA 4P9HH 3CFCH 3FQUB 3O6FD 4PV9A 1JMXA 4M61B 1A1NB 4O5LL 3FHAA 4X6DB 5J1AB 4UTAL 2C7UA 5DD1L 1W0VA 2I24N 5F9JB 2Y6SC 1HHKA 3KDMB 1HN1A 4LLQB 3QWRD 3A6CL 5ETUB 4EDWL 2R56L 1NH6A 2FB4L 3J8F7 3JWDL 5C0NC 1MRDH 1Z6JT 5HHOD 2AQ2A 5C0EB 1S7WB 2X4PB 1BREA 1KLFA 2IWGA 15C8L 4JFFA 4PRPD 3GK8L 3RX5A 3U7WL 2VLJE 5HHPB 3GUTB 4MNHA 2Q7YB 4KQ4H 5FIEA 3IRZA 4PJGF 1ZLSL 3E0GA 2YD7A 4OLZL 3T0DA 2HMID 2HT2D 1JK8A 1FE8L 3WS3A 4F7MB 4S1DC 4QF1B 4J2XA 4JZJB 3SKJH 4NQTA 5J13C 5DJ8A 2VWEE 1DVFA 4JZOB 4BQBA 4HLZG 5KSBB 3LS4H 4K8RH 1MCKA 1PLGH 5HTSA 4GG8A 5DJ2A 1J0KA 5C2BH 3LD8C 4HUUB 5I76A 3DUHA 2OL3A 5FF6B 1MQ8A 3IDUA 5TDPA 3KAAA 4KPHH 5ICYA 1CXFA 2XIDA 2B39A 1OAQH 1I8KA 1JPTH 1G7JB 3GJFK 1R24A 3BP6B 4M1CC 4K9EC 1N5AA 1FYTB 4P2OB 1QD0A 3L3OB 1YJDL 3AROA 4CGTA 4GAJL 4P2QE 3NFPB 4N0UB 3QISA 1F5WA 3T2PA 4NQXB 5HYSA 3MREA 3TV3L 1MFEL 4WWKD 5IK3A 5F7HA 3UAJC 3CSGA 3OKOA 5EIVA 2XXCB 4NNPL 4WI6A 4RFNB 2P43B 2ZUQB 1CD0A 2IH3B 5LCVH 5INDA 4KTDL 3S35X 4OLVH 1A6AA 4JPWH 5ADOL 3PE9A 4Z0XB 5F3BB 1DBKH 3FB8B 2IALA 5EIIB 5BVJB 1KOAA 1EUTA 4HGWB 4X8JA 2FJGB 4YHNA 2FO4A 1F11B 5CP7B 1RJLB 4N90D 2LTQC 4P2RD 3MC0A 4N5ED 3QQ4B 2CK2A 5IVOA 2KZ1B 5FCUL 4XMLH 3RVTC 5DHVA 1MLCA 5HHVH 1MFAL 4ZS6C 1U8PA 2Y07H 3NIDE 1S7VB 4BSWB 3ARBA 5I71C 1AR1C 1NGYB 2R1XA 1D3CA 3R0MA 1G7PB 4IDJL 5H2BA 4XPBH 1N6UA 2FATH 3VRJB 1I9RH 1A6TA 1KUMA 3HC4H 4RIRB 3RDTB 1IM9A 2HJFB 4U2YA 2HTKC 4LASH 1B90A 5TH2B 4JR9H 2XN9A 4YAQA 4QOKE 4M1DH 2E7BA 1QVOB 4POUB 1NCDL 3TYGH 3DX6A 5IV2A 1JPFB 1FYHB 3IJYB 5TPWL 4LCCB 4YHOH 1NUFA 3FFCE 5B4MD 4RMVA 5E8EA 3RTQC 3VU2A 5GJTL 1ONQB 4WUUD 5DA4A 3OV6A 1AE6H 4LRNL 4K71B 1QFWI 4M7LH 4OZIE 1OAZH 4LGSB 1IM3A 2O93L 4WCYH 3PWNB 3JTTB 1JVKA 4MB4A 3I75B 2BVEA 3UZVB 2GFBA 3U79A 5GGTH 3RWIB 1VPOL 4LAJH 2Y7QA 2OR7A 5FV2A 1RVFL 1E4XL 4OLXL 4PY7A 5IF0A 2BNRA 3UBXG 2ZUQC 1G7MB 3RP1A 4XB8A 2H26B 2YWZA 1JHKL 3BKCH 3K4ZA 2Z31A 1WEJH 1I1FB 5I18H 1T4KB 4FN0A 4YNYB 5HHXH 4FNLH 2EE3A 3IETA 4QRUB 1QA9B 2VUOA 3VXRE 2M1KA 4X0KB 1OB1A 3HHRB 4PJ7F 5EUKA 4W81A 3T2NL 4I3RL 3MJ9L 2VLKD 1MWAL 3MV7B 4EN3D 4HG4J 1YEJL 5HDQL 4YGAB 4M5YH 1SJEB 2JK5B 4YFLF 1I1AB 4YBQC 4Z77B 1UB5A 1FC1A 3D39E 3L3HA 3IKKA 4NP4H 2KZWA 2VQTA 4XI5D 2CMRL 2ARJQ 2NW2A 3H9SE 5ITBH 4HKJB 2CDEA 4XWOC 5E1HB 1B6UA 2NYYC 4HUWB 2SEBA 5GGSA 5TDPB 2HLAB 1D5BB 3P77B 4C56D 1DZBA 1X5LA 4MCYB 3GSRB 5JZ7D 1E4WL 4PRIB 1G7JA 3EDJA 4IIQC 3D0LA 2DD8L 4L29B 1T0NA 4TNWK 4H0GA 5FYKU 4NPYA 4JVWA 1FYTA 1UH2A 1I9IH 3AB0C 3O8XB 5T5NF 3JUYA 3U9PL 1Z5LB 5F93C 5T5FL 3SGDH 1NQBA 1DANU 1T3FB 4H1LA 3IVKB 2I25N 5FKAB 1JZ3A 4D2NA 3T2OA 4Q2ZA 2FHFA 1DEDA 2VQ1A 4HWBH 4HS6A 3MUGB 4K8RD 4NDMA 4QO1A 1FL3B 5I1JH 2HLFC 2HTLD 3FB7A 2BNRE 2QSVA 4OFYA 4JLRA 4HGWA 4DFHA 1KJVA 3QUYD 4BZ2L 1JL8A 2B0SL 2BXZA 1XCQA 4ZPTA 2GUOA 2JB6A 1N5YL 4FXGB 4DZBB 5C6PB 2FBJH 5JXAL 5F7WC 3A6BL 4LVHC 4QHNA 4H0IA 1Q1JL 1TZHA 5AWNH 1W0WB 3IDMA 5D1ZD 1NAMA 1X9QA 2VZUA 5EUOE 3ILQD 4GMSH 2DQJL 5EO0B 3QHZH 1MCHA 2R1YA 3U36B 5IESH 1I1AD 4PGBB 3A67L 1GGIL 3RIAF 3MRLA 1DQML 3EAKA 2PXYB 3QI9C 4IS6B 4YDKL 3QXUA 1QRNA 3WJJC 1S7TA 4LCUA 1FBIH 1YN7A 3ARWA 3QDMB 3S4SG 3WE6A 2CSPA 1D6VL 3B9DA 4F2MA 4L1DA 3D85A 2GTWA 1FNSH 2IG2H 1HZHL 4WW2A 4G5ZL 2PTVA 3RWEA 5IMMA 1H3TA 3PNWB 5E99H 4L4VB 3WFEH 2R0KH 3D39D 1VKXB 3M17A 1YA5A 1UG9A 4NYLA 4R90L 4JM2D 5K9KB 2PETA 1S7RB 4CUCA 4E41B 3QJFA 1C5DA 2MOVA 3UYOD 1CGWA 1WAAA 4MLSA 5AD0B 1NC4A 2EIZA 4R4NC 3TT3H 2DIAA 5C8JA 1DBAH 2HJKB 2H8PB 3EYUL 3TJHD 4NQCB 5DI8A 4BH8A 1Y6MR 3UEZA 4FA8A 1WAAE 4KKAC 4KGLA 5LKNA 4QRQB 2ITDB 1P6FA 3NPSB 1QA9A 1A3LL 3Q3GA 3REVB 1GZQA 1H15B 3RBGA 4NHCL 5E5UB 2I26N 4NC2B 4CMMB 1B4JL 1C16B 2ZG3A 4DTGH 5DD0H 4ZUUA 3AM8A 4ETQB 3S88L 2WUBL 4M62H 4K07A 5IHZB 3G6AA 2VKXA 5B38G 2VLRB 5L6YL 4M5ZL 1CGYA 1DQDH 3I6KA 4OZ4A 1FVCB 1PG7H 3DVFA 3BGMB 4FFVC 3F7PC 1A6WL 1CL7L 3KPQB 3G6JA 3JWDC 4HXAH 3G9VA 1KIQA 3UYRL 3HI5H 3L95B 4R4ND 4OZIA 1HI6B 3VA6A 4HAGA 4WENB 1C8PA 2AI0H 2EDJA 4JZJC 4XCYB 4MDIB 1NMCC 2RGSA 4KVCL 2FL5A 1B3JA 4CVWA 4NC1C 4KY1L 4Z7NF 1N2RA 2DMBA 3EZ8A 1MWAB 1EEZB 3HNSH 2E6JA 5CZXC 5H37G 1U93A 3SQOL 12E8H 1WTGT 2VTFA 1GYAA 2EYSA 5GS1A 2NY1B 3GHEL 3JWOL 2CDGB 4FG6D 2IQ9H 1FVEA 3ARPA 5IBTL 1INDL 3W39B 4XBPA 4L3EB 4HK3N 2ZJSL 1CFSA 3IB4A 1KTDB 4YDLC 2ZSWA 3U0WH 1ZHKA 4AL8L 4NDMB 5J11B 4ELMF 3LPFA 1EGJL 4PRBA 2DLFH 4I48B 4R96A 1LEGB 1RU9L 1KLGA 1J8HB 4D9RD 4S1QL 2P5EE 1XF5A 2XWJB 3NZ8B 3MUJA 5JW5A 5HI4C 1YMHA 1JYXA 5DJ8B 2EDTA 2A6KB 1BQUA 3UTZB 3ARRA 1LO2L 1EO7A 4NKIL 1AQKL 1LO4H 2ZUWA 4HUUA 1CXEA 3T04D 4UDTB 2YD1A 3HZYB 3JWOC 4LLUB 5ICZA 4NM8L 4Q6IB 3WFDH 3GHBH 5ICYB 1MSPA 3ARDD 3FT3A 4QYOA 5A2LH 2MCPL 3Q1SH 2I60L 1JN6B 1X7QA 3TO4D 1OTTD 4PRHB 3VI4F 1Q9LA 2CRMA 1HINH 1K5NA 1CDYA 3G5ZA 3QIUA 3GMLA 1CFQA 1U8MA 2H9GB 5T3XD 1MIMH 3EYOB 3FOMA 5IGXL 3MBXL 1WSST 3WIIL 3PDDA 4POZC 2EDFA 3P30L 2LVCA 2ZOLA 4X5XA 3MZGB 3PHQA 5F7DA 4ZTOL 4JG1L 4KTEH 3TJEH 4LPWA 4F9PC 3LKPA 4GAFB 1B0GA 2F74A 2GJ6A 2ICES 1FZKB 4H8WH 4Y0GA 5KTEH 2VDMH 5E8DL 1YN6A 4PJAB 2EXYC 3HZKA 4HUVA 3O0RL 3RL1A 3ROOA 1FFPB 1WBYA 1R3JA 5EBWB 1BOGA 5CEZH 1DBBH 3QI9B 3SDAB 3TYFB 1NUNB 2CXKA 1IGJB 4GW4A 4PRNA 5I9QB 4NQCA 5DI8B 5C71A 5F88A 3GSQA 5CILH 5K59F 3IU3A 4X5WB 1U8PB 2P24B 2NY7H 1J0IA 4N1CA 4DGYH 3MNWA 3T0VA 2X4OB 1MJUL 1UKQA 3L5WB 2NY6D 4OF7A 2P5ED 4PLJD 3RVWC 2QSCL 4E5XB 1LP9B 1CWVA 1EJOH 4YQXH 4JFOB 4PGEA 4XNXL 1T1XB 4TQEL 4KQ3H 2XN9B 4YAQB 3VDAA 2EDWA 3U4AA 3L3DB 5FKPB 1PJ9A 4X6CF 4K7PL 1NFDA 3O41B 3LIZH 2AEPL 3MCLH 5B22A 4UBDC 5F96L 4LQFH 4NO0D 3HNVL 3KPQA 3FB6B 1CD8A 4OM0H 3CAFA 3QDGB 2A83B 2UZIH 3LVEA 1LE5A 5DZLA 5L9DL 4C4KO 4GFTB 1T5WB 5E4IA 5ECJE 3QNYB 4EXKA 4JN2B 4KUZL 5F6HJ 3RBSA 2OBGA 5EZJA 2DWDA 2Z92B 4M3KB 2XICA 3O6KH 5E8NB 5DHYB 1AGFB 5FYLH 1DL7H 3QUYC 2RIKA 2DDQL 3OGOE 2OP4L 5B38B 3NCJL 1A22B 1K3IA 5D7SL 3C8DA 1KJ3L 3HFML 1H3WM 4Y5XB 3AS1A 1KXQE 2Z35A 1QG3A 5SWZA 2VL4A 3SCMA 5EH1A 3X13B 2UUDH 3HC3L 3CUPA 3OF6D 3UJTL 5HGGS 1RK0A 3STBA 6CGTA 3DGGA 3KJ6H 2DL9A 3TPUB 4KZDH 1I1AC 4G6MH 5DEFB 1ERNA 4FQPA 5BV7L 4LVHB 2YPVH 1S9YA 4OFVA 4LCWE 3EOBA 4X7DC 4AT6B 2GIYA 1JGDB 4Z77A 2X09A 3D2UB 4U3CA 4WHDA 4BK4A 5JLZA 4M8QB 1RZFH 4AIXA 3KJ6L 2E5EA 5C0JA 2P5WD 3BX7C 4FQHA 4PJDB 2FX9L 4O2EB 4W6YB 2E7LA 1BWMA 3QIWB 4Y1AB 1R5WB 1U8QA 3RGVA 3TZVB 3SDXF 4X7CC 1R5IA 2HG5A 1RZ8B 1FIGL 4YX2H 4LMQI 1JGUL 3ARZA 5CBAA 4BK5A 3T3ME 3B3IA 3MRBB 4OSUH 3MYJA 4P5MA 1KCSH 1A6AB 1CE1H 5DMYA 4U1KA 3QG7H 1ZE3C 1KB5B 2FZ3A 2X4NA 3PQYB 5GPRA 1EERB 4KUZH 2P7TB 2FJHA 3ZKMD 4N90E 2WQRA 5KOVC 4XPHL 4FQIL 4WO4C 3KPLB 4NWUH 1EHNA 4JPKH 5DLML 3X3FL 4DVBA 4PRAA 3IDNA 4YUEL 3QUKB 3GKWL 5T3ZH 2XRAL 4GXUN 2PYFA 4OM0L 4H5SA 4F9PA 1B9ZA 4H1LG 4C57C 1RJYB 1MAMH 1KGCE 1YC8A 2EKJA 4KKBD 5GRVL 4A6YB 3VGFA 3KXFA 3Q6FB 3O6ML 5EZLB 5IJVB 4WRLA 3BPNB 1KYOK 4M6NH 4NO3A 5HGHA 1CE6A 2NTSP 1ZANL 1U2CA 4TQEH 32C2B 2LU4A 4V1DA 1FVDA 4DZBA 3JV6B 2R1XB 2D31B 4P2QD 2APVA 2I5YH 4MVBC 3RVVC 5AG9A 1CT8A 5EDXA 4RX4A 1CBVL 4MAYD 4PRNB 1RUAH 3LSOA 2VZ3A 2P44B 4ONOA 3F7QA 4F8TA 4U3XA 3ALPA 2B1AH 4OLUL 5CILL 1QBAA 3SGJA 3KPPA 2WQ8A 2P24A 4YC2C 5BMFL 4OF6A 1PKQA 2CPCA 5CJQH 4RZCA 5CMAA 1FLRH 1TJIL 3MRKA 3VFVB 2CGRH 3WSQH 4EDXB 4C56B 2LTQB 5F7NC 4N0CC 3GJFH 1SJHA 3MLVH 3QDMA 3SO3C 3ULUF 1QHPA 3SJVA 3MODL 2N7BA 3K4AA 1RHHA 4WFED 5C1MB 5BV7B 5F9WB 1SY6H 2WM0A 3L3DA 3UDWC 2V7HA 2AP2A 4PJCE 3DXAD 5CZVL 1UM6H 5GGRY 4LSQL 5D2LF 4B7LA 1AO7E 4HX1A 5HHOA 2VLRE 4I9WE 4P23B 4JHZA 5L88L 3OJVC 3BKYH 4P9HC 1RFDL 3D25B 1MIML 1I1FA 3IT8D 3KPRE 4F33A 1FP5A 4OUUA 3MZTA 3GEWB 3N85H 3WKNA 1A0QL 3HR5B 5IQ7L 3HPLB 5CFHA 1DQLH 1A7NL 4JM4H 3BH9A 4YIQA 1S5HA 1WIPA 4U4BA 1KTRL 1W0VB 5F9JA 3ULVC 3FT2B 3QDHA 4WFHE 4PJCF 2MNUA 1H8NA 5EZIH 1XMWA 5MHSD 2W91A 2F8OA 1DQLL 1HNFA 2QTEA 5H8DA 1BZ9A 5TFSL 1IGFH 1ZEAL 3IDIA 5DEZA 3DVNB 3U9UB 4OCRL 4HULB 3UPRB 2NY5C 2V5YA 1ZLVK 3AY4C 4L9LB 4GUPA 1RZIA 3KPRD 2NXYD 4PJBF 3PGFL 4HV8B 3LZFH 4HHAA 3BKYL 5DHXB 5F1NB 1HHGA 1NMAH 4KK6D 3CC5A 1NEUA 4L8SB 5ESVB 3MA9H 1RQ5A 4NM4L 4P2OC 5F1IB 1MOEA 5DJ0A 1B88A 3RKPA 4XPFH 2CRZA 1QNZH 4I9WD 1N4XH 3PWVB 1PYWB 1SY6L 5KSVA 1J1XL 2J8UF 3FB5B 3VXSE 4GSDL 2I9TA 3O8XA 3HAEH 4AEHL 4GBXC 4HIIA 4P5TB 1SVZA 2BSRA 4NT6B 2HRPH 2PYEE 5FYKL 4ZFOL 3VJ6A 4H20L 5CBAB 1S7WA 1N64L 5BO1H 1XF1A 4X80H 4KY1H 3I50L 2R2BB 1U8LA 4R2GC 5KAQG 1I8LC 5I1KL 5ESQB 1MWAA 1RUAL 4MZ2A 4LHUB 1KEML 1T1ZA 3EDEA 2H6PA 3N06B 4H25A 3TBTA 3MUHL 1R6VA 5HGDA 4F58H 4U3HA 2VDKH 4MCZB 3LN9A 4EJ1C 3NABL 4YPJA 3V95A 2C1PB 3CXHJ 5LGHH 3PWUB 3NABH 3KPSD 1U58A 2VDPL 1RAMA 1P4BL 1B0RB 3CVHA 5J12C 1SEQL 1R3KB 1T1WB 1KIPA 3HAEG 4CVXB 3BOVA 3SE8L 3SKMA 3R06B 3OPZH 3GSUA 3AAZA 3D0VA 4YK4C 4N9GB 4X8JB 4XBGB 2HFFB 2CRYA 3F5WB 3E2HC 3ZTJG 1DR9A 1Q0XL 5C0ND 3PL6A 4J4PC 4DTGL 2E8ZA 3GKWH 2WW8A 5BV7C 2R29H 3IFOB 4OTXH 1UZ6E 1YJDC 1F42A 1Q94A 4XC3H 5GSRA 1GHFL 5F6HI 1XGQB 1HKLH 4KK8D 3TBYB 3OKYA 4U6XA 3UBXI 1NMBL 3U30C 2C3WA 3VXQA 3EJJX 1YZZA 4BSWA 1NGQL 4K94L 4RMWA 1KN4H 1S5IL 1OY3B 2VLJB 3P0GB 4YX2L 3QWOA 5C09E 1QSFA 4KKAD 4ZNEA 1RMFL 5C0GB 4OZGB 4O2CA 3WD5H 3HMXH 4RQQB 3F62A 5EWIL 3G5ZB 2CLRB 2ZUXA 1U8MB 1Q9KB 4X9HA 1J8HE 4DGIL 1A6UH 1HQ4A 1AXSB 1XIWC 2A77L 5CZKA 4R90H 1ZLWH 5F6IB 3KYNB 4RFEA 5MEPA 3C5JA 2VDNL 5IFJA 5EU5B 5CIPH 4F9LC 2J2ZA 1C5CH 1SBSH 2ED8A 2NY1C 4EXPX 2VLKA 3INUH 3UDWA 1HZHH 3DX8B 4EN3A 1RZGA 4XNMA 4PBWD 5EBLA 4GAYB 1T1YB 3GSOB 2P8LB 4ZFOB 3I6GA 5DMIL 3NCCB 4O9HL 4PJXE 4BA8A 2IPTL 2ZCLH 2VL5A 4M6AA 4PJ7A 3G5XB 4PBVC 3VD5A 4ODHL 1U3HC 5FYLL 5BS0E 1UZ8A 2KL6A 1U8KB 3E1F1 4KAQL 3SDXA 2HJLA 1IKNA 2N56A 3GMPA 3MRRA 1ZHLB 3V6FB 1JNNL 4AQOA 5IIEB 3K7UA 3ARGC 4HWEH 4LKCA 3GSWB 4GAGL 3OG4B 4QRSB 4FQCL 4O02L 4Y4KC 1TJHL 4AMKL 1BD2E 3OAYK 4GUPB 5ILTH 2RQ8A 4N8VG 1TVHB 2FH8A 2PW1A 1N5YH 4F9LA 3D69A 5B8CC 2GJJA 3TLRA 4X4YB 4JFOA 4OUOA 1EV2E 2B20A 1CDHA 4H88L 4LQFL 1JJUA 2DQTH 1AO7B 3H7BB 3RNKB 5BXFB 4OFKA 5L2KB 3NGBC 1KN2L 3TO2B 1MNUH 3O2DL 5E5RB 3DX7B 5JDSA 1IGIH 2VO5A 4EQ2A 2JCCB 2ICWB 1S7XB 3MLTA 1NEZA 3DV4A 3GMRB 1MREL 5DJXA 4QLRA 1T0PB 3O9WD 1MREH 3BP7B 3P77A 5D9SA 2I5YL 3IETB 1RPQA 4FHBD 4QRUA 4NJ9L 2X4UB 1AC6A 2YRPA 3RWDB 2FIRT 4MD0A 4DJMA 1T20A 1K8DA 3MRFA 4QXTA 4YO0B 1ZMYA 4ZUWA 3TWCH 2ESVA 3HG1E 2FEDC 2H6PB 2Z8RA 4M6NL 1PEZA 4XGZB 4HEPG 5FEBA 1KLGB 1BM3H 2BNUB 1L0XA 3MFGB 1MAML 1E28A 2CD0A 4ORGB 4RMRA 4Q2ZB 4UINL 5FO7A 4ALAH 4Y19D 3JVGC 2E3VA 5DVNA 4YUEH 3GDBA 1YMMA 3MV8A 1F2XK 4RMSA 1AXIB 5FUOH 3RDTD 2CXGA 5JORB 3U83A 5JIPA 5D7JD 4HUWA 4HWEL 2QJDA 1MF2H 2AK1L 4OKVB 3SDDB 4BSVA 2PO6A 3LV3B 3MJ9H 2F58H 3T8XB 5IW6B 4L29A 3BP4A 1FIGH 5C0CA 5EO0A 4C4KT 2EXYD 4P3WA 3TH2T 5MERA 1AGDA 2DTML 5I76B 1OQOA 2VAAB 4NO2A 3FQNB 4P4KB 4KU1A 1RZ8A 4J3WA 1L6ZA 4M7KH 3O2WH 4LPTA 5TGBA 3MYJB 4P5TC 4OLXH 1CICA 3JSSA 4XVJH 5F9WC 5C0GA 4PJHF 4P4KD 1LO4L 2I9LB 5HGAB 1SBBA 5JOFA 2YPVL 1U8NB 1F8TL 4IIQB 2GTWB 2O5YH 4Y5VC 5EOTA 4DVBB 1M7DA 3D3VB 1CXIA 1IQDA 3MJGX 1MLBA 4RBPH 1YC7A 2HVKB 4LMQE 2X05A 5FAAA 2YXMA 5SV4A 5F8RC 2Y25A 3W5NA 1JI1A 5ID1B 3BUTA 1EGJH 4GW5A 3JWNC 2FRGP 4XNYH 5F9OL 4Y7MA 2OM5A 4S1RH 3U0WL 4DZ8B 2G9HB 4JR9L 4FQ1L 4DQOL 1I85C 4K94H 1P6AB 1LEKA 5HYJD 1XFPA 5IBTH 5F9OH 3S6CA 1OVZA 3O3UN 5IWLC 5SWQB 3MX0A 1A7RH 4AJ0A 2WP3T 3CCHA 3TBWB 1E4XI 3GSXB 2IJ0C 4JZNA 3S96B 4X9GA 1CLYL 3T0EE 3K1KC 2VRAA 3ARBB 1D5MB 2CIIA 3HNVH 5C0FB 1PW3A 4ELME 1NGWB 4XP1H 1NGYA 3BO8A 4C56A 5IB4A 3RA7L 3UTSE 3LIZL 3MRCA 3FKUS 1QFWL 3MUY1 5H2BB 1O5DT 2FDBP 2RFXB 4Y19E 4QHLB 2F54E 4Z78A 5CJXA 2VLME 2VDPH 4KJYB 1N0XL 1C7TA 5D1QD 2OL3L 4A2MA 3TP4A 3FO2A 4LKXB 4OAWA 1BMGA 3S9DB 4PG2A 2O5XL 4ETYA 4WTZA 4FQXD 3ARED 3QI9D 1F00I 5HHOB 5K9QI 4M62L 2VXVL 5JQ6L 5HY9A 1A3RH 2ATPB 3I50H 3CJJA 3PL6D 2R4SL 3CXDL 4K3GA 3NAAL 5GZND 5DMGC 2F5AL 5E70A 3LEXB 4X6DF 5TE4H 5CEZL 3Q3GB 3REVA 1V3KA 3AREA 3DYMA 4NZRH 5JIIA 3HUJE 1SYVA 4MD0B 2OZ4L 4XMKH 3C5SA 2A9ML 3BH9B 5E8DH 1VACA 1Q72H 1OAQL 4O4YL 4R26H 4FQ2H 4ZUUB 1V3LA 1IQWH 2AQ3A 5FK9A 3ZHKA 1BM3L 1AHWB 1RK1A 2AERT 4X7FC 4JFZH 3WFBL 3TVMA 1VEPA 4JFPB 4K8RL 2AJXH 4QNPE 5IR1B 4KXZI 4UQ2A 4LLMB 4X6CB 1Y6KR 5C3TA 5F7YC 2Y6SD 3L5XH 3OR7A 5IVXA 2UUDK 3W9DA 4NQCE 3LRSB 3NIGF 1GGUA 1HKFA 1KNOA 5F1IA 4LVEA 4X6EA 4LU5L 3LV3A 1CZ8H 1AXTL 3WL9B 3VXNB 5LBSL 3VXSD 3TBSB 4JFYB 5DXWA 3T3PE 1AY1L 3VXRB 4H1LH 1A1OA 3VFPB 5D2LE 3VWJB 1BQHG 4OBRA 3E6FA 3LRGA 3RZWA 4QXGH 1D9KC 2ESVD 3KHOA 4LHJB 1H8OA 4YZFE 3QUMA 2HVJA 4RFNC 3SPVB 4WI9A 5E2WL 4LDOB 2J8UE 4YHYC 2QQNH 3OGCB 4X9BA 4KJQD 3NACL 1I75A 3OJDA 2VDRH 3HE6B 4GMSL 9CGTA 1RU9H 3P73B 1K5NB 5IOPA 2C1OA 3VH8B 3MRDB 4LSQH 3B83A 1CFQB 2AJZB 3RUGF 4GG6A 3Q2CA 1Z5LA 5ALCH 4O58H 5KG9B 2ATKA 2NW3B 4PTTA 5MHSE 1FSKB 4QRPA 4MX7B 3LEYL 4X5XB 3QQ9D 4G9DB 1F6LL 3ARGA 4LL9A 4JO2H 4Z7QF 3BIAX 3U46B 1C7SA 1FJ1A 4PJ9A 2QADD 3IDYB 5D5MF 1HDMB 2H2PC 3R06A 5C0CD 12E8L 1T7WA 2NR6C 3VDCA 3VFOB 4WHYG 5B8CA 4Y4FB 2JB6B 3WJJA 1A9EB 1IFHL 3INUL 2B1AL 2Z0BA 3VXME 3IFOA 4MJ5B 4J12A 2XG4A 3IGAA 4Q6IC 3QULA 1WFNA 1NAMB 4M93C 3C9NA 2AJSL 5GRWA 2XT1B 3SJVB 1UCBL 2AI0L 3PXJA 1VEOA 2AEQH 1I85A 4UZGA 2VLRD 2W60B 1FG9C 1TPXB 1GJIA 4UIMB 4IJ3B 1XCTB 2Y06H 1UWGH 4JFHD 4POZD 2J3SA 5EWIH 2VERN 2F19L 2F53B 4FZ8L 4LF3A 1S7TB 1DQDL 1BJ8A 1RMFH 4YDIL 5D1XB 1S9KC 4Y2DB 3P0VL 1NSNH 1MCCA 2D9CA 4NO5A 2GT9B 4FQ2L 3D25A 2CUIA 5GGVL 1XF4B 3QEUB 3PWNA 2XRAH 1MUJB 7FABH 2XZAL 4UB0H 3FCTA 2A1WH 1KCRH 5D6DA 4Y89A 1CTOA 3CLFL 5IB2A 2X9XA 4Y4KD 5MEPB 2DQEH 4BZYA 3KPMB 4UB0L 3D87B 4NQSA 4XVTL 1T4KA 2YZ1A 3CD4A 1T5WA 3DYOA 3VW3L 4CVUA 1RJZB 3OPZL 2X4OA 4D0CA 4IRJA 1L7IH 1VACB 4QCIB 2E9WA 3H3BC 4XP9H 1UEYA 4MQXD 4QRRE 4LLVB 4XPGH 4JREB 5D7KD 2F5BL 4YDLB 3RPKA 3Q48A 2AEQL 1DANT 1QFWH 2R0KL 2Z35B 4KKLC 1OCWL 4PJ8D 4Y5YB 5KS9B 1A6ZA 1NAML 3ZZ1A 2AJ3B 3MUZ1 3LB6C 4LLMA 4OF5A 2BOCA 3MRIA 4I5BA 3EJYD 3WS6C 1IAII 2FCBA 5HHMD 1OTSC 5EORH 5DVKA 1M05B 4H20H 5KOMC 1ZLVH 2BSRB 4NT6A 5E9DD 4YHOL 1GRWA 3RNQB 4WO4B 2EDLA 3RZCD 1I7ZB 2C3GA 4XPTL 4AEHH 5MEOA 2NY0C 3SE4C 2OJZH 4UOW0 3KVQA 3ZHDA 3I02A 3KLDA 2UZYB 4N1HB 2OMNA 2AXGA 1GGCH 1TCMA 4H8WC 4XPFL 3W0WE 1QLFA 5KS9E 3GMRA 5DJXB 3P3YA 4TNWF 1W0YT 2R0WH 5JDJA 2YPLD 3MRBA 3KYMA 2WBJD 3B2UC 5BJTB 4P46D 2BX5A 2XPGA 1UH4A 2NX5B 1KIPB 4FABH 1K8DB 3UZEA 4LCCC 5DO2C 3CDYA 4PJ8C 1T7YA 4TUOB 5DEFA 1QZ1A 2DI7A 1V05A 5TFSH 4U1MB 1KCVL 3ZDXE 3FHQA 3L3JA 5KG9A 1R0AL 3WS3B 2BY2A 1U3ZA 2PUQT 4WW1B 1X5FA 1KJ2A 3O2WL 1NBQA 4JCMA 1I9EA 4MX7A 5C0JB 5LBSH 4ORGA 5C0AA 1DFBL 1AD9B 1LD9B 3TBVB 4P46A 3V8OA 2VIRB 3CSPA 2QSCH 3C09B 2X4SA 5T5FH 2D9QB 3ESUF 2D7PA 1F3DJ 1WICA 5FXCH 3T0EA 1OP5K 3IKCB 5DURB 3GIVB 1A0QH 3F7YB 4NGHL 1A2YA 3CDCA 4KMLB 4XX1E 3TFKD 1BVKB 4DN4H 5KSBE 2D31A 1BBJB 1MF2L 4KHXL 1K4CB 5IBLD 4PY8J 3STZA 3HTLX 3WFBH 4ZUSA 1KT2A 1I8IB 5DVMA 4F57H 5CZVH 2FO1A 3O0RH 3RY6A 3RWCA 1HYRC 3JTSA 4ZO9A 3U4BH 3WIHH 4NBXB 5L0QB 5HVHC 4Q6IA 1I3RA 3H7LA 1FL5B 1C08B 2CJUL 3KWWA 3QUXD 2A9MH 3OJMB 4RFEB 3DMMC 5C0RH 4PGCA 1AP2A 5C2BL 4TRPH 4LNRB 2V9QA 2VITA 1GC1L 1J12A 4TVPE 3UTOA 1PLGL 3WIHA 5FCSH 1P53A 3QUXB 3C08L 1OOAA 1NLDL 4HT1L 3NAAH 4Y19B 1OHQA 2R4SH 3BIKB 3CXDH 5A3ID 2QHRL 3ELAT 4NJ9H 3DI2B 1CBVH 1MJ7L 4Y8AA 5GISL 5JW4R 3L7FB 1LGVA 5DRXB 1M7IA 2NY3C 3K81A 3TPKA 5JW4Q 5EO9B 5I18L 1GH7A 4K8RC 1MCOL 2MCPH 1GGYA 3FFDA 3EBAA 3IFPB 2OL3H 4JVPA 5KSAC 4YBLC 3TO4C 4YHLL 4E41E 1R0AH 2FIKB 5E2JA 3WXVL 3EOTH 5C70A 3RIFF 1IGCL 1MRDL 4EBQH 3O6MH 3CDGB 1KCVH 3OBAA 4ZUVA 5HD8D 3SDCC 4EUPB 4H88H 1UXWB 1TVHA 3ZYOA 4NN6B 3CU7A 3FT2A 1MCSA 3ILQC 4YE4H 5E2VL 5TH2A 4M03A 3AS3A 4NZUH 4HZLA 2V7HB 5EU6D 1N7ML 4GAGH 2KQMA 4P9HL 3S37L 3FO0L 3MRCB 4Y5YC 2DLEA 1CDJA 3QG7L 4XPAH 1JNNH 3X11A 5CAYB 1SMOA 4QHLA 3QO1A 3MV9A 2NXZD 2DM4A 4WUUA 3QDGD 4HBQA 2XA8H 2OJZL 5J4MA 4LPXA 5HHNA 4UU9A 4WDIB 4I18C 4XPTH 3WYRA 2VZSA 1PGRB 1I7ZA 4WEMB 1ZAGA 1OPGL 5C9JB 4Z6AT 1EHXA 4U7KA 1B6DA 1BIIB 3CPLA 5B3JE 2IH1B 2HRLA 5GQBA 4PJBE 1KENL 1T04B 3MGAA 5SWZD 3F58L 3ET9F 4GBXD 3C6LC 3QIBB 3CSYB 2Q8BH 5HJ3A 3SCMC 2DMKA 1PZ5A 1ETZA 2WINB 2WP3O 3HI5L 1UA6L 1FG2B 4J3SA 1JUFA 3CX5K 3P4LA 1A6UL 3D1MC 2QADC 4M7KL 4DEPB 3MV8B 5DD3L 1A1MB 4OZHE 4OV6F 3NFSL 1UENA 5E1AB 5EA0H 1L7IL 4AM0B 5DTFB 4GKSA 5KJRL 1AJ7H 1HHGB 4NBYB 1BJ1J 1DBKL 2ADJA 3BMWA 3HFMH 2N4IA 1H0DB 1UB6B 1FN4B 3WCYA 1ITCA 3VXUB 3PWUA 2X1XR 2WBJB 5DD0L 4QTHA 2X4TB 1YEDA 1T1WA 5KSVB 1ZSDA 2XNAA 3KS0H 5J8OA 1QSEB 3SKMB 4NHCH 5KVFH 3F7RA 3U1SH 3DUSB 1MHCA 5D7LA 1YJDH 2VAAA 4XC3L 4X99B 3MRHA 3UBXA 4AEIH 4BQ9A 2BCKB 3HS0B 5J1TC 2ARWA 1M4KA 2C3XA 3C6LD 5D2NC 4UV4L 4UUJA 5K9JL 3LKQB 1QR1A 4MWFB 3GMMA 4TULH 5GGUA 3CFJA 4M43H 4LHUA 2ICCA 3CZFB 1II4E 4S2SB 3SDYH 1MHPL 3VWKD 4IIQA 4X83A 3VXQB 2VLKE 5FOBA 4BUGA 1NCUA 1ES0A 1S9VA 2NX5E 1JPGB 2ZOLB 3KPOB 5CJOH 3QUMH 3FAXA 5ISZB 4RCAA 2ZUSA 4XNQA 3WFHA 2XXMB 5F7FA 4G42B 3P73A 4JDTH 5DZNA 5IT2H 4LSTH 5J9PA 3U2SA 2DWEB 1FGNL 4XX1G 1ZLUH 1T83C 1HQ4B 5B4MC 3F5WA 4G5ZH 3O81A 3MROB 1IFHH 1A7PH 5DGRA 1MNUL 1MFBH 1S3KL 1G9NC 1KN2H 5K59E 4FQXA 4X6FB 1RJYA 1YQVH 3QI9A 3C8KB 3SJVD 4HC1H 2BSED 2R69H 4WHCA 1FNEA 4WTZG 2ENYA 3JUZA 3TO4A 3FZUC 1OSZA 5KAQF 1CYGA 1Y18A 1HDMA 5C09D 3FFDB 4KJPC 1BQLL 1J1XH 3K4DA 4Z7VA 5KTEL 5IEKB 4WUUE 1GPOL 1HHIA 1F6FB 2AK4A 5B8CB 3SE9L 4UTAH 4WHTA 2J6EA 2YMXL 3MCKA 1EFQA 3NH7L 4TOYL 1AGBA 5ILTL 4AH2B 4NHUB 2GW5A 4Z7WB 3QULB 1ZGLM 3LQAL 5ACLA 5FGCB 2VDRL 5CSGA 4KRMB 5DUPL 3ULSA 3LZFL 1FLTX 3GMPB 5DJ6A 4LKXA 2JB5H 5JHDE 2H32H 43C9B 3OB8A 2B0SH 4NQDA 4F15B 4OCRH 3RJDA 4HIHB 4QXGL 3TVMD 2F53A 4LF3B 2IPTH 2ZCLL 3BKMH 1KFAL 5HY9B 3RIAK 2G5BA 1AY1H 1JGLH 3JV4B 3KPRB 3ALXA 4DEPC 5IW1A 3W81A 1CLOL 4KRLB 4RDQF 5ABDE 2CIKA 1P5UA 2ZPKL 5JW3H 3ULUL 3FAWA 4F15C 3X14B 4F8QA 3BZEA 1ORQA 1OP3K 1AQDB 3VWJD 5JPMA 3KYAA 4R4BB 3BZ4A 3LKRA 1AFVH 4LVOC 4PLJC 1DVFD 3QFJB 1UZ8B 3BSZH 5F6IC 4U1IB 1AGFA 3MOQA 3QR2A 1MCNA 2A77H 4LCWA 3PG2A 4DGIH 2ZCHL 1P69B 5E0QA 1NEZB 1AHWA 3BIBX 1D5ZB 2X5PA 4NN5C 3TVMB 1YEEL 2ADIB 4HS8L 1YPZB 4HC1A 4V1DE 4J23A 3RI5F 2OK0L 1QRNE 3B9KD 2DYPD 4O4YH 2Q6WB 4H0HB 4JO1H 1A5FL 3RKDC 1KJMA 1WZLA 2A74A 1FL6B 2HWZH 4IMLA 5E1AA 1GOHA 4ETQA 4GRMB 5I1DA 1S7UA 1V7NH 4ODSL 5TF0A 3IXTB 1IJ9A 3LMJH 3KPNA 4G6AD 1GHFH 2Y4SA 3G5YB 2CGRL 3WSQL 1FVCA 3WN5B 3WL9A 4JDVA 2R2EA 4YEFA 2R29L 3VXMB 4QGYA 4Y5XC 1MWAH 5DO2D 4I3RH 2D2OA 2NTFB 5DVOA 4QHUA 1MCPL 3DSNA 3KNBA 2D0GA 1NGXA 3C5ZA 2AJUH 1TLKA 2DBLH 4TUJB 5T1KD 3BKCL 4EUPG 4BFBD 4GQ9L 3G5VA 1JHKH 2DB8A 4GG6F 4UNTA 4YJZL 5LGHL 3O3AA 4LSPH 3GMMB 4TTDD 4HDIA 3RGHA 2V9RA 2AXGB 1AKJD 2FJHB 2EDKA 3OZ9L 3RA7H 5DD5H 5EU6A 5FM5O 4M5ZH 1KCUH 1TMCB 1RI8A 1JHTB 3ARTA 1I3GH 1JPGA 4O51B 4XBPB 4IOIA 5E2UL 5A2FA 2BDNH 5E94A 3BKJH 4XNQB 5CGYC 1A7RL 5TF1L 1FC2D 3CH1A 4PJCA 4B5EA 3B6SB 4MXVF 3RZCA 4YPGA 5D7JC 1IAIM 1LO0L 3H3PL 5HPMA 4GSDH 1M7DB 3D3VA 1KLUA 3OAYH 1FFNA 1I4FB 2W0FB 4B41A 3BYYA 3DOSA 3WDIA 3EYUH 2C1PA 1OTUC 2WMPA 3IF1A 4FQ1H 4DQOH 3FO1B 3C09C 1J86A 5HD8C 1G6RA 4M93B 3UTSB 5IWLA 1G9MH 4X9FA 4AIZB 4ELMB 1JE6A 2BMKB 2GCYB 3MA9L 5HHMB 3PGCA 3I6LE 1AGEB 4PJGB 3B8SA 3BN9D 1LEKB 2RBLA 4R97C 3B5HA 1Q9WB 1OT1A 3VMNA 4RAHA 1MHHB 2O26U 4L9LC 4PJ8B 4Y16D 2EC9T 4AIOA 4OF3A 2XYCA 1I7UB 1RURL 5I1HL 4YBLB 1MFNA 2DM3A 4JFEE 5KVGL 1NLBL 1EDQA 4NQVA 5I66A 2P5WB 1U3HA 4NNYB 4X6BA 3HC3H 5T1KB 4PRID 1WZ1H 2PTUA 2GSIA 4XP6L 3OKKB 4U1HB 5BS0B 1FBIL 2VSCA 5A2KH 1DLFH 1OTUD 4JJ5A 4U7SA 3RWJA 1S9WA 4ZD3H 2G9HA 4ODUA 4HFUL 2VZVA 3QH3A 5A2IH 2FHBA 4OT1L 1A4JB 3CFEA 1H3PL 5MEQB 3BZEB 3V5HA 3HZKB 3MR9B 3PHOA 4ZAKB 2BRRH 3FFCA 3CMOH 3I3EA 1EO8H 2H45A 5SWQA 2AXJA 4DKDC 3SGEH 1XGUB 2UZIL 5FA3B 4LCWB 3EO1B 4DCQB 1IAIH 2NLJB 3B9KB 1IKFL 3SY0A 4EN3B 4UINH 5J89A 4HQQL 3REWA 35C8L 2DOCA 5GZOC 1OF2A 5D7JB 2OSLA 2FX7L 5EULV 5BCAA 1MFDL 4Z9KB 4JANA 1D7FA 4E5XA 4PP1D 3AGVA 5MENB 1EJOL 4YQXL 4MLIA 4PGEB 5DQ9B 5E4EB 2EYTA 4P4RA 3RHWK 2ADGB 2VABA 4HWZB 3U0PB 3KYOA 1A7QL 4MAUH 1SVCP 2JE8A 4JM2C 4P2RB 3DROA 5IEHB 5JMOC 2R0LL 4YR6B 4FTVE 4M1CD 4BFGA 1QRKA 1UKTA 1LEIA 3ZKND 2NW2B 5KSAB 4UTBH 2BY3A 4KI5F 2RCSL 4QHUB 1KNOB 2R4RL 4M4PA 4HPOL 1N26A 3QUYA 1FH5H 4CAGA 4F3FB 2DQTL 1INQA 3P2TA 3S97C 1TVBA 5F21B 4PBXA 2RAMA 1KXVC 4QRPE 4QWWD 4NPYB 4MS8C 1HYSD 5T3ZL 3UTQB 3E8UH 2XKUA 4Z7UF 4LAQH 4LLQA 3E6FB 3BH8B 4AENB 4JJHA 4P2OD 1AGCB 4LVNB 3H9ZA 2J5LB 4PJEF 5DSCA 1ETZB 3PP3H 5AUMA 4CU7A 5HYFA 1MCQA 3BPLB 2NX5D 3ULVF 2IPKB 4OSUL 4UQ2B 4HIXH 2CRIA 1F4WL 4KAQH 2X4SB 2BVQB 5IOPB 3CH1B 3CFDB 1U2HA 3QPQC 2QLVB 4ZMAT 2E7LC 1F97A 1N6QH 4RAUA 4F7CB 4F7PA 3PJSB 2BVTA 4NCC1 4WTXA 1ZVHA 4FNLL 2VC2H 5C0BB 3S37X 1CGVA 4P57B 1PVHA 5A2JH 2BNUA 1CTNA 2GUOB 2GSGA 5JNYB 4PLKD 4N8CL 4NKMB 3O6LL 4KVNL 3N1MC 4JFYA 2A6JB 5GSRB 3VXPB 4ZUSB 5I19H 5E7FA 4FP8H 3GO1H 5DURD 4EI5C 1KELL 3RGVD 5E9DB 4U6XB 5FO8A 2UVFA 1MHCB 1QFWM 2HFEA 2YD5A 1ODAA 4JHWL 1CXLA 2LVEA 3L3IA 1Q9WA 1DCLA 1T2JA 4OQTL 7CGTA 4MJ4A 2BNQE 1TQCC 3S3PA 3B3IB 4QRTA 3KJ4B 1DE4A 1OP3H 4LARL 1NFDF 1NC4D 4OZGA 3D6GA 5MI0B 4Y4KA 2J4WH 3VFSB 1MEXH 2AK4E 2CUHA 5F9AC 2V17H 3MRDA 1LNUB 1P5VA 5E5MB 1FFQA 5FOJA 3QDJE 3EZJB 4Y4HD 4KMQA 4LSSH 3IU4L 5JQHC 3VWJC 1NBYB 5DJAB 2IH3A 1KJ2L 3PNWA 4Q9BA 4YEEA 3OKKA 3HC4L 2VDOL 3BHBB 3FQXA 1CR9H 4YDVB 2FATL 3HB3C 1VKXA 4IDJH 4G9FB 4K3DL 4Z95L 5HGAA 5JOFB 1C12A 2IALB 4NO3B 5T1DH 4CJ0A 5JIHA 4KKLD 3NIDF 4QTIH 5T3XE 2E9JA 3IJSB 3QNZA 4FQQA 3GIZH 1RJLA 4G6FB 1JNJA 3WKMH 4FQXB 1QSFD 3QCUL 4DN3H 5FCUH 4HJJL 3LY6A 4L8CA 4PYGA 2H8PA 1MRCL 4I2XB 1JZ6A 1BLNB 1P4BH 4DZ8A 1CDIA 3N1QC 4RWYL 4JFFE 4U7MA 3VA2C 4QRQA 5CEXA 5DUBB 3VGGA 5H35B 4F58L 2XTJC 4Y2DD 4NJAH 3ULVH 2OI9C 2M26A 3W2DH 3U6RA 5CEYA 4YZFF 4MXWL 3TT1H 1AKJB 3B5GA 1KV3A 2LU3A 5D1XA 3S88H 2PW1B 4DGYL 4HWNA 3BWAA 1HSBA 2NY7L 4X8XA 2HT3D 1WCBA 3GSNA 1B4JH 2OS7A 3S96A 4OZGF 1FO0A 3FQUA 1OLZA 4MAYC 5C0FA 4OZ4B 4WI7A 1S7QB 2JTDA 2W0LA 4DKFL 2VLJD 2HMIC 4PRPE 2RHEA 5C86A 2B1HL 4OCSL 2NXZB 3FN9A 3K1DA 3RKDD 5C6TL 2K1MA 1U95B 3VXMD 4KPHL 1DBAL 3O2VL 4OJFL 3DV4B 3H9SA 1FORH 1AI1L 2OTPA 3WN5C 4F33B 5D7IF 2Q76A 4B50A 1NUDA 3HR5A 1MCWM 4HKBB 2BOBA 5LQBH 1DBJH 4JFFB 3MGTB 1U92A 1BHGA 3C8HA 3O2DA 1EAJA 3MBXH 3L7EA 2DYPB 1T21B 5JMRA 2H1PH 1TZGL 4IMKC 1P9MC 5IMKA 4OLZH 5CP3A 3VCLA 2F53D 3WHXB 3G6JE 1NCAH 3GJFA 3GBNL 1JIBA 4L9LA 3SDCB 3GHBL 3OKLB 5F1NA 4PRBB 2YR3A 4PJFB 2YD2A 5JORA 1LWRA 1MFCL 1QQDA 2DQCL 3CC5B 5D71L 5EOQL 2DQCH 3E3QE 1OTTC 1UB5B 3PF2A 3MACH 5EO1A 2GAZB 5HGBB 5C92A 1YMHB 5C07B 3WHE1 1PYWA 5HI3C 3D18B 1TENA 4W68A 1YEHL 3QIUD 4S1QH 3O3EB 4UDUB 1YEFL 5IVXB 4RWHA 2FEDD 4LEXH 4X4XA 4W4OC 3MNZA 3UJIL 2DLFL 4UDTA 3G08A 5IBUG 3G6JF 1UM6L 3ECBB 2PXYD 2C5DC 3D85D 1LK3L 4CNIA 1BEYL 3EGSA 1NDMB 1T6WA 3GSRA 3OAUH 5SX4H 1DE4B 3L9RA 5IMLA 4XXDA 3STZB 1EZVX 1T0NB 2WWMD 4V2BA 3WFHB 3L3KA 3MLVL 3VG0H 4MA8L 2Z4QA 5AZ2L 3HG1A 4DK6A 4HWBL 4ODBD 3DO7A 1FLRL 1PAMA 5C6TH 4XMPL