2DDXA

Crystal structure of beta-1,3-xylanase from vibrio sp. ax-4
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
324
structure length
324
Chain Sequence
LDGVLVPESGILVSVGQDVDSVNDYASALGTIPAGVTNYVGIVNLDGLNSDADAGAGRNNIAELANAYPTSALVVGVSMNGEVDAVASGRYNANIDTLLNTLAGYDRPVYLRWAYEVDGPWNGHSPSGIVTSFQYVHDRIIALGHQAKISLVWQVASYCPTPGGQLDQWWPGSEYVDWVGLSYFAPQDCNWDRVNEAAQFARSKGKPLFLNESTPQRYQVADLTYSADPAKGTNRQSKTSQQLWDEWFAPYFQFMSDNSDIVKGFTYINADWDSQWRWAAPYNEGYWGDSRVQANALIKSNWQQEIAKGQYINHSETLFETLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution analysis of beta-1,3-xylanase catalytic module from Vibrio sp. AX-4
rcsb
source organism Vibrio sp.
molecule tags Hydrolase
molecule keywords beta-1,3-xylanase
total genus 135
structure length 324
sequence length 324
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ddxA00
3FY1A 5JIWA 4WKHA 3GH4A 4X0NA 1V6YA 2ZXDA 1E4LA 1MYRA 1CGTA 4GI9A 1HT6A 1ZBVA 1R85A 1HJWA 3K46A 5DT7A 3WUEA 3GH5A 3L4UA 4PBGA 2OWWA 1KR0A 2F61A 1W91A 3T0DA 4MNLA 3PZGA 3L4XA 4PUDA 5KZ6A 5HXMA 3RM4A 4DWSB 3OLIA 2VX6A 1XGZA 1CGXA 4AISA 1BGGA 1V0LA 3EBVA 4PMNA 3SCWA 1AQ0A 1NWTA 3OZPA 4JAWA 1BLIA 3S6TA 2DIEA 1FH8A 4FF5A 4AZBA 1QI5A 1CECA 3NUKA 3AS1A 4M24A 1E70M 2WSPA 4UZUA 3FAXA 3GBDA 4HTYA 4ZE4A 4ATLA 4AZHA 2CERA 1SFSA 4W85A 2BHZA 4CD4A 3K8LA 2PC8A 5JBFA 1UQYA 3ZT6A 4BQ5A 4MNKA 3CHDA 4OBRA 2CKSA 4BA0A 2OWCA 1WDPA 5FD0A 1XYZA 1KB3A 3VMPA 1KQYA 5IHSA 4LYPA 3SEPA 1EO7A 4WK9A 1GPFA 4RE3A 1LF1A 2W62A 2DSKA 4AD4A 2CXGA 4AY1A 5ABHA 3WQWA 3ZR6A 2GJXB 1OGSA 3PZTA 4H2CA 2XPKA 2GVYA 4UOJA 3FHQA 1BF2A 5CXPA 4MB1A 1J9YA 3ZO9A 4AYSA 4W84A 3BAYA 1GOIA 4NZCA 3WF1A 3L2LA 3UERA 3AMGA 3B8SA 2EPKX 3BH4A 2JIEA 4OOZA 1CXEA 1BPLB 3N18A 3ARVA 1E43A 4GZJA 3VU2A 2J7FA 4XZWA 4Z2LA 3U7BA 1ZBWA 2E9MA 3AIQA 1XSJA 3VM5A 1UD5A 2ZX5A 5ABEA 2ZIDA 1UKSA 1ISZA 3WH5A 1M53A 3G6LA 1TFVA 2JF7A 3T2OA 4MTVA 1HVXA 3AOFA 3VM7A 1MVYA 4JFWA 3GXFA 4M29A 4JHZA 1EGZA 1HKKA 1PEZA 1W9PA 2J7BA 1NP2A 1TR1A 5FCZA 2A3EA 3AHVA 4NRRA 1I75A 3AS2A 3AIRA 4M1RA 1KXQA 4BCEA 1MQPA 3PBGA 1MXDA 1UWQA 2DT1A 3GZAA 2FDMA 1QHZA 1G9HA 5GNZA 5IFPA 4PUEA 3MUZ1 2W67A 3WF2A 1MFVA 2ZUVA 1V08A 2VO5A 3WD1A 4ACYA 1JZ8A 3K4DA 5EFFA 1OINA 3GTNA 1VBUA 4M80A 2WSKA 2BFGA 2QF8A 2E4TA 1ISYA 1MW0A 1WDSA 4MJ4A 3N17A 1W32A 1TE1A 4M8UA 5A6AA 4TX8A 4F66A 1D2KA 3PZUA 1AMYA 3CZJA 4JL2A 1W1PA 4OUEA 3W53A 4WSJA 4ZXLA 2X09A 2CEQA 3WH6A 2ZX6A 3AIWA 2QV4A 1VJZA 1UZ4A 2ZWZA 3FXYA 4LPCA 4N42A 4MAZA 3ZT7A 2VRQA 2VZOA 1B31A 3ARQA 2VTFA 3PTQA 3F5KA 5IDIA 3MU7A 4ZENA 5DMYA 4MADA 4PMDA 3MO4A 3RILA 1QW8A 5GPRA 3WQ8A 4HZ6A 3DC0A 3PZMA 3SUTA 2WLYA 3O9NA 1EA9C 1V0MA 2X8RA 3THCA 3QGVA 3OLEA 2BHUA 3CUIA 2ZUNA 2XVLA 3QR3A 2UY2A 1AVAA 3VX0A 3WDHA 5BXPA 1UD6A 1C91A 1HP4A 1FH9A 4UQDA 2Z1SA 2PI6A 3KL0A 2XFYA 4J3TA 1KBKA 3VDHA 3VGEA 3WQ5A 3SCVA 5I78A 1C93A 3GXIA 3AI0A 2VCAA 3AZRA 3KL3A 3WL0A 1GW1A 4D6HA 3ARYA 3VNZA 3WD3A 3NSXA 1QVBA 2VI0A 3MUIA 4B9ZA 4UFMA 2D3LA 2WMJA 5FL0A 4ATDA 3J7HA 4AXNA 3MSGA 4H7VA 3VIIA 4Y7EA 3AIVA 1PJ9A 1MW2A 4HOZA 5CGTA 1JDDA 1HL8A 2PWFA 3ZM8A 2WAGA 3HMCA 3KZSA 2W63A 5A6MA 3WNOA 1UA7A 2V5CA 1GHSA 3WUGA 4GQRA 4X0VA 4W87A 1L8NA 2WZEA 3HN3A 1B3ZA 1HJQA 1KQZA 4CGTA 5M03A 1K9EA 1MFUA 3VD4A 1HJUA 2BY1A 3IAPA 3LMYA 1E55A 3ARRA 1VB9A 1E5NA 1MQQA 1JI1A 2XM2A 2ZUUA 3CPUA 4GI8A 1UR1A 2XFRA 4PMOA 4UR9A 3OLGA 2CBJA 2WBGA 1M01A 1J0JA 1E71M 3CHCA 4M56A 2CETA 1NOUA 2EQDA 2WHJA 1GJWA 3VKKA 1O6IA 1E6RA 1E56A 4TTUA 3D5HA 2ZUWA 3F5JA 2J7CA 4L4PA 1DWFM 1B0IA 2OYMA 3BAKA 5A6SA 3ARWA 4H04A 4PMRA 3AS3A 5CSUA 4AEEA 1J18A 2J79A 2ZXQA 5ABFB 2VCBA 1H49A 3K8KA 5CZKA 2V3EA 3A4XA 1CXKA 3A4WA 3TTYA 5D9OA 1NWSA 2ZUMA 1JZ4A 1HKMA 3MUY1 4CN4A 2WC7A 3B9DA 2J7HA 1OGGA 2O9RA 2V3DA 4U33A 1GOKA 4OBSA 1CLVA 3BSHA 1B90A 1HIZA 5A8NA 1GOMA 4GI6A 2WHMA 2XVKA 3OGVA 1CEOA 2WHKA 5C70A 1EHAA 1I1WA 5AYBA 3NIYA 4TOQA 1E1FA 2WC3A 1Q6EA 3KEHA 4UQCA 2OLHA 2WCGA 2BY2A 1E5JA 2WC4A 3QHMA 5HPOA 4W89A 4ZFMA 1BYAA 3SCUA 1BFNA 2VJXA 2ZOXA 4GZEA 5I0DA 2Y8KA 4QCFA 4UFKA 4EANA 1VEOA 2EPLX 4AW7A 3L4ZA 5CLTA 1UR9A 2WCAA 5CJ5A 4W7WA 1M03A 1VF8A 3VILA 1SMDA 5A1AA 1JI2A 1H5VA 2J7DA 1ZS2A 2F2HA 4D72A 4F9JA 1KR1A 4UOQA 4U5KA 1HL9A 4W88A 4S3KA 4CU7A 1E0VA 1ZB5A 3AMCA 5HOSA 1ESWA 2D1ZA 4V2XA 7TAAA 4JKMA 1V6XA 1CDGA 3MUAA 4AZIA 1UH4A 2WVUA 2E9LA 3AIBA 2XIIA 3OZOA 1GVIA 4MDOA 1MW1A 2FH6A 3WBEA 5IXEA 1WO2A 1EQPA 1HP5A 2GJPA 3MKKA 2O9PA 4RE2A 3M7SA 2PWGA 2NW0A 5BROA 1R87A 1XH1A 1P6WA 2V38A 2WWCA 2ZXBA 4LYRA 3SUSA 3MMDA 1CTNA 3CUJA 2D22A 3OB8A 3KE0A 2NT0A 1UWRA 3OBAA 4PEEA 3WDQA 3NCOA 4CCCA 3WDPP 5JBEA 1CNVA 3VMNA 2BHYA 3VOCA 4DM2A 3L4WA 1O7AA 2VL4A 1CIUA 2OWXA 3N04A 3RCNA 2Y24A 1E1EA 4BQ4A 4PYSA 3GNOA 1MQRA 2FGLA 2OYLA 3GDBA 3EDFA 3WFZA 5E9AA 4MB5A 1HXJA 5A3HA 3EDEA 4F9DA 1ZBCA 3FN9A 3WH9A 2V5DA 2BXZA 3MANA 1DEDA 3BC9A 3ZSSA 3VDAA 4OIFA 3WF4A 5I79A 3WSUA 3K4AA 1UYQA 3CIVA 4WKFA 1TMQA 2CNCA 3CH9A 3OIHA 1V3HA 4HPGA 3WH7A 3SCTA 3UCQA 1UHVA 4JFSA 3PZQA 1V03A 2DSWA 1GQJA 3U5YA 4QLKA 2NT1A 3UESA 4E8CA 4J27A 1E4NA 3MS8A 1AQHA 1V3MA 4D6DA 3W6MA 3N1AA 1KXVA 2D20A 3WN6A 4MNMA 3KL5A 2WMKA 2FHBA 3WL1A 2D0FA 1BYBA 1TVPA 3OLDA 1FHLA 2CBUA 1QI2A 3ARZA 6A3HA 3BAWA 3W28A 1Y7VA 2XWDA 1E4IA 1GONA 4B15A 4GPNA 4PRWA 1YHTA 3I3EA 3WDIA 1BVNP 3W25A 3VIFA 4AWEA 2XGBA 1J01A 1QOXA 1FP8A 3VX1A 1G01A 2WHLA 2FHCA 4JFTA 1OSEA 2G3MA 3WNKA 4C7DA 1WAWA 1H4PA 1J10A 2X2YA 1JZ5A 1NH6A 1PIGA 4LQ1A 3I3DA 4XX6A 3ZIZA 1VFOA 3SCNA 3OG2A 3VIHA 2RGMA 4DUXA 1J0YA 3SCSA 4CD5A 5DFAA 1BHGA 1US2A 4LYQA 1EHNA 4EK7A 1UZ1A 2A3BA 2DDXA 2WBKA 4OOUA 4HA4A 5EB8A 1PX4A 3L4VA 3VIOA 3W37A 4W5UA 3MSDA 4AC1X 4UQ9A 2JALA 4P7QA 3VIJA 4ATWA 4W5ZA 1XV8A 2WK2A 1F4HA 3TTQA 2EJ1A 2YBTA 2YA1A 1BG4A 1U30A 3TTOA 1JZ2A 2VX4A 4D1JA 4DUVA 3SCPA 3SCOA 1JNEA 3II1A 2DT2A 3W29A 3APGA 3VIKA 1H3GA 3MMUA 3L4YA 1J0IA 1W9XA 3W81A 2IXUA 2G41A 1GQLA 5GNXA 3PHAA 5IFTA 2XUCA 3PTKA 4HZ8A 4HPHA 3WD0A 3QOKA 4Z2KA 3AXHA 1UG6A 3SCQA 2QPSA 3W6LA 3NDZA 2WVVB 1QPKA 3CBWA 2WVVA 5I3DA 1OGBA 3WY1A 3W4RA 1K9FA 3AS0A 1GOQA 3QHNA 4AIUA 2PB1A 1TG7A 4D6EA 5CG0A 4GQQA 2CBIA 1VFMA 2G3NA 4OZOA 1KGXA 2J78A 2VZUA 2Y2WA 5I5RA 1GQKA 1JZ3A 4AIOA 3T08A 3IJ9A 3RM8A 4M82A 3W27A 4B3KA 2PBOA 1QNOA 2YKKA 3UG3A 4FLQA 4W7VA 1UUQA 2YL6A 2YDQA 1XCXA 4JL1A 5A8PA 1OB0A 1LQ0A 2TAAA 2PWDA 3VVGA 3UG4A 1EO5A 4AMCA 4PCSA 4IPNB 3BAIA 4H8UA 1UA3A 4HA3A 4JCLA 4XZBA 1NM9A 1JDCA 2YJQA 1U33A 1UR0A 1ISWA 1IT0A 1HVQA 4TUFA 2EEXA 1UR8A 4PMVA 2VX7A 3JUGA 1W3KA 1DWIM 3SURA 2AMGA 4CN6A 2XSAA 1DHKA 2WVSA 4H41A 2EBNA 3EYPA 1B9ZA 3AICA 1E0WA 2DIJA 4TX6A 1E3ZA 2YLAA 2E8YA 1XC6A 4MJ2A 5HNNA 2WCSA 2BY0A 3GXDA 4GO8A 5F7UA 1CXLA 2VRJA 3EMCA 1GOOA 1Q6DA 1H0IA 3GXMA 4W8AA 2C7FA 2CHNA 1KCLA 1OBAA 1QI4A 4U2YA 3UETA 2Z1KA 2YDRA 4DM1A 1E3XA 1DWHM 1RP9A 2VRKA 3W38A 1XCWA 1QI3A 3WBAA 5I6SA 3TTSA 4AD5A 1D7FA 3BXWA 3CHFA 2CCRA 2E9BA 4Z2GA 1JL8A 1ZJBA 3BCFA 1U2YA 1WE5A 4IISA 2DGAA 3AFBA 3EMQA 3WEMA 1V3KA 4AZ6A 4AD2A 1PAMA 4UFHA 3THDA 4J3VA 1EOKA 2ZICA 4DWSC 5EMYA 1YQ2A 1EDGA 3WQVA 3ZMRA 3SCRA 3ZT5A 4UTFA 1HKIA 1S46A 1LJYA 2FGZA 3ECQA 3N11A 5A6BA 3K8MA 4CD6A 1OT1A 3GYCA 2EPOA 4FK9A 4AZGA 3NSNA 4GZIA 1LG2A 1XSKA 5GNYA 4QP0A 5A95A 1R7OA 5AC4A 5E6YA 4F79A 1V6VA 4J3UA 3VMOA 2GK1B 2WPGA 2E0PA 1OWQA 4D6IA 4AZCA 1XHGA 1X6NA 9CGTA 1CBGA 3ALGA 3BAJA 1LWHA 4IUGA 3QHOA 3WDRA 4A3YA 1J0HA 1J0KA 2C0HA 1V3IA 1XH0A 1B3YA 1W9VA 4UFJA 3BAXA 4WKAA 1QHOA 1PZ2A 1K9TA 4HOWA 2YL8A 3CMJA 1PZ3A 3NYDA 4NF7A 3BLPX 2WKLA 4HZ7A 1UD8A 1GUVA 1V0NA 1JD9A 3AMDA 3CLWA 4JFUA 1US3A 3EDDA 3WF0A 3ZJ7A 1JFHA 1W1VA 1WCGA 1LL7A 4Q7NA 2JIWA 5GQBA 1A3HA 3BGAA 5I23A 1PPIA 4YHGA 3CO4A 1B3WA 3EMZA 1AQMA 3RO8A 5FIPA 1B3XA 2X1IA 4CU6A 1CGUA 1WNOA 4U3CA 3PZVA 4PCTA 3PN8A 4S3JA 3RPMA 2VX5A 1JF5A 1UH3A 4UZSA 3B9AA 3O6AA 1E6QM 1M7XA 1RH9A 5LA1A 2AOSA 4AIEA 1UWTA 2XVNA 2G3JA 3VGDA 1IZKA 3W26A 5A8QA 4AZ7A 1NWUA 4NSBA 2X05A 4MNJA 1VEPA 4P7RA 5LYRA 1PBGA 4GXPA 1K9DA 4MB3A 4UNIA 1V3LA 3T0AA 1W9BM 2BVTA 4M81A 3NSMA 2GK1A 2W4XA 4QAWA 4BZYA 2O9OA 3O2LA 3F4VA 1QNPA 1H11A 5D4YA 4OJYA 4BQ2A 2Y5EA 4KWUA 1JZ7A 5JIPA 4D6GA 2CITA 4AEFA 1BVZA 1FH7A 4HMDA 1SMAA 4IPLA 3ARXA 3SUVA 4ACZA 2WMIB 5LA2A 1C7TA 4W8LA 2J47A 3WEOA 2G4FA 1FFQA 4P7OA 1QI0A 1B1YA 5BCAA 1C8YA 1CZ1A 5ECUA 4D6JA 3PZ9A 8A3HA 3AJ7A 5JBDA 1QBBA 3ARTA 2VT0A 2AAAA 1MWOA 1XYFA 5IHRA 1UR2A 4D1IA 4XV0A 1ECEA 1W3HA 3NJ3A 1JZ6A 4E4PA 3TONA 4QLJA 2YL5A 3K1DA 1IZJA 1C8XA 1QW9A 4PMUA 2D0HA 2GJXA 2OSXA 1E6PA 1KWGA 1KCKA 3AISA 4XUYA 1UKTA 1VFUA 1EDQA 3ARUA 1CPUA 4B16A 1E40A 2CPUA 3U7VA 3BSGA 1JAEA 2YBUA 3IK2A 3ZJKA 3FHAA 3VD7A 5A94A 5BRQA 4U31A 5M17A 3NDYA 4B3LA 4W86A 2VR5A 1UKQA 5D9MA 5BXTA 4UFLA 4WJXA 1VFFA 1ITXA 3POHA 1OM0A 1X6LA 1PX3A 2YL9A 2YLLA 4DUWA 1JYVA 1WZKA 1TZ7A 1EQCA 1ZL1A 1W1YA 3VO0A 5JUVA 4EKJA 4U3AA 5M5DA 2X0HA 1KGWA 6TAAA 4YPJA 4CN1A 2Y4SA 1ZBKA 2ZE0A 1GHRA 4PSRA 1LWJA 2UWFA 1DTUA 1NARA 1VRXA 3ARPA 1CENA 2Q8XA 3WEZA 3ZSTA 4EE9A 1NOFA 5A2AA 3RIKA 4BF7A 1FOBA 3ZR5A 4JKKA 4TXEA 3WNMA 1HJSA 1CXHA 2FHFA 5A69A 5KEZA 1H09A 5A6JA 2WMIA 4AD0A 3MV01 4HP5A 3ZJ6A 3AHXA 1UR4A 2DT3A 4C7FA 4HMEA 4V27A 1QHPA 3ZQ9A 3WUFA 4ZXOA 1BQCA 1PX8A 4P8VA 1ZJAA 2J7EA 2CIPA 4PN2A 4F8XA 2W66A 3N12A 3DYOA 1D3CA 2JF6A 1JNDA 5BYWA 3VDBA 4P8XA 3DYMA 2V3FA 1JD7A 5D8ZA 4MDPA 1OD0A 3DECA 2X0YA 3CMGA 2J74A 3WQ4A 4E2OA 4EAMA 1JYNA 3VINA 1E72M 1JYWA 1V02A 2GSJA 4PSPA 2HISA 4P8UA 3L2MA 1ITCA 2DSZA 1ISVA 2UY4A 4ML4A 3TOPA 1TVNA 3FAWA 1V6UA 4CCEA 2J7GA 4AD3A 4QFUA 2DSUA 4ZEPA 1GJUA 3T2QA 1KFWA 4LX4A 2NSXA 1RPKA 3D3AA 2CKRA 2XG9A 3GH7A 4JCMA 5M3WA 5E6ZA 1E4MM 4JHOA 5CLWA 2DPEA 1JIBA 3AXIA 3IJ8A 2QMJA 1NWRA 3OGRA 2A3CA 2G3IA 3AIEA 3VD5A 3VD3A 1R8LA 1IV8A 1FA2A 5FOOA 1V0KA 3BMVA 1EDTA 3GNRA 1JXKA 1C92A 2D23A 3CGTA 3PZOA 4L4OA 4ZE5A 1JYXA 1G5AA 4TVUA 4B9YA 5CPTA 3ZOAA 3OGSA 1OIFA 2FH8A 3G6MA 4W7UA 3WELA 2A3AA 3AHYA 2EXOA 2UY3A 4GKLA 1H1NA 2JEPA 4UFIA 1UD2A 5AC5A 4YN5A 1SR0A 5A2CA 1R86A 2BY3A 3PZIA 2GJRA 1X1NA 4J28A 1EXPA 1WP6A 3WF3A 4QCEA 1ISXA 2W61A 1WDRA 3CTTA 4H8HA 4IM4A 1HF6A 2RGLA 2E8ZA 5BWFA 3M07A 3A4AA 1VJSA 5A2BA 1W2PA 3WFLA 3UG5A 3FNDA 2DH2A 4D71A 3AROA 5CGMA 3VIMA 1JAKA 1QBAA 2O92A 4W8BA 5C71A 3IANA 5DO8A 4P8WA 1GCYA 4D6FA 1FP9A 5D8WA 5CSYA 1UQZA 5BXRA 1OIMA 4BS0A 3PTMA 1WKYA 5A6BD 1LLOA 3GBEA 3VGHA 4A4AA 1E9LA 3CZEA 2WW5A 2F8QA 4HU0A 5DT5A 3U57A 2YA0A 4KGLA 1CXFA 3AQUA 2ZX9A 3S2CA 3LPFA 2W5FA 2B31A 4TVDA 1Z32X 2PWHA 1E6XM 3GM8A 1R7AA 4UCFA 3MMWA 3VPLA 2GFTA 2WXDM 1W1TA 1LL4A 1KBBA 4AZ5A 1HX0A 2EPNA 1HJVA 4K68A 5CPQA 2VQUA 4WLCA 5EBAA 1CWYA 3DHPA 3LPGA 1B2YA 1LG1A 2XVPA 5FL1A 3W0KA 1G0CA 2VMFA 3TA9A 4CVWA 1XSIA 5ABFA 4Q22A 2ZUTA 4KRUA 2WMGA 1GZJA 2IUZA 3L4TA 4J3XA 1ODZA 3N15A 1QNSA 4W93A 1WDQA 3BMWA 5HDRA 1C8QA 1E6NA 1EOMA 4UOZA 1W9DM 4FLOA 7CGTA 4FMVA 2BV9A 1CXIA 4X9YA 2J8GA 3F5LA 1B30A 5FKYA 2DSVA 4NI3A 1VBRA 1FFRA 3ARSA 3AIUA 1NQ6A 2JFEX 2IXVA 4KGJA 4OKDA 2VZVA 2J8FA 3OA5A 3SUWA 1MXGA 2G8ZA 5HPCA 2EO7A 3WDJA 1HNYA 3A3HA 2CBVA 2WZHA 3AHTA 2YDSA 1VENA 2VOTA 3T09A 1XH2A 3B9EA 4GINA 1A47A 5AYIA 1NOWA 1BGAA 4C7GA 4HOXA 1KGUA 1C3FA 3RJYA 1TUXA 2WZIA 3EDKA 4HA1A 2DQXA 1EH9A 1VIWA 1OCQA 2BVDA 3UR7A 3CZ8A 4J7RA 4PMQA 1J11A 2D24A 5I2UA 4PMXA 5D9NA 1RP8A 3WNNA 3FW6A 3GNPA 1CGYA 5A6KA 3CZGA 1Q4NX 3RM9A 4NRSA 2VZSA 4WF7A 2A3HA 4JFVA 1ZU8A 2CESA 4MB4A 4Z2IA 5TD4A 4CVUA 3AMLA 2C8NA 3VD9A 3ALFA 3EDJA 1VAHA 5ABGA 3CZLA 5CPSA 1UKOA 1HKJA 2VURA 4URIA 1XRVA 3HU7A 2VC9A 2XIBA 1UKPA 3IJ7A 2XGIA 4PTWA 2DH3A 3WUBA 3AMKA 1Q6FA 4A3HA 3WKZA 1JXJA 4GO9A 2J75A 4J3WA 1TA3A 3BLKA 4MAVA 1OT2A 3U5UA 2EPMX 3MV11 1LL6A 3QOMA 3LPPA 1BYCA 3IAQA 1GNXA 2J25A 1CYGA 2BXYA 3UR8A 3VIGA 3AXXA 3TP4A 1DWJM 1GQIA 2WM0A 4PTMA 4FLRA 2ZUSA 2OSYA 1I1XA 2XSBA 4PTXA 1CGWA 2CYGA 1BAGA 1UOKA 2ZX8A 2Y8VA 3LPOA 4JIEA 1L0PA 1W9UA 2ZWYA 1V3JA 2QMKA 2ZX7A 1HJXA 2BS9A 1W2VA 1V02E 1H0GA 5E0FA 4P7LA 4UQBA 3N13A 3UEQA 1DWAM 7A3HA 5E70A 3KWXA 1W3JA 2QLYA 2WNWA 2YOCA 1UWIA 5I24A 4CU8A 1E6SM 4GIAA 4U2ZA 4BQ3A 1BTCA 2JE8A 3WMCA 2WLZA 1F4AA 5A6LA 1JDAA 2VQTA 2WB5A 4U5IA 3DYPA 3BCDA 4YHEA 3W82A 3WQ6A 1JFXA 4TVCA 4RL3A 2XTKA 3SUUA 3VIPA 3AHZA 2WMFA 5E0CA 2O9TA 3HJEA 2XYLA 2MANA 4R5EA 2GDUA 4PTVA 3T0BA 3M46A 2OSWA 2QPUA 1UWUA 5C8BB 4AZCB 2PF0A 1Q6GA 4PMYA 1QNQA 4RE4A 5DEZA 4KH2A 2BVYA 4QLLA 4CD8A 1N82A 1GORA 1KXHA 4J3SA 1WB0A 3VGBA 1PIFA 2W92A 1E6ZA 3WENA 4ACZB 3AZTA 5BXSA 5EFDA 2D2OA 3A6OA 1J0ZA 4N0RA 1JGIA 3VDCA 1FHDA 2VUYA 2XHYA 2D3NA 3T2PA 4CCDA 2PBGA 1XD0A 2ZXAA 1JF6A 3RDKA 1KWKA 4JKLA 4PMZA 2QHAA 3N9KA 6CGTA 1UH2A 1WZAA 5A8MA 2XWEA 2GDVA 4R27A 5DF0A 4KRTA 5HBFA 5CQ1A 2ESCA 4H8VA 2XFFA 1NP0A 5AY7A 1GOWA 1QNRA 5D9PA 2J4GA 4CKQA 2UY5A 3CUHA 3M6DA 3WD4A 1EIBA 1DWGM 2XVGA 4LXFA 2YA2A 1E0XA 1H2JA 2E3ZA 3RMEA 5I77A 4WSKA 2GUYA 1WPCA 2WWDA 4V28A 1CGVA 4XB3A 2WMHA 1M04A 5E09A 3CHEA 2J77A 3AYSA 1C7SA 1B3VA 1KXTA 2WKGA 2DEPA 1XD1A 3SIMA 1UWSA 4UQEA 4KMQA 3VNYA 1W3LA 2VVSA 5LA0A 3WMSA 4Z2HA 4AD1A 1UD4A 4WIWA 2VR4A 1UD3A 2DT0A 3CZKA 1E73M 1OD8A 2VNCA 4CUCA 4TTGA 2WYSA 1WZLA 3VUPA 2WANA 2HVMA 1MW3A 4DWSA 1Q6CA 3CUGA 2YIHA 1J12A 1CLXA 2XJ7A 2OYKA 3ZJ8A 4DWSD 8CGTA 3WMBA 4Z2JA 3WD2A 3VGGA 4QDMA 5BRPA 4P7NA 2VCCA 1JG9A 3A47A 3DHUA 1TCMA 3W24A 3WH8A 1K6AA 1RD6A 4JZ5A 1ODUA 3VTRA 2XM1A 3RJXA 1VEMA 1SYTA 1HN1A 2JEQA 2VZTA 2VVNA 3POCA 2BNJA 1H41A 5A8OA 2V3GA 4CD7A 3WNLA 4MPKA 2J62A 2CHOA 1WZMA 2WVTA 1GVYA 4FLSA 1BYDA 2E40A 3WIJA 1G94A 2D0GA 3AZSA 1V6WA 4D6CA 1BSIA 1DP0A 1E15A 2W91A 4E8DA 1G1YA 4LGXA 4UQAA 3VGFA 1C90A 4HU8A 3I3BA 3E1F1 3WNPA 1BG9A 4HMCA 2PWEA 3PZNA 3AYRA 1TA3B 3CUFA
chains in the Genus database with same CATH superfamily
4QG8A 3FDKA 3GH4A 3W1PA 1F74A 4IIBA 2QIIA 1TWSA 4B4FA 3TQ0A 4H6EA 3V75A 1HJWA 3K46A 4S3CA 5HULA 3L4UA 2QT3A 3AU6A 2VD9A 7REQB 3PZGA 1GW9A 4IQLA 3GIYA 3RM4A 2OFJA 5DXXA 4GGHA 1XGZA 4AISA 3UR5A 3QR1A 1AQ0A 4K7VA 1NWTA 4A05A 3OZPA 4WY0F 3QM3A 4XD4A 1BLIA 3S6TA 2DIEA 2HK0A 5D30A 3GYEA 1QI5A 3COTA 4E2VA 3AS1A 2NUWA 3TH6A 3QPEA 2WSPA 3LGGA 5AVNA 4KPLA 3GBDA 4X9SA 3ZVHB 1IYXA 2HDJA 4CD4A 4YVPA 4MNKA 4BA0A 2WNZA 4FXSA 5FD0A 3KHJA 2R94A 1PKNA 4FHAA 2V9DA 1FWTA 1FWRA 1XIFA 3KP1A 1MXSA 3QGKC 2DSKA 2PDGA 4AD4A 2VM8A 3FGCB 4PL1A 4AY1A 3WQWA 1G4PA 3ZR6A 3CUZA 1IWBA 2NV9A 3QEZA 3URNA 2GVYA 4UOJA 4MB1A 5T91A 4AYSA 3MHGA 1GOIA 1POJA 2Z29A 3UPBA 1SZGA 4UB9A 1T8XA 3W7NA 4NZCA 1OG6A 3WF1A 1FCBA 3BLDA 3CIWA 3AMGA 2EPKX 5J8LA 1NF0A 1EJUC 1XWYA 3LG3A 1BPLB 3N18A 1XQKA 1Z44A 3KZPA 3WLIA 4WZHA 4GZJA 4Z2LA 1XLBA 4XZWA 2OLAA 1ZBWA 4JEQA 3I65A 3QF0A 3DEQA 2BBFA 4L1WA 4PTNA 4Y90A 1K8YA 4QEHA 2ZIDA 1RJPA 1SJDA 3G6LA 3GG1A 1TFVA 2JF7A 3DFHA 4V1YA 4MTVA 3DGBA 3E2QA 4JFWA 2DORA 4M29A 4E3TA 1PEZA 4UTWC 4YXGA 1W9PA 3APYA 2RJGA 3RFAA 5FCZA 2A3EA 3AHVA 4NRRA 3AS2A 3AIRA 3GG0A 3MI3A 3M7WA 4LJ3A 4E38A 3EPNA 3PBGA 2HMCA 3IUHA 5CKSA 1UUMA 3GZAA 5MF5A 5DLCA 2PLMA 4FIRA 1Q8AA 3LCIA 2ACSA 3QR0A 4O4WA 1BD0A 1Q45A 2ZUVA 3VOGA 1O5QA 2A79A 3TZNA 2VO5A 3WD1A 3LV5A 4ACYA 1JZ8A 2NWRA 3K4DA 1O60A 1RXOB 1VBUA 1G4EA 3B97A 4G6CA 4A3RA 1ISYA 1WDSA 3N2BA 4MJ4A 1XBVA 4TX8A 3MP5A 3UW6A 1UMLA 4JL2A 2O7SA 4ZQCA 3W53A 2CEQA 1AFSA 2PTZA 2ZWZA 1VJZA 3TWAA 4LBRA 4N42A 3I10A 2VZOA 4OHQA 3GFYA 4LEFA 4L6DA 2AMXA 3F5KA 3L66A 3PR2A 4NX0A 3WK0A 2XH0A 3CQJA 3I7SA 3RPTA 3T4CA 4JNZA 3WQ8A 4HZ6A 3PNUA 3W72A 2Z0IA 4KWOA 3ABOA 3SUTA 4XZHA 2WLYA 3GDRA 3LGDA 5H1WA 4JXCA 3KTXA 4GYPC 1ML1A 1AVAA 4ES4A 4H6KA 3VKCA 1UD6A 4PGLA 4O0ZA 1FH9A 3C6CA 1BWKA 4BEUA 2BASA 1KBKA 2ON3A 1FVPA 1C93A 3AZRA 2F9RA 3AJXA 3ID7A 1F3EA 1QPOA 3UWUA 1I2NA 1TUFA 4ONVA 3R12A 4UFMA 2WMJA 4ATDA 3J7HA 3CB3A 1KM0A 4BHYA 4C6LA 3U3HA 3VIIA 4Y7EA 3RAOA 3A23A 4JY9A 3EWWA 3EXSA 5CGTA 1FXQA 2PWFA 3ZM8A 1GEQA 3JZEA 3KZSA 4GQGA 2W63A 2C13A 2XDFA 3ZWTA 4N7QA 1BVWA 3SFWA 1J4EA 3THAA 2VWSA 3BLEA 5CAKA 4W87A 3HN3A 1GYNA 1HJUA 2BY1A 1FWEC 4CNTA 4LTSA 3LMYA 1YRRA 1VB9A 4CQCA 3WLQA 3HPSA 1JI1A 3VK5A 1RALA 1F7BA 1UR1A 3QQWA 4HN8A 3HQOA 1E71M 3P7YA 2CETA 5FESA 3EX4A 4MM1A 3CEUA 3O8AA 4TTUA 3M44A 3NVDA 3RLGA 1H51A 3ANYA 1OABA 3WLSA 3BAKA 2RDUA 3N29A 4H04A 4PMRA 6ALDA 3GIPA 4RE0A 5FF0A 2ZXQA 4KWWA 2VCBA 1D3GA 3A4WA 1NWSA 4X63A 4CN4A 2A6NA 3TV8A 2J7HA 2Z26A 1X7FA 3LI0A 2NWSA 5A8NA 1FWAC 2XVKA 5AYBA 1FCUA 2HWGA 4TOQA 1Q6EA 2REQB 4UQCA 1DJHA 4JX5A 1UB3A 5KTLA 1IR2A 3B8TA 1ZFJA 1EWEA 1PWMA 2QULA 2VJXA 2F7FA 4FNSA 4GZEA 5I0DA 4UFKA 4EANA 2EPLX 4PZVA 2RDXA 3CV6A 4GVIA 1WOBA 3TYEA 2PLCA 4GIRA 2WCAA 5CJ5A 4PE8A 4F4RA 5B7ZA 4ZSUA 1BKHA 1JI2A 3C0SA 3G8RA 5IDZA 3LBOA 4GUHA 1TV8A 4F9JA 3CUXA 1HL9A 4W88A 3W1AA 5JU6A 4CU7A 3AAMA 3GE7A 3HB9A 5REQA 4YTSA 3IGSA 3NDOA 3LYEA 3W83A 1VZWA 1GPWA 1WA3A 4R85A 3ITGA 5EU9A 2WVUA 2E6YA 2XIIA 3OZOA 4UTKA 3A21A 1W8SA 1MW1A 4N6FA 1YXDA 1GVFA 3WBEA 3MHFA 1WO2A 2QKFA 4AY7A 3F4WA 1HP5A 4RE2A 1B4KA 1EGVA 5AC8A 2NW0A 5BROA 4KEZA 3OVQA 1HG3A 1A50A 3SUSA 1GVRA 4K8EA 1CTNA 4ZGYA 1GQNA 3KE0A 5DRCA 3WDQA 1ZUAX 1CNVA 5CZSA 5D2XA 1NDYA 3W1LA 5IOBA 4L1XA 1PTAA 1E1EA 1J2BA 2FGLA 3RU6A 2VEMA 1JCLA 1HXJA 4MB5A 3FN9A 4FX6M 3MANA 4OIFA 3WF4A 1BWVA 1TQJA 5I79A 3Q65A 4WKFA 2CNCA 3CH9A 3NQBA 2BGSA 1GTHA 3OIHA 5LNRA 4HPGA 3TLQA 3UCQA 7ODCA 4JFSA 3PZQA 3P5ZA 1S1RA 2BG5A 2PDFA 2A2IA 4QLKA 5FF4A 1XG3A 3ITYA 3R8GA 3IWPA 4E8CA 1XDMA 4J27A 4ORMA 1AMKA 5D09A 1P1XA 4FF7A 1KXVA 5G2WA 4BKNA 2GQ9A 3KL5A 4NZFA 2EJAA 3NL5A 1IT8A 4JQAA 3GX9A 4IIFA 3OLDA 3WQEA 1QI2A 3G77A 6A3HA 3KBMA 4C5ZA 3GU9A 3MBDA 3TKFA 3NO3A 1E4IA 4GPNA 3URBA 3UWQA 4F0MA 2QUTA 2XGBA 2HZGA 1FP8A 3VX1A 2FHCA 3ZLGA 3BANA 1H4PA 3V1HA 2ZZ4A 2R1MA 5KETA 4IMCA 3ZIZA 1VFOA 3NL3A 2A4AA 3OG2A 1YTKA 3VIHA 1BHGA 1US2A 1XC4A 3TC6A 4EK7A 3QV9A 2CLEA 1U5JA 3NPUA 3S2NA 4HA4A 5EB8A 5H91A 1VFTA 6XIAA 3WJZA 4H9XA 3L4VA 3O6CA 4K36A 4P7QA 1UCWA 1V77A 3VIJA 4X3ZA 4ATWA 3GQYA 1P0EA 3SQLA 4DXKA 4JTUA 1R46A 2YA1A 2BODX 1U30A 3TTOA 1JZ2A 3B04A 4DUVA 1BXCA 1ME9A 3MI6A 2RDTA 3HGJA 3II1A 1ECQA 3W29A 1O1ZA 2PEVA 3R5EA 1FHUA 2ZDRA 2I57A 5M2FX 2G41A 1UOZA 1GQLA 5IFTA 2FTYA 2XUCA 4QJ3B 3V4BA 1SSGA 3PTKA 4HZ8A 2R82A 8TIMA 2V0TA 2PGRA 4ZSTA 1B4EA 1SQ7A 3SQMA 3GD6A 1T41A 2NQJA 1C9WA 1CI1A 2YCJA 3L9CA 3RR4A 3NDZA 3VNMA 1QPKA 3SGGA 2WVVA 3LXAA 4XVDA 1I8JA 1RJQA 4RDZA 4JTSA 2GYIA 2PB1A 4FR1A 1TG7A 2FJKA 1W31A 1LRQA 4EPEC 2FFCA 1H7OA 4OZOA 3ES8A 4ZVJA 2PA6A 1XDJA 1GQKA 2QUNA 5EMJA 1JZ3A 1OYAA 4M1BA 3W02A 4M82A 3W27A 1J2WA 1VHCA 2PBOA 1PB0A 1LP6A 2BOGX 2ATSA 4PL2A 3TCEA 3UG3A 4W7VA 1UUQA 2YL6A 5A8PA 2ISVA 3FVDA 4AY8A 5LNSA 3TK7A 4Q7BA 1D8CA 3HPAA 3O6YX 1TPFA 1TV5A 4XZBA 2G37A 1JDCA 1UR0A 4TUFA 2ALRA 2EEXA 1UR8A 1TSIA 3U2OA 3QQ1A 1DWIM 2AMGA 1TJPA 1K6WA 1W5PA 3EYPA 4U4MA 3IV8A 4YVVA 4PC8A 3R6IA 5LIXX 4JN6A 4TX6A 4TIMA 1T7LA 1XC6A 2WCSA 1ZGDA 3UNTA 2BY0A 3GXDA 4EXAA 3EMCA 1KFJA 1GOOA 1Q6DA 2GOUA 1H0IA 2PZNA 4DYEA 1U83A 3QV7A 1KCLA 3NQEA 1OBAA 1QI4A 4DM1A 1DWHM 2YZ5A 5CBJA 4FXFA 1RP9A 1XCWA 1QI3A 2VFIA 2FTPA 3UJSA 3QMTA 3A4JA 4QNWA 3CHFA 3LXCA 2ZRWA 4Z2GA 1Q2SA 1JL8A 3B8DA 1XXXA 1ZJBA 1U2YA 1WE5A 3EMQA 1A4MA 5D32A 3G1FA 4DO4A 2X7WA 4NHVA 1JDFA 4LRTA 1AODA 5C2XA 8XIAA 3IK4A 5E0KA 2O7QA 1VBJA 3BGJA 3S5SA 1EDGA 4GI4A 3ZMRA 2VHLA 4DLFA 3EWYA 5DMMA 2QEZA 3N11A 3K8MA 3UJEA 1PDZA 1JPDX 4RZBA 1XSKA 2PDIA 4JOMA 1AJZA 4F79A 3P74A 1RVGA 4NT0A 3PFRA 2X1SA 4X22A 3RX2A 4D6IA 1LBLA 1GWJA 1X6NA 9CGTA 1LZOA 3DZ1A 1QO5A 1TCDA 3WDRA 3NR0A 4OUIA 2ABAA 1XBYA 5HJYA 2XIJA 1XX1A 1K4GA 1V3IA 4O17A 1B3YA 1UP3A 1QWGA 3BAXA 4H6QA 4WKAA 3N73A 1X6UA 2J24A 4NF7A 3RCMA 5CC6A 3S2MA 5CC5A 4HZ7A 2ZZ1A 3S1GA 3T0TA 3BOLA 1R30A 2BGNE 3LQLA 1JD9A 3W84A 1FWWA 2C19A 3MI2A 2HROA 4R88A 1JFHA 1W1VA 4N6EA 4LB3A 2ZTJA 4J2MA 1MRQA 3DDMA 3R1ZA 1OX6A 3W1XA 1RBAA 5FIPA 3RO8A 2X1IA 4CU6A 3PZVA 3CT7A 4S3JA 3RPMA 3LBMA 5G2IA 4UZSA 5F4XA 1UBSA 4FX8A 1AW2A 1RH9A 1GT8A 4KBXA 1UWTA 3L0NA 2CLFA 3IEBA 3TUUA 3PPFA 2Q8LA 1VEPA 1UIOA 2YR1A 5HQMA 4GRSA 4UNIA 3UXKA 1R3WA 2LLEA 3T0AA 3M4HA 4M81A 5E93A 3UJ2A 1EZ2A 2W4XA 1I6NA 2OPJA 4QAWA 4BZYA 2O9OA 1QNPA 4WX2A 2GVLA 2Y5EA 5G4HC 1BVZA 2QCHA 2XN0A 5AYZA 2OLSA 1MNZA 2O55A 3ARXA 2G0WA 3R13A 2BZNA 1C7TA 4QE5A 1FFQA 1QI0A 3KTSA 2QXWA 1CZ1A 3TC7A 4QITA 4D6JA 1O1HA 8A3HA 1LQAA 1QOPA 5JBDA 3ARTA 3LHZA 1O66A 4LCSA 1W3HA 4I5XA 4IG2A 2QGYA 3P84A 2PODA 1NSJA 3DG6A 4Q7IA 3TONA 2YL5A 3LCGA 4O1DA 2GJXA 2E5CA 2GOKA 2OO6A 3TXZA 1E6PA 1KWGA 4XD5A 1KCKA 1ONEA 4DJEC 3QYSA 3AISA 4IJCA 4IL0A 3ARUA 3HOJA 4FNPA 4MKSA 1XS2A 2CPUA 3K4WA 1Q66A 4LS1A 3ZJKA 5LSMA 4B3LA 4W86A 2VR5A 2GJLA 3Q37A 4IFOA 1YTEA 4WJXA 1OM0A 3POHA 4K6AA 2VFGA 3CWHA 1EQCA 1W1YA 1KM2A 3Q94A 4LU0A 1RR2A 1KGWA 5TAOA 1YNPA 4YPJA 3TSMA 1F2JA 3H2OA 1ZBKA 2ZE0A 3BQ5A 3CAKA 3KOWA 2KZHA 4PSRA 1LWJA 2UWFA 3L2IA 1CENA 2Q6ZA 2Q8XA 4YS1A 3WEZA 4AWUA 3PB0A 5TIMA 2PS2A 5C5YA 3GC4A 2FHFA 3PPCA 4I5RA 1TV7A 4LUYA 3L5LA 4CLMA 1FDZA 3R11A 2DT3A 3SY8A 3OP2A 1BQCA 3WLMA 1JGMA 4P8VA 2E6FA 3R94A 3EAUA 4NUWA 2GVEA 2P50A 1XYLA 3PSVA 2JK2A 5BYWA 3VDBA 3CAVA 4P8XA 4DB7A 2HQAA 1JD7A 4FP1A 2X0YA 4EAMA 1XRSA 1JYWA 5GJMA 4PSPA 4UTIA 4JTHA 2HISA 3L2MA 5F4SA 2X0SA 1RVKA 1F73A 1P0DA 1QMLA 5CJMA 1WBHA 4LX4A 2NSXA 1ZY9A 1W3TA 2CKRA 2RH9A 2XINA 2OG9A 3TJLA 1E4MM 4PB3A 2I5IA 2PFHA 3IARA 3S5OA 4BI7A 5CLWA 2NVDA 3TFCA 3IJ8A 2QMJA 3OGRA 2A3CA 1IV8A 4L1GA 3ISIX 1V0KA 3C8FA 1C92A 1WXJA 4ROPA 3UVIA 4ZO9A 4F40A 4L4OA 4ZE5A 1JYXA 1K8CA 2F2KA 3LLDA 4B9YA 5CPTA 3ZOAA 4WOZA 1OIFA 4KETA 4RZ6A 3WELA 4NXSA 3AHYA 2A7RA 3G1RA 2QVHA 4GQBA 3QFWA 4WY0B 5AC5A 1SR0A 2OXNA 2ODOA 2GJRA 2BSLA 1V5XA 1EXPA 1NDZA 2EGZA 1VGAA 1ISXA 3CTTA 1R5YA 2AL1A 2E8ZA 2W27A 3VC6A 3MCMA 4R7OA 1W2PA 2YZRA 3UG5A 3UPWA 3IVSA 3FNDA 5J04A 5T9BG 4O1CA 4HN4A 1VFLA 2O92A 2EKGA 3IANA 3XIMA 4MPQA 2UV8G 4P8WA 1GCYA 4JTRA 4D6FA 4DJFA 4QDWA 2WJEA 4BS0A 3BK0A 1GOXA 3F4CA 4JGDA 3GBEA 1QR7A 4DO5A 1IR1A 1XKYA 3O1NA 2WW5A 1SVDA 4HU0A 1Z9AA 3F1QA 4M0XA 4O52A 2YA0A 2ZC8A 1CXFA 3S2CA 1Q2RA 3LPFA 2W5FA 2XSXA 2PWHA 4GH1A 1NDVA 1VBGA 5AN7A 3QW3A 5ENLA 3MMWA 2GFTA 3CWNA 3R8RA 2WXDM 1KBBA 4AZ5A 2G95A 2IQTA 3KTCA 5DANA 2XZ7A 1XLCA 1HJVA 2ZVIA 2E09A 2GGIA 3QY6A 4K68A 5CPQA 1XINA 2AL2B 5EBAA 1YPFA 3LHUA 5ABFA 2PZ0A 3WZ0E 3RNDA 1ODZA 4QQ3A 4W93A 4DZ5A 1C8QA 4HK6A 4UOZA 1W9DM 4FLOA 3EA3A 3KBSA 1C9DA 2VC7A 1I60A 4PA8A 2BV9A 2F6XA 3G0XA 1VBRA 2AGTA 1IGWA 4F2BA 1NQ6A 4OKDA 2VZVA 2NQHA 3M0JA 3SUWA 3E38A 3OJGA 2PUZA 4PR4A 1HFBA 2VYOA 4Q8NA 3W01A 2WZMA 2PDCA 4NJGA 3N9RA 4LNYA 1EJXC 1ZLPA 1A47A 5AYIA 3LCFA 3JVAA 5L6UA 4C7GA 3FVMA 4OQVA 2WZIA 4YTQA 1OF6A 4ADUA 1GZGA 1EH9A 3P80A 1VCVA 1DJNA 3TR2A 3CZ8A 4J7RA 2R1NA 4PMXA 1RP8A 3SAZA 2CLHA 3CTLA 1Q4NX 3RM9A 1S39A 1PS9A 4ZOAA 4UR7A 3B0PA 3HO8A 1S2AA 4XZLX 3PPGA 4Q4SA 3R0UA 2C8NA 4MG4A 4LAOA 5TBOA 3NQDA 5ABGA 4O14A 5CPSA 3M0ZA 2EAWA 4PRTA 3W2NA 1J8VA 3IJ7A 3PY2A 3G1AA 4PTWA 3TW9A 2R1KA 3R2GA 3GFZA 4JTKA 2YYTA 3HGSA 3XISA 5F2MA 2WQDA 3CIXA 4ZO7A 4I90A 4XO7A 2I9EA 3U5UA 4OGZA 2EPMX 1LL6A 1CYGA 3P81A 3LU2A 4UTWA 2WM0A 4PTMA 4AF0B 1AD1A 3SIZA 4HHMA 1I1XA 3PWGA 3T55A 1VJIA 2I5GA 1UOKA 4GYJA 3E6EA 4HNNA 1W9UA 1V3JA 4PB4A 2QMKA 2ZX7A 4IGMA 1EBHA 3GUGA 1WKFA 1W2VA 1V02E 2TODA 1K7EA 2RJHA 4P7LA 2PLKA 1AH0A 1PZ0A 4OECA 3R58A 3B06A 3QZEA 2PDYA 3KWXA 3GHTA 4DN1A 4EPBC 2QLYA 1UWIA 5I24A 1Z7AA 4WDXA 4CU8A 1E6SM 4GIAA 4U2ZA 4A8LA 4BQ3A 1BTCA 4LUSB 2P53A 1NEYA 2W3ZA 4IQDA 2X41A 3UYIA 3WQ6A 3QQ0A 3T1GA 4O8AA 4PUKA 4RL3A 3VIPA 1SO5A 4TQTA 3AHZA 3PB2A 4EVZA 5E0CA 2XYLA 4MZ1A 2GDUA 4G1KA 1LROA 2IW0A 5C8BB 3V3WA 4OU1A 4EWND 4UTLA 2E1DA 3TN3A 1Q6GA 2GVGA 1JDEA 4H83A 4GJIA 1WDWA 4CD8A 1N82A 1GORA 1GZ1A 3BMXA 3RMJA 2CU0A 3E2VA 3LN3A 1GJPA 3VGBA 4R3UA 2W92A 3H21A 4JIPA 1E6ZA 3EKLA 1AL8A 1IF2A 4GX8A 1J0ZA 3MZNA 5JVLA 1X38A 1K03A 4H2HA 1JULA 1PSCA 2EPHA 5C2GA 1KWKA 2ISSA 1QPNA 4JICA 4PCFA 4H7CA 4J1OA 3N9KA 1UH2A 1EF3A 3DU0A 1A5SA 2DZPA 5DF0A 4KRTA 4LBUA 1JUBA 1Z48A 2ESCA 1FWJC 2Z6IA 4JS3A 4H3DA 5I00A 4CKQA 3CV7A 1CLKA 3WD4A 1U22A 1EIBA 1ENUA 2R1PA 5H8PA 1E0XA 2YA2A 4C6PA 1RQEA 2D2JA 4WSKA 2GUYA 1FQ0A 4NVTA 4JTEA 1BXNA 4V28A 2WMHA 1M04A 3CMFA 5E09A 3W7MA 2F6UA 1EC8A 2WKGA 4QS6A 4IGHA 4UMBA 4UQEA 3UXDA 4KMQA 4C90A 2VVSA 4EIVA 4Z1BA 2QJIA 4DJFD 1UD4A 3CZKA 3NGJA 3EB4A 1KFBA 3D6NA 2WYSA 1J5SA 1BEUA 3SDOA 5BOEA 3CUGA 3QC0A 8CGTA 2ZA2A 4Z2JA 1EC7A 3A47A 4IX2A 1KCZA 3DHUA 4GISA 3N2CA 4FEZA 3W24A 3UVAA 3H22A 1K6AA 3DXIA 3UZXA 5D2VA 4XSMA 2XM1A 4OV4A 2Z1VA 3DG3A 3OZMA 5FF7A 1SYTA 1HN1A 2X42A 3EOUA 5EA9A 3WQDA 2VVNA 1A5MC 3CPRA 1I4NA 4GIYA 3LD5A 3CQIA 3S1VA 1XKJA 1GVYA 4Q4OA 2Z2UA 4L64A 1I0DA 1CB7B 1VHNA 1I9CB 1YDOA 3AZSA 2WKJA 2QAPA 4GUIA 1V6WA 3LNPA 4D6CA 3B4UA 1G1YA 2PD9A 5I3FA 3I3BA 3HURA 3S9ZA 1BG9A 1XLKA 1BF6A 3AYRA 4JQ1A 5T9CE 1KM5A 2PWVA 4DZHA 2WQPA 2Z2AA 3FY1A 4IOTA 5JIWA 2B7QA 3V5CA 2C91A 1AH4A 3HBLA 4DWDA 1VS1A 1CGTA 4GI9A 2GPTA 3ABQA 1HT6A 3S2LA 2ZZ3A 1ZBVA 1R85A 5DT7A 3VNLA 3TW7A 1KLZA 3T0DA 1AQFA 4PUDA 3S9IA 5HXMA 4S3EA 3BARA 1TVLA 4FB7A 5HMEA 1BGGA 1FWFC 3EBVA 3KM8A 2P8CA 4JTIA 3VOHA 4FF5A 3NUKA 3KW3A 3VKDA 4M24A 4UZUA 2PD5A 3HIJA 3OVRA 3BDKA 3FAXA 4HTYA 3UY8A 4H6RA 4ATLA 3SADA 4F2TA 4AZHA 4GOAA 3OODA 3W87A 1FWGC 3M6YA 3C86A 1PVNA 1VLIA 2CLLA 1B57A 3K8LA 5JBFA 3ZT6A 4OBRA 1XYCA 2CKSA 3O3RA 3F2BA 1XYZA 4LCRA 5LXEA 4LYPA 3PBMA 3SEPA 3WFAA 4WK9A 1GPFA 4RE3A 5HATA 3OHMB 1VQTA 3WG6A 3MTWA 1DKWA 2CXGA 4MVAA 4HU4A 2GJXB 4XQ6A 4R34A 4HK7A 5CXPA 1QASA 1J9YA 3FSTA 3SJNA 4W84A 1EGMA 3GNDA 3WQOA 4CEUC 5C55A 3L2LA 4GABA 3BH4A 2JIEA 3SR7A 3VNDA 2ISDA 3USBA 1CXEA 1XLGA 1X96A 3NTYA 3ARVA 4FR6A 3GNNA 3VU2A 4K37A 3TQKA 1JCYA 3U7BA 1H63A 1X7IA 1L6YA 3VFLA 5CPNA 2E9MA 2Z7GA 3VM5A 1UD5A 1U1UA 1W0MA 1UKSA 3WH5A 1M53A 3HTWA 4DO6A 4PH6A 5D38A 1LRTA 1HVXA 3G1VA 3GXFA 1TPEA 3E12A 2OQYA 3HFYA 4JY8A 3O06A 2J7BA 1NP2A 2DVTA 3SN0A 3R89A 4JDYA 4M1RA 5HUPA 4BCEA 5AECA 1MQPA 4WUIA 4HD5A 3H12A 1UWQA 2G4JA 2Z28A 3OQ8A 4UTJA 1KRCC 3WBXA 5T8GA 3D46A 1QHZA 1G9HA 5GNZA 5IFPA 1VRDA 4GIEA 3L12A 4H8NA 2W67A 5I02A 5DMNA 3GKFA 2DUAA 3A9IA 1HGYA 2FPYA 1R0MA 4G7FA 5EFFA 1OINA 4S39A 3EWCA 2WSKA 4L80A 4IIGA 5JH1A 4JYFA 1F6PA 2E4TA 3G3MA 2B7PA 1IEXA 4I9JA 4WRHA 1TPUA 3EKZA 4M8UA 3IIPA 3W85A 4Y9AA 2Z1BA 1T0OA 4DQWA 3ABZA 2YBVA 4YCOA 1V93A 3TE9A 4MWAD 2QV4A 2QW5A 3AIWA 4LPCA 4YYCA 4A35A 3ZT7A 3B0XA 1B31A 5G1MA 3ARQA 2VTFA 4E3VA 5IDIA 2QZRA 1Q8JA 4JNMA 3W2JA 3REQA 4BF5A 4EACA 4MADA 1QW8A 1K8XA 4DYKA 2BX7A 1F61A 5CPMA 3PZMA 1ZP3A 3TFXA 3BGGA 2E5DA 4GMEA 4LV4A 1SFLA 2V30A 4H01A 2X8RA 3QGVA 3CUIA 2ZUNA 3OQEA 5DQPA 2UY2A 1R3SA 2A7PA 3U8GA 2FB3A 1ITQA 1C91A 1TWWA 1GKQA 2NQLA 3N14A 3KL0A 4J3TA 3E2RA 4QAIA 2V5LA 5KZMA 3W1UA 4LCQA 1GW1A 3VNZA 3W7GA 4EPKA 2PGEA 5D2WA 2D3LA 2Q8ZA 4AXNA 1TR9A 1KV8A 5CG7A 3AIVA 4ZQOA 2J13A 1MW2A 1A5UA 1OK6A 3E5BA 2ZRXA 1DPMA 4FIQA 1JDDA 2IPGA 4Q8UA 2V5KA 3NQ7A 4IQJA 2WAGA 3HMCA 1E51A 1JQVA 3MHUA 1S2VA 5AKQA 2V5CA 1GHSA 4NIRA 4C6QA 4UMCA 2E7FA 4QIUA 3GVGA 4GNJA 1H1ZA 5M1TA 2H9AA 3EX1A 4J40A 4I8DA 4PUJA 4INFA 3AU2A 1XISA 4GC3A 1K9EA 1MFUA 4FSAA 3UXAA 3RHGA 3P82A 2DFAA 3ARRA 1VR6A 1L9WA 2XZ9A 3O15A 3H4WA 1NAL1 4Z1CA 4GI8A 5AHNA 2INEA 3Q4DA 2XFRA 4UR9A 3DHFA 2WBGA 1J0JA 1TKKA 2GSEA 4IXXA 1TREA 2WHJA 1GJWA 3VKKA 1E6RA 1E56A 3PWIA 2PDPA 1Q65A 2ZUWA 4M5PA 1X8CA 2J7CA 1DWFM 3KBNA 1B0IA 2I7GA 2AL2A 3ARWA 3AS3A 4BI5A 2VC5A 5CSUA 1QK2A 4AEEA 1J18A 2QF7A 2OZ0A 5BU6A 1OCBA 5ABFB 1U1JA 5CZKA 4L61A 1CXKA 3TTYA 5D9OA 3WLPA 3A3XA 1XUZA 1JZ4A 1HKMA 3MUY1 1SUXA 3P60A 4NAFA 2O9RA 4OBSA 2XU2A 3BSHA 3UWWA 2OKOA 1F3WA 2O4QA 3BPWA 1E1FA 4UUIA 4A22A 4JBRA 4ZL1A 4OTKA 2OLHA 1E5JA 3QHMA 3SW6A 1YTDA 4PFMA 1DXIA 1A80A 3SCUA 4H9MA 1RV8A 5DBTA 1VEOA 2OJPA 3UD6A 4AW7A 1VKFA 4XIMA 3LB0A 3L4ZA 3NFUA 2ACRA 4XAPA 2QPXA 2NQZA 5E5CA 1FWSA 4LUTB 3GXPA 5A1AA 3QN3A 5I03A 3DI1A 4K1WA 2PAJA 2RHGA 4GG9A 2YXOA 3Q67A 5BWAA 1U5HA 4G8TA 3AMCA 4WR3A 2BOEX 1P0BA 2D1ZA 3BJSA 4FALA 4AFYA 1FDJA 4C6OA 7TAAA 4JKMA 1CDGA 1GVSA 3MUAA 1UH4A 4AZIA 1GVIA 2GQ3A 3E74A 1YX1A 3C0JA 2GJPA 3MKKA 2O9PA 3A64A 3VZYA 5I06A 4JNYA 1DHPA 3M7SA 3O0FA 2ZC1A 3KDOA 2Y61A 1R87A 1XH1A 2CHRA 3APTA 2DZUA 4LYRA 3TNBA 3QH2A 2PE4A 3MMDA 3CXOA 3CUJA 3H2CA 3CQHA 1UZDA 5FF2A 4GACA 4HIBA 3TQPA 4B2DA 3WDPP 5JBEA 3VMNA 2BHYA 4X2RA 2ZBTA 3L4WA 1NELA 2VL4A 3JU2A 4FO4A 4M6VA 4Q8QA 4ADTA 1KBIA 3GXTA 4BQ4A 4PYSA 1OFDA 2OYLA 3USZA 5KITA 3EGJA 2HTMA 2CLMA 5E9AA 4F9DA 3CQKA 4H7ZA 5BZAA 3GR4A 1LT8A 1ONRA 3BC9A 3OIXA 3G8EA 1REQB 4FNTA 3WK1A 1OX4B 3WSUA 2XIMA 3K4AA 3CIVA 4AWSA 1TMQA 4MKVA 2D73A 1UHVA 3QV8A 3CV1A 4LC8A 4YVXA 4Z1YA 1RCOB 4GJJA 1GQJA 3GVWA 1TPVA 3HJZA 1E4NA 3MS8A 4D6DA 2QUUA 2O56A 4RPPA 3ORWA 4YIWA 5D37A 3WN6A 2R14A 4UC5A 4DNHA 4ERIA 3KVKA 1RY0A 2QJJA 1LBFA 1W1IE 3WL1A 3SRFA 3ANUA 4MJZA 2J6VA 4RW5A 2QV5A 1N8FA 3BAWA 3W28A 2I16A 2VEPA 5DY2A 3HV8A 2DUXA 1GONA 4B15A 2FPVA 3R79A 1R2RA 1R38A 1YHTA 1W17A 3I3EA 3FJ6A 3WDIA 1BVNP 3TSDA 4AWEA 4MFDA 1J01A 2ZKMX 1EWDA 3EPMA 3WNKA 1R47A 4C7DA 1A3WA 1J10A 1JZ5A 1NH6A 5HA7A 1PIGA 2V69A 4LQ1A 3I3DA 3OW1A 5F4WA 2ZDSA 3HPFA 3QZ6A 3PS7A 4O1EA 3FJLA 3EWBX 4XAYA 3BO9A 3OVPA 4LYQA 1TE6A 1EHNA 4TV5A 2H6RA 1UZ1A 4GUGA 2A3BA 3UQNA 4L4LA 1PX4A 5G4EA 3OVGA 1W37A 4ZZ9A 3V36A 4W5UA 1EX1A 2PDHA 3ZXWA 3GDMA 2ZA3A 2FMNA 4W5ZA 1XV8A 3C2RA 1R9ZA 1IHIA 1BG4A 2VX4A 5JMUA 3TJIA 3UWYA 1JNEA 1BSLA 3UPMA 2QQ6A 1WKEA 3MMUA 1PKMA 3L4YA 3W81A 2D2HA 1OFPA 3NXFA 2G3FA 3I4KA 3WD0A 1LORA 3QOKA 3ME3A 4Z2KA 3AXHA 2PP3A 3SCQA 1PTGA 2Y7FA 2D69A 1OFAA 5B7YA 3CBWA 4E0CA 1UMYA 1W5QA 3SFKA 2RAGA 3WY1A 4XAZA 3AS0A 1GOQA 3QHNA 4AIUA 4HHHA 3E0FA 4GQQA 1VFMA 2QAFA 1KGXA 3SRKA 2YFNA 5I5RA 5HMDA 3AYVA 1F05A 1KTNA 1FWDC 2TPSA 3M5VA 4CNPA 1G4SA 1QNOA 4BF9A 4BWLA 3L23A 1V7AA 5HWJA 2TAAA 3VVGA 3L5MA 5K4ZA 4K1GA 3NL6A 4IPNB 3DAQA 4DIAA 2QDEA 2J9XA 1UA3A 1UROA 1NM9A 1F3XA 3H24A 2YJQA 3LS9A 1OEPA 5C7VA 4JN8A 5TNVA 3FX4A 4GH3A 4DZIA 3E0LA 1R3RA 3SURA 5BW6A 2X7VA 2XSAA 4LB4A 1O68A 5CBIA 2VEFA 1E0WA 1LOLA 3LQGA 4AMAA 4US6A 3ITCA 2OGJA 1SJCA 1P4CA 4XK2A 5HNNA 5HINA 2V2HA 4I9MA 4GO8A 1FBAA 1Z89A 5F7UA 4YCPA 1CXLA 2CC0A 5CCZA 3GXMA 1J5TA 1XIHA 2VDGA 2C7FA 3GWQA 6ENLA 4C6DA 1M5WA 1GKPA 1XR2A 3DCPA 3W73A 3PPHA 2DV0A 2G96A 3QTGA 2E9BA 3P8IA 5E9XA 1S5MA 3BCFA 1EJSC 3AFBA 3B0VC 3WEMA 2BB0A 3NQAA 2FQIA 1IWAA 1PV8A 2YXXA 5F2GA 4GQ0A 1X98A 2P3ZA 4A29A 3AWNA 5EMYA 3IIOA 3WQVA 3SCRA 4UTFA 1HKIA 2ZZ5A 3NPVA 5BMXA 4H9YA 2FGZA 3ECQA 4E2BA 4CD6A 1OT1A 3R43A 3JZUA 4B5SA 1JCTA 4I9AA 5IM51 1NDWA 4GZIA 4RNJA 1LG2A 1V7YA 4X2PA 3AO0A 2FZDA 4I8YA 4ZR8A 4LS0A 2A7NA 3VYLA 1OC6A 2GK1B 3GTFA 2E0PA 1OWQA 4AHQA 4DX3A 4Q32A 1XHGA 3LGEA 5FA5A 3TEVA 2OMAA 4D9PA 2WSYA 1LWHA 5LNWA 4Z0JA 2QNEA 2Z24A 1Q7QA 1TJ1A 4A8IA 4O10A 2C0HA 4HTBA 4UFJA 5B80A 1G69A 3IJIA 3L21A 3BG3A 3S1UA 3N19B 3DX5A 2HBXA 3M0XA 2WKLA 3R7MA 1NJJA 5BNKA 3U0HA 3AMDA 3ZJ7A 1K1DA 1LL7A 4Q7NA 1A3HA 1FKXA 1O12A 4YHGA 1N8WA 3CO4A 1B3WA 2YGYA 4XZNX 1B3XA 4J4KA 1CGUA 4PCTA 1O94A 3R4IA 1JF5A 1UH3A 3O6AA 4BR1A 2ALDA 4NX5A 5LA1A 2AOSA 4REQA 1KTCA 1IZKA 5A8QA 3A12A 4B5UA 2VGBA 4NSBA 3ZLHA 4E4FA 3CYVA 1MEIA 2HRWA 3OBKA 4XBSA 3VE7A 4MB3A 5FAJA 4LVFA 4WXZA 1NF7A 1DJIA 2E28A 5LIWX 4XD3A 1L6SA 2VELA 3PJWA 5D4YA 4BQ2A 4N4PA 1A5KC 5JIPA 2QYGA 4AEFA 4EF8A 1MO0A 3N6JA 3O0KA 2GL5A 1DORA 2PDKA 5K7JA 3CL8A 1SSDA 3K2GA 3WBWA 4K38A 4KF1A 5C9ZA 3S6DA 2G4FA 3ANVA 1IXNA 5DMLA 1EJVC 1B1YA 4JPGA 1C8YA 2Q71A 4UMAA 4C6JA 5ECUA 3N34A 4QJ1A 5EMLA 3AJ7A 5I3GA 4RZ4A 2NXHA 4UTHA 2VT0A 3QTPA 4QBXA 4D1IA 1US0A 4XV0A 4XD6A 1ZP4A 2OQLA 3BWWA 4JQ4A 1JZ6A 3LXBA 1ZJHA 4QLJA 1IZJA 4O12A 1C8XA 1QW9A 3WO8A 4PMUA 3TIMA 3TYZA 2DP3A 4I6VA 3D47A 2A6LA 3MCOA 2FZMA 4V15A 3C5QA 4B16A 3BSGA 1JAEA 3U2CA 1DXFA 3TN4A 2REQA 3WBYA 5BRQA 5M17A 4N9CA 3I6EA 3UYCA 2CZVA 3FV9A 4JX4A 1ZCOA 3M5ZA 1JYVA 1WZKA 5JQ9A 3VO0A 4EKJA 2NX3A 2X0HA 2B4GA 1VYRA 6TAAA 3L0GA 2Y4SA 5LIYX 3BE7A 1TWZA 1DTUA 1VRXA 2XN1A 1TWIA 3TOYA 3I4EA 3ARPA 2ATMA 2XISA 3YPIA 3W88A 5A2AA 4C6FA 3OZYA 3RIKA 4C6KA 4BF7A 3GC5A 1A5LC 4IICA 4JKKA 1YADA 4TXEA 5AC7A 4C5YA 5FJTA 5KEZA 5A6JA 4AD0A 1GVQA 5ECVA 1ICQA 4S2CA 2O4MA 4WJ8A 3IGHX 2NV1A 4C7FA 3AC0A 3ZQ9A 2FYMA 3MP4A 1ZJAA 2Z6JA 2J7EA 4N2YA 3C61A 2W66A 1W3NA 3N12A 1TPDA 3DYOA 4NI8A 2QDDA 2JF6A 1JNDA 3W3OA 4DAIA 2V3FA 5D8ZA 3FK4A 1OD0A 3DECA 4E2OA 1JYNA 5FF3A 1ZTVA 4IMDA 3SRDA 4IMGA 4NY2A 4UTUA 3B9OA 2WOQA 4P8UA 1EEXA 1ISVA 2UY4A 3TOPA 1GGOA 1SFTA 4CCEA 4QFUA 1QTWA 5LNUA 1GJUA 3T2QA 2DW6A 3WYZA 4RZ5A 1RPKA 4QX4A 4HNVA 5M3WA 5GVJA 2V82A 2Y6ZA 4ORIA 5IRPA 5CPLA 2NV2A 3A13A 1IIHA 3KVLA 2QJGA 3AIEA 2FKPA 1R8LA 4MMWA 5FOOA 3BMVA 3PBVA 1EDTA 1ADOA 4ZB0A 4NJHA 4D8AA 1QK0A 3PZOA 1SU5A 2V2CA 4LAMA 1KV5A 3T81A 4EXQA 3FS2A 2QCFA 2FH8A 1LCOA 3RITA 2A3AA 1LBMA 3PUOA 5FEZA 3S83A 2E77A 4IQEA 4GYFA 2H3DA 3QVQA 4Z42C 3STCA 5A2CA 1R86A 4JTDA 1IWPA 2XH7A 4LFYA 4J28A 4QCEA 1WDRA 4H8HA 2RGLA 3N2MA 3HFTA 4JTAA 3R10A 1FWIC 3BOXA 1RLDA 1B9BA 3AROA 5TF0A 5CGMA 2P76A 1JAKA 3NO1A 1XIJA 4N4QA 5C71A 1KCXA 1F9CA 3W23A 3URQA 1OIMA 3F7JA 1WKYA 1A5BA 2ABBA 2Y5SA 4DZAA 3PNZA 2CZ5A 5DT5A 3QPZA 3AQUA 1FRBA 5DCDA 2V6AA 2ZX9A 3BOFA 1IXOA 4QNEA 4TVDA 2DJXA 3FXGA 5HANA 4UCFA 1A0CA 3VPLA 2HNEA 4LWWA 2X40A 3Q58A 4EP8C 2J9ZA 4UNKA 3DI0A 1TPC1 2Q02A 3VCNA 2WJFA 2OB3A 1G0CA 2G97A 2I14A 4HNUA 3NM3A 4ZCWA 3W7KA 2ZUTA 4KRUA 1B3OA 2IUZA 1OFOA 3G1XA 3N15A 2GSHA 1WDQA 3V5OA 2C1HA 2P8BA 5CPOA 4FMVA 3W22A 3URAA 2NXGA 4XAFA 4NKCA 1XPYA 3F5LA 1FTXA 2DSVA 4NI3A 1UWAA 4KGJA 2IXVA 4ZOEA 3VZXA 1J79A 2VUNA 2J8FA 3MVIA 3QPYA 2DVXA 2EO7A 3WDJA 1QFEA 5DX7A 4XTIA 1P5BA 1HNYA 3MCNA 3WJWA 4O54A 3MVTA 3WMLA 2WZHA 1RA5A 4K2SA 4GD0A 1VENA 4YLWA 2VOTA 3T09A 1XH2A 4GINA 5EGRA 1BRLB 1SW3A 4M6PA 4O8RA 1BGAA 4HOXA 2QCNA 3M1ZA 1TUXA 1RAKA 3V1PA 2GDQA 2DQXA 1OCQA 3UR7A 2D24A 3R0DA 5D04C 5D9NA 1L6GA 1M3UA 3NZQA 2ZA1A 1R9YA 3WLTA 2VXNA 3W7IA 4ADSA 2E68A 3G5EA 1QUMA 1K70A 1KRAC 3W70A 3AMLA 4H9UA 3EDJA 1VAHA 3MT1A 1UKOA 3UXIA 1ZRQA 1IXQA 3GTIA 4LBSA 3HU7A 2XIBA 3SSJA 2EG8A 4F0LA 1TIWA 4D8ZA 3WUBA 1SZNA 1E0TA 2C3ZA 3AMKA 4KEVA 3LM3A 4XZIA 1N2VA 4A3HA 2I17A 1JXJA 3V0TA 3GW0A 2Y88A 2XH2A 4NP7A 1A5AA 3V18A 3BLKA 1OT2A 3KCLA 4DJDA 4MKNA 1KC7A 1AL7A 2P3EA 3MV11 4KS0A 2OCZA 3LPPA 2X2GA 2BXYA 3VIGA 2YSWA 4FLRA 1RCXB 4EWJA 2Y62A 4FXRA 3FIGA 3IJDA 3GHUA 3HGOA 4PTXA 1BAGA 2ZX8A 4GNVA 4AHPA 3R25A 2GWNA 4XG1A 3VUSA 4AB4A 3I7QA 3CQ0A 4MF4A 5E0FA 1W6TA 2Z4GA 2JQXA 3TR9A 1JCJA 3GVRA 4UQBA 4Q8PA 3N13A 3GTHA 5EMMA 3N3MA 2PRHA 3C4UA 2W79A 5E70A 1W3JA 1Z69A 5J5DA 1FKWA 3MSYA 3SJ3A 4J2PA 1XIIA 3I68A 2OGYA 4S38A 1JJKA 1ELSA 1TJRA 3P2VA 4HNTA 1XFBA 2WB5A 3GFXA 4YHEA 3IIXA 3RRXA 3EKGA 1NFGA 4UTTC 4NYUA 4DBEA 3G3DA 5HR6A 1RLCL 1P1MA 3VAVA 2H8XA 1NIUA 1VYPX 3FA3A 2MANA 4PMJA 3M46A 2I56A 3GVVA 3CS2A 3NEVA 2QPUA 1TWDA 4NAEB 4IF2A 4PMYA 1R3QA 4QLLA 4B91A 1KFEA 1F3TA 3GG7A 3SY1A 1B54A 1WB0A 3H2AA 4ACZB 5EFDA 3A6OA 3BCJA 2PDUA 4S3GA 3PBYA 1PL9A 4OWGA 2XHYA 3UFYA 2GGGA 3VE9A 4CCDA 4AF0A 3LA4A 2ZXAA 3MY9A 4PULA 4M3PA 4UXDA 3ATZA 3VOJA 4RW3A 5CJNA 1WDDA 3TN5A 4YU1A 2XWEA 2UZ9A 2GDVA 4R27A 4ZO8A 5HBFA 4FXJA 4H8VA 4ML9A 1UIPA 1V79A 3KX6A 1LTDA 4C1LA 2J4GA 2UY5A 3KS5A 3CUHA 3TSBA 3UZJA 4DXXA 3RMEA 1KFLA 4F0HA 2R8WA 3E0WA 1CGVA 4XB3A 1Y8BA 2D2GA 2ADAA 1KXTA 3W6YA 2DEPA 3UA4A 1W3LA 4XIAA 5LA0A 3WMSA 2OX4A 4AD1A 2DT0A 4A3QA 3H2NA 4RXFA 5AYXA 4FNUA 2QJMA 3UZWA 3S8HA 2WANA 3KOXA 2HVMA 4DWSA 2FGBA 3W86A 3PWAA 1J12A 3GO2A 4P5UA 2OYKA 3VXGA 3WD2A 1WOAA 2WJDA 2VCCA 1TB3A 1JG9A 4L9XA 3KFTA 1JEZA 3WH8A 3M43A 1J6PA 1BTMA 4GUFA 3O63A 4NASA 3RJXA 1EJ7L 3R8HA 1VEMA 1XJBA 3TWBA 1VCFA 2AQWA 3ZYZA 3B8VA 5DELA 3W7OA 4K3ZA 5CEWA 1DE6A 2VGGA 2ANUA 1EJTC 5G5IA 4DJEA 2VDIA 1WZMA 1Q6OA 4YMZA 4KCVA 1BYDA 1HGWA 3KOZA 2E40A 3WIJA 1G94A 3MMTA 1P7TA 2BOFX 3LCXA 3QXBA 3ATYA 5C9UA 4LF2A 4DXVA 3VKAA 1BSIA 5EMKA 3W76A 1DP0A 1E15A 1PHWA 4LGXA 1C90A 5IBXA 4XZ9A 3WNPA 3WJXA 3OOQA 1DV7A 4HMCA 4O0KA 3ZZ1A 2Z25A 2V2DA 1JUEA 5D33A 4XTDA 3RU8X 3WX7A 4MWAC 1V6YA 4GY7A 1VPYA 2ZXDA 1E4LA 2VGFA 1W3IA 2I5QA 3CEPA 4FS9A 4O4VA 2DZAA 1FWCC 1QT1A 2DY3A 4WCJA 2R6OA 3MB9A 4C60A 3WUEA 5FAGA 1NFBA 3LUTA 2OWWA 2F61A 2BWGA 4HQVA 1JPHA 2GZXA 3FYOA 3L4XA 3BUVA 5KZ6A 1CGXA 1S3HA 4PMNA 2A0NA 4GX9A 5G1TA 2ZRUA 5K4XA 5D2TA 1D9EA 1FH8A 3ZWSA 1CECA 5C9XA 2WJZA 3C2YA 7ENLA 3SGZA 3DC8A 4MYAA 1Q4WA 3IJLA 2CERA 4S2BA 1SFSA 1M65A 3UGVA 4DF2A 4H4IA 1H5YA 3H53A 3ZVHA 2PC8A 1UQYA 3GIQA 4IPJA 3CHDA 1D7KA 2OWCA 4B5VA 1ME8A 3WLOA 2PF8A 1WDPA 3DFTA 3UCCA 3IIVA 1KB3A 3KDNA 3VMPA 1KQYA 1KKRA 1KD0A 1EO7A 2W62A 3KBWA 1YDVA 2ICSA 4GBUA 3MA8A 1P6BA 1KRMA 1NU5A 5ABHA 1RUSA 3LZ3A 4UTTA 3TXVA 2PRLA 4H2CA 3B8UA 1SFJA 2XPKA 3H23A 3FHQA 3BG5A 2HSAA 3NQCA 3I6RA 3ZO9A 3BAYA 4MGGA 3GDLA 3S42A 2Q01A 2X1UA 2P10A 1A5OC 5FJIA 4DLMA 3KLKA 5H8UA 3U4FA 2X1TA 4GVHA 1WUFA 2J7FA 3HG4A 3AIQA 1XSJA 3WLKX 1SW7A 2FIQA 2G5WA 1XLEA 4MUPA 4AUBA 1OX4A 1OFBA 3T2OA 3AOFA 2GQAA 4JHZA 1EGZA 3M0MA 3DIPA 1JCNA 1IEIA 4ICNA 4PBFA 2VKZG 5J5RA 4OBTA 1KXQA 1MNSA 2E6AA 1G7VA 2PDJA 3U6WA 1MXDA 3FYYA 1EL3A 4WSHA 1S5VA 3OHIA 1SGJA 1WXZA 4HBKA 1RA0A 2VGIA 3PP7A 3QFEA 1X97A 3QSTA 4HYRA 1VH7A 4LH8A 4KQNA 3EWXA 3N3TA 4I7WA 2FZ8A 1YE4A 1FX6A 3KS6A 4NZ3A 2FZ9A 4M80A 3CLMA 2BFGA 4R7WA 3N17A 1ZAJA 1W32A 3TJXA 5A6AA 4F66A 1D2KA 3SN4A 3PZUA 3CZJA 2OEJA 4OUEA 1Q6RA 2X09A 3WH6A 2ZX6A 3FXYA 4MAZA 1F07A 3PTQA 1W56A 3MU7A 4W4QA 4PMDA 5DMYA 1PKLA 5GPRA 2Y8UA 4GYPA 2OTDA 3LY0A 4US5A 1K77A 3UNDA 3O9NA 1EA9C 3THCA 3OLEA 1XYAA 2XVLA 3TDFA 3QR3A 1OFQA 3IJQA 3W7QA 3VX0A 1A3XA 1HP4A 1DYSA 2EG6A 3MUXA 1ICPA 2V8ZA 2PI6A 4CQDA 3WK3A 3BQ6A 2VOMA 3ABRA 3WQ5A 3AI0A 1Q85A 3H4XA 3KL3A 3FSUA 5I07A 3QY7A 4JHMA 5I7GA 3L67A 1RPXA 1PWLA 2X1RA 1QVBA 2VI0A 4Z17A 2KAUC 1YBQA 3NO5A 2NUXA 1ZNNA 1EPXA 4E6MA 4A6GA 3MSGA 1PHQA 1Q13A 1WUEA 1KFCA 4HOZA 5H8MA 3BLIA 4KT2A 4KCTA 1TV2A 3U4AA 3ELFA 1H7RA 4UBPC 4BWLC 3EA1A 3UXLA 1Z3NA 3WNOA 3S46A 3PM6A 3WUGA 4ICMA 4X0VA 5A5WA 1L8NA 2WZEA 4QE4A 4GKTA 5M03A 3VD4A 1UW9A 3KCJA 2HXTA 3Q45A 3HG3A 1E55A 2IMRA 3BURA 1MQQA 2ZUUA 4I7VA 1IGSA 3OLGA 2CBJA 1M01A 3CHCA 4M56A 1NOUA 3V16A 2EQDA 2VD8A 1O6IA 3UZZA 2RKXA 1NTHA 1TV3A 3D5HA 4C1NA 2V68A 4O1FA 3F5JA 4DJDD 2R24A 5G1YA 5A6SA 5LIUX 4QJ4B 3CHVA 3VKBA 3DFPA 3CC1A 2GQ8A 2V3EA 5D2YA 3L5AA 2ZUMA 3LHWA 3B9DA 2V3DA 3DKJA 4ZOBA 1CLVA 3HG2A 1B90A 2WSQA 1HIZA 1GOMA 1K7FA 3PANA 2NSOA 2WHKA 5C70A 1EHAA 2YXGA 3M47A 2WM1A 3NIYA 4PUMA 2WC3A 4S3DA 2XN2A 5FJOA 2WCGA 3M41A 3I7RA 5HPOA 1OK4A 4ROQA 3TJ4A 4G56A 2F38A 3D0CA 2FLIA 4ZFMA 2ZOXA 5A6TC 1SO6A 4CNNA 1PXGA 1VP5A 5H2ZA 1BXBA 3NQ2A 1X8FA 2FVMA 2O0TA 3D3FA 3BJTA 4OVXA 4AG0A 1XIDA 2XFWA 1UR9A 4B3ZA 4W7WA 4JQ3A 3VILA 5U7SA 1BRLA 3JR2A 4G1NA 2J7DA 5BRBA 2PSNA 4D72A 1XPGA 2Q3OA 1KR1A 2FTWA 4Q8WA 4U5KA 5F1UA 3BV7A 5REQB 2C6QA 4S3KA 2PCQA 1ZB5A 2P5NA 4DAFA 1ESWA 7PTDA 4V2XA 3WJSA 3AIBA 1AJ2A 3GC2A 1FWBC 2FH6A 4WD0A 1ZSXA 5C9RA 1MZHA 2ZRZA 1ZPTA 1HO1A 1DOSA 1L8PA 3TC3A 3STPA 2V67A 2V38A 1ZCCA 1ZZMA 2WWCA 2ZXBA 3E2SA 1EUNA 2NZLA 3MQTA 3EB2A 4Q8OA 3OB8A 2NT0A 4OE7A 1XLIA 3WQFA 3OBAA 4IIHA 5EBUA 4WEVX 2L5HA 1AZ1A 2NXIA 4CQ9A 4DM2A 3UY7A 4PTDA 1CW2A 4LAZA 1CIUA 4ZTXA 2OWXA 3P5YA 3P61A 1E1CA 4N02A 1P43A 4HPJA 3RCNA 2Y24A 1EFZA 3GNOA 2Z00A 3EDFA 5E1QA 3WFZA 1YE6A 3QRHA 1ZBCA 1RJRA 3ZSSA 4YWSA 3VDAA 1I0BA 3CV2A 1ZALA 4YYFA 1UYQA 4TR9A 1QWKA 1ZAHA 1AUSL 7REQA 3SCTA 3OPSA 4JDBA 2RDWA 1MDRA 1QATA 4I9TA 4V33A 4DBSA 4CQ8A 1AW1A 3U5YA 1AW5A 3ZFHA 3UESA 3FEMA 3FCPA 1RBOB 1V3MA 4U10A 1RY8A 2IPFA 3N1AA 5FJRA 4TU1A 2D20A 4IHCA 4AYGA 2YYUA 5HQLA 2P88A 1KA9F 2FHBA 2D0FA 1W1ZA 1TVPA 1FHLA 2CBUA 3RLVA 1EC9A 4LSBA 3ARZA 5HQEA 5HNTA 2Y70A 1Y7VA 4Q4MA 2XWDA 1O5RA 4GGBA 1J96A 1VFSA 2VFDA 2C14A 4RKAA 1KLYA 4AVOA 2QCMA 3H2MA 1QOXA 1G01A 3CU2A 1OSEA 2G3MA 3VOFA 2OT1A 4ASTA 2IKJA 2XIQA 3E0IA 3FGCA 4F0SA 1OYCA 3RUBL 3KAOA 4XX6A 1HO4A 3SY5A 4B5TA 3WQPA 3GAKA 2QDHA 4Q33A 2RGMA 4L9ZA 2ZVRA 5DFAA 4FI4A 2PTYA 3O05A 2DDXA 2TMDA 3HQNA 4MLRA 4Y9NA 4DY1A 3W37A 3MSDA 3S3GA 2C79A 4GFSA 4AC1X 1N55A 4GXWA 3QW4B 2WK2A 3B0YA 1WX0A 1F4HA 1L6FA 3HQ1A 4RLIA 2EJ1A 4KRZA 2ZZ2A 4ZA0A 3FA5A 3EX2A 3SCOA 8RUCA 4ZTYA 4IL2A 1W9XA 1C29A 2IXUA 1GVOA 3BTNA 4QEEA 5FEPA 4HPHA 4GHRA 2I9UA 1UG6A 3NXLA 4WOQA 2H90A 1KM3A 4O11A 4EF9A 3ES7A 2WVVB 3PAOA 4DPQA 3TYUA 5I3DA 3M0VA 2PDNA 1G7UA 1TPWA 2HK1A 3PBUA 4D6EA 5CG0A 5FSEC 2G3NA 1UR3M 4AIOA 4XVEA 1W5MA 1JCXA 4JR5A 1Q6LA 2ZYFA 1XYMA 4M7TA 4B3KA 5LZLA 1QW7A 1LM1A 4DPPA 3HV9A 1GG0A 3TMQA 1XLAA 3HGRA 4FLQA 1XFCA 1YW1A 2YDQA 4JL1A 1OB0A 1LQ0A 1EF2A 4AMCA 4PCSA 1YIXA 3BAIA 4H8UA 4HA3A 3MWCA 1LQ2A 1U33A 1XICA 1EJWC 1ISWA 1HVQA 3KBVA 5I3KA 5AFDA 3TQVA 2VX7A 3M0HA 3W1MA 4IIEA 4CNUA 4CN6A 2NVCA 2VWTA 4Q8VA 3S47A 3KXQA 2WVSA 1P0KA 4H41A 2EBNA 2YCLA 4O53A 3NG3A 5C7HA 2DIJA 2QCDB 3KRUA 1I45A 4B90A 3MYOA 4LF1A 3LHTA 2YLAA 3FDGA 1Z6KA 4MJ2A 3E9AA 3UWVA 2FMOA 2VRJA 2ONEA 2QJHA 4W8AA 3JW7A 1VYSX 4U2YA 1XIEA 3UETA 2Z1KA 2YDRA 1TRIA 1XGEA 2FVKA 4IP7A 4WJEA 1O95A 3DOPA 3W38A 4QISA 3WBAA 1S1PA 1XLHA 3T07A 5I6SA 4AD5A 3BXWA 3MPGA 3NQFA 4HCHA 4UIOA 4BK9A 3KVMA 3G1HA 3GU2A 5K9DA 4E8GA 1S2TA 8XIMA 4UFHA 3THDA 4PB5A 3THUA 5FSDC 4J3VA 5HAOA 1EOKA 4GE8A 5XIMA 1YQ2A 4X61A 3ZT5A 2Y7DA 1S46A 1ZJIA 1PKYA 2Z1XA 3QZAA 5DBUA 5DY3A 2EPOA 4FK9A 4AZGA 3AXKA 4KESA 2Z27A 2QR6A 4GK8A 5GNYA 4QP0A 3RLUA 4QTGA 5A95A 1R7OA 5AC4A 3GY1A 3O7UA 5E6YA 2XGZA 3C3UA 3B03A 4J3UA 4GXMA 2WPGA 2IPJA 4AZCA 3CASA 3LNMA 3B05A 1CBGA 1VLWA 3BAJA 2PTDA 3KRSA 2HJPA 3KCOA 1J0HA 1XIGA 1J0KA 2ZFAA 1XH0A 4CCZA 3LV6A 1PZ2A 1K9TA 1V51A 1PZ3A 3NYDA 3BLPX 2P0OA 1R3YA 5HR7A 4HT3A 2BXVA 4HYWA 1DQXA 2QCCA 4ZBCA 4JFUA 4YJ5A 3WF0A 1MEHA 1WCGA 3E0VA 3MUCA 2ZE3A 2JIWA 3KOFA 3BGAA 2BLEA 5I23A 5HUOA 1PPIA 3G24A 4DO7A 1Q7MA 3EMZA 3TMLA 1AQMA 1PDYA 4U3CA 4ENLA 3PN8A 4NNAA 2BP1A 5LKYA 2PU1A 3UBPC 1M7XA 1E9YB 3TZFA