2DDXA

Crystal structure of beta-1,3-xylanase from vibrio sp. ax-4
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
324
structure length
324
Chain Sequence
b'LDGVLVPESGILVSVGQDVDSVNDYASALGTIPAGVTNYVGIVNLDGLNSDADAGAGRNNIAELANAYPTSALVVGVSMNGEVDAVASGRYNANIDTLLNTLAGYDRPVYLRWAYEVDGPWNGHSPSGIVTSFQYVHDRIIALGHQAKISLVWQVASYCPTPGGQLDQWWPGSEYVDWVGLSYFAPQDCNWDRVNEAAQFARSKGKPLFLNESTPQRYQVADLTYSADPAKGTNRQSKTSQQLWDEWFAPYFQFMSDNSDIVKGFTYINADWDSQWRWAAPYNEGYWGDSRVQANALIKSNWQQEIAKGQYINHSETLFETLGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-1,3-xylanase
molecule tags Hydrolase
source organism Vibrio sp.
publication title Atomic resolution analysis of beta-1,3-xylanase catalytic module from Vibrio sp. AX-4
rcsb
total genus 135
structure length 324
sequence length 324
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ddxA00
4XZBA 3TTSA 1XD1A 4J3TA 4RE2A 4LXFA 1JFXA 3VGBA 5CSYA 4UQAA 4AC1X 1OCQA 3MSDA 3K46A 3UG4A 3GDBA 3CUHA 1GQIA 2AMGA 2D0HA 2EPOA 4BA0A 1B3WA 3OBAA 4ZXOA 1BSIA 3WDIA 2YL6A 2XFYA 2YLAA 4D6EA 3EBVA 5FKYA 1F4HA 2YDQA 3VX1A 4LPCA 2XVGA 4UOJA 1VBRA 1XH0A 4MDOA 3PZOA 4P8WA 4WKAA 4GXPA 2BVYA 2GK1B 4HP5A 4HTYA 1B31A 2GDUA 2PWEA 3VNZA 1GHSA 4CU8A 1IZJA 1GHRA 1CLVA 3WH8A 1K9DA 3ZT7A 2PI6A 4HMEA 1H0IA 1J01A 3AS1A 3GXIA 3RCNA 3U5YA 3U57A 2DIJA 3S2CA 2D3NA 1ZL1A 5D9NA 1B30A 2DSZA 2VRJA 1TVPA 2J8FA 2D23A 1HKIA 2VI0A 4AISA 3CUJA 1BYAA 4J3WA 4E8CA 1R8LA 2ZXQA 3VD3A 1MXDA 1H2JA 3A47A 3BC9A 4D72A 3FXYA 1WKYA 2XPKA 5A6MA 3CHCA 4BF7A 1V6VA 3U7VA 3OLEA 4M81A 5D9MA 4PUDA 2XWDA 2BHYA 1J0JA 4EK7A 4CCDA 2ZXDA 4CN6A 4AZCA 2FGLA 5BWFA 1FHLA 3PHAA 3PZUA 1ZU8A 1HJSA 3PBGA 3SCRA 4OOZA 3VDHA 1V0NA 3L4XA 1HX0A 1MWOA 1TA3A 5HPCA 1VJSA 3D5HA 4IPLA 2FDMA 1H5VA 2EPKX 1NOUA 3UCQA 1QHOA 3UEQA 2EO7A 3W26A 1NWSA 4KGJA 3SCTA 2F8QA 3HU7A 1WDPA 2W61A 1HJVA 1PPIA 1TR1A 3BCDA 5CSUA 2WVVB 3RJYA 3A6OA 1JI2A 4ATWA 5D9OA 2YA2A 3WN6A 4MB5A 1Q6DA 3OLGA 3WDHA 1B2YA 4TXEA 1EDQA 2BY0A 3ZT6A 1WZLA 5AYIA 3WDJA 4JCLA 3AS0A 4TUFA 4P8XA 1HP4A 3WMCA 1GQJA 3CBWA 2XWEA 2WZEA 1V3MA 1D7FA 3SCSA 1UD6A 4DM1A 1UWQA 1HP5A 1EOMA 5BXPA 3M6DA 4OZOA 3A4AA 3CZLA 2GUYA 3AXHA 2WBGA 1FH7A 2VRQA 3ZIZA 3WIJA 1QVBA 1PBGA 4MTVA 1LJYA 1GVYA 1QI4A 1EA9C 1VRXA 3WDPP 1FP9A 1E6RA 3BAKA 4OIFA 5FL1A 5E09A 2YBUA 4ZE4A 1ODZA 3WEMA 1W2PA 3SUWA 2ZUWA 2WC3A 3BAIA 2ZX7A 2OYLA 2F2HA 3MSGA 5GNYA 1WE5A 4AZ5A 3WNNA 3SCOA 1W1YA 1G0CA 3O2LA 4PMQA 6TAAA 4LYQA 3GXFA 2ZUUA 4JFTA 3ARXA 1DHKA 1XYFA 1H11A 2PWHA 3CUIA 1EXPA 1CXFA 5A6BD 2EEXA 1XSKA 1CXIA 1UQZA 3VVGA 4FLRA 1Z32X 1MVYA 1JYXA 1SMAA 1E40A 4TVCA 4AWEA 2DGAA 3F5JA 1MQPA 4WKFA 1QNQA 2ZX9A 1JF5A 4MNMA 3W29A 2WMHA 1ITCA 1VIWA 4KH2A 3A3HA 2F61A 1U33A 4CCCA 3ARYA 3GNPA 4U3AA 3PZTA 1B3VA 1BQCA 3EMQA 1OGBA 2WZHA 1E6SM 2G3MA 1CGVA 5ABFA 4PMRA 3VINA 1UG6A 1QI2A 1K9FA 2XSBA 2CHOA 8CGTA 3ARWA 2WHMA 3MKKA 5C70A 1U30A 2VX5A 1W9XA 1HJUA 1X1NA 1EHNA 3VIIA 2ZOXA 1QOXA 2DT0A 3W81A 2WWDA 4KMQA 1E71M 2W91A 4QDMA 4AIOA 3WUBA 1C7SA 1E4NA 2CNCA 1QPKA 3FNDA 3MUIA 2CBJA 1Q6EA 4WLCA 1CBGA 2DQXA 1CXLA 3K8LA 4B9YA 1KWGA 2OSXA 3BAYA 3MUY1 1S46A 5IHRA 1VFMA 1VEPA 1AQ0A 3FHQA 4PRWA 2XYLA 3AZSA 1JZ8A 2ESCA 1UA3A 4HA1A 2XVKA 1MFVA 2X0HA 1G94A 1E5JA 8A3HA 3AHXA 4J27A 3MV01 6CGTA 2X09A 2G8ZA 4GI9A 3II1A 4W86A 1B0IA 1E55A 5CPSA 1C91A 1CGTA 2D0FA 1E4LA 1E0WA 3AHVA 2VZTA 4ZFMA 1YHTA 1QW8A 4PEEA 1UH3A 1B90A 4OKDA 1US2A 1XGZA 1E3XA 4RL3A 5LA1A 2CERA 1IT0A 1VEMA 1CNVA 1CGUA 5A6LA 4H8VA 5I3DA 2BVDA 4AZ7A 3T2QA 1BF2A 1PIFA 3OGVA 4PYSA 1JZ6A 2WCGA 3AISA 2J25A 3VPLA 4WSJA 1DWIM 1XH1A 3ZJ6A 1HF6A 4HA4A 2GFTA 1ISVA 4R27A 3SCVA 3UESA 4AD5A 2YL5A 2DT1A 3WEOA 3I3DA 1E73M 1JYNA 3VDBA 2CYGA 3M7SA 1EQCA 3VD5A 1CDGA 3EMCA 1GOIA 3BSGA 1ZBWA 2VT0A 2WHKA 1UR0A 3J7HA 5I5RA 1I75A 1GW1A 2D3LA 5M3WA 4AZIA 5IDIA 3CIVA 1ISZA 3PZGA 3KL5A 3W6LA 2GJXB 1TUXA 3IK2A 4DWSA 1KCKA 1E70M 4KRUA 1HN1A 4YPJA 4UQBA 1HKKA 1QHPA 1BAGA 3DC0A 2CPUA 4LX4A 4M24A 1M04A 1E5NA 2QPSA 4CD7A 1WAWA 4UTFA 2RGMA 1XD0A 2X0YA 1OT1A 4PTWA 2UY4A 4X0VA 3U5UA 2WCAA 1C92A 4NRSA 2XFRA 3A4XA 2WHLA 3WQ6A 3ARTA 3EMZA 1JZ5A 3UR8A 3ZJKA 4D6FA 1MW0A 2MANA 2UY3A 2WB5A 4FLSA 4HZ6A 4D6CA 1HJQA 5E70A 2OYMA 4GQQA 4W85A 3WF3A 2J78A 5TD4A 4FF5A 1V0MA 5C71A 3NCOA 3AICA 4DUVA 3GH4A 1XHGA 5EBAA 1XCWA 1XSJA 1DWHM 3PZQA 3WF2A 2FH8A 1UWSA 5I24A 2BXYA 3AZRA 1KGXA 1EDTA 4MAVA 4IUGA 4UZSA 2XUCA 3VIPA 3WQ8A 4AIUA 2YJQA 3K8MA 4IISA 2JEQA 3T0AA 3WNPA 2YOCA 4DWSB 3EYPA 1CGXA 2GJXA 4RE4A 1V6XA 2J7CA 3GXDA 2TAAA 1B3ZA 3FW6A 3GM8A 3ZR6A 2DH3A 2AOSA 5A6KA 5CQ1A 5AC4A 4IM4A 4AEFA 1V0KA 5IFPA 4UQEA 5A2AA 4EANA 1JL8A 4Z2LA 5A3HA 4GI8A 2VX7A 3CUGA 5HNNA 1BGGA 3WNKA 3N04A 3S6TA 2QHAA 2PBOA 1DWJM 1BYCA 4TOQA 1SYTA 2D20A 3ZSSA 2WSPA 2IUZA 1OSEA 1WNOA 1Q6CA 2G41A 3VD7A 3O9NA 3NSNA 4U3CA 1GONA 1UKSA 4V27A 1HKJA 1V0LA 2YA1A 3WENA 2D0GA 4PMUA 2G3IA 3OLIA 3W38A 3TTOA 1JDDA 2VRKA 4W7WA 1JD7A 2JIWA 4PTXA 2GDVA 1KXHA 1E6PA 2JE8A 2D22A 3LPFA 3RM9A 1KXTA 3WH5A 3PZMA 4GIAA 3RILA 3WBAA 2XHYA 1GOWA 3QR3A 4NSBA 4M80A 4CVUA 1BG9A 2XM2A 4Z2JA 2VC9A 3W37A 5DMYA 3AIEA 3ARUA 5DEZA 1JDAA 1VFUA 3ZJ8A 2XVPA 5IFTA 3LPGA 3PTKA 5BROA 1E4MM 3OLDA 3VGEA 2WKGA 1X6LA 3GYCA 1WDQA 4PN2A 4C7GA 2OLHA 1UKPA 1UQYA 5GPRA 5EFFA 2WHJA 1W1VA 4CKQA 1JZ2A 3MU7A 1V6WA 3THCA 1CTNA 1WB0A 2WWCA 2Q8XA 3BH4A 1HJXA 3QHMA 4GQRA 4MAZA 2YIHA 4UZUA 1W9PA 2XIIA 2D2OA 1MQQA 4JHZA 1UR8A 3WUGA 4HOXA 1MW3A 3PTMA 1W32A 4W93A 3SCQA 5JIPA 2YL8A 1JI1A 2WNWA 2WC4A 3IJ8A 1G5AA 2CEQA 4AXNA 3W25A 1JNDA 4HA3A 4B3LA 3U7BA 4JFSA 3HJEA 2J79A 5CXPA 4JAWA 3B9AA 3CMJA 2VZUA 4GO8A 3AYRA 4CUCA 5EMYA 2FHBA 2JALA 3KZSA 3THDA 3AIVA 1PX8A 1KBBA 3VU2A 4UFMA 4GZIA 2OSYA 3SUTA 3F5LA 5BXTA 1RP9A 2ZWZA 1KB3A 1QHZA 1RPKA 4OUEA 4HPGA 1V6UA 2DT2A 2D24A 3N17A 3FAWA 2YL9A 3W28A 1QNPA 4PCTA 1LL6A 1NARA 3PTQA 2X2YA 3NUKA 1EGZA 3OA5A 4B3KA 4TVUA 1BVZA 4OJYA 3AIRA 3VDAA 5BXRA 1KGWA 2CHNA 3B8SA 3ZQ9A 1RP8A 1H09A 2XJ7A 1W1PA 3W53A 1GZJA 1M7XA 3L4UA 4JKMA 4NF7A 1ZB5A 3NDYA 4XX6A 3WEZA 3WSUA 3APGA 2ZX5A 3VGFA 3IAQA 4GI6A 4M1RA 3N18A 1VF8A 2WYSA 4WK9A 4AZGA 2WMFA 3ZMRA 3L4YA 4M29A 2JFEX 3MO4A 5DO8A 1P6WA 1J9YA 3POHA 1UR2A 1W9BM 1CXHA 2YLLA 4U5KA 1UD2A 4NRRA 2XFFA 2VVSA 3VIMA 3K8KA 4X9YA 4MPKA 1FA2A 3L4WA 1PJ9A 1SR0A 1E43A 4M56A 5I2UA 1J0HA 4U33A 1VEOA 1ECEA 4OBSA 2WW5A 4W89A 2VZSA 1E0XA 1K9TA 2D1ZA 2PB1A 3LPPA 3AMDA 3VKKA 2W92A 5FD0A 1C8QA 4P8VA 1X6NA 2ZUTA 1KWKA 4DUWA 3D3AA 2WVVA 2DPEA 1OINA 1M01A 3CMGA 4B16A 3RDKA 3WH6A 1PAMA 3ECQA 1HNYA 4X0NA 1H0GA 2CETA 1D2KA 4WSKA 4KGLA 2J77A 4Z2IA 1FH8A 1W9UA 2Y2WA 4QLJA 1TA3B 4P7RA 1ZBVA 2VCCA 3EDEA 4QLKA 3N11A 2DH2A 3MV11 2Y24A 3VGDA 1G1YA 2GJPA 2NT1A 3G6MA 4QCEA 2X05A 1XC6A 4W5UA 4QLLA 3VMNA 1E15A 1KXVA 2WC7A 2CXGA 2W63A 3EDDA 3AI0A 1NOFA 4J3VA 4W87A 3WBEA 5ECUA 4AEEA 3RIKA 3OZPA 2RGLA 5E6ZA 1LQ0A 3AHZA 4Z2GA 5HBFA 2JF6A 1DEDA 1US3A 1ISXA 4UCFA 2PWFA 3CHDA 3JUGA 3BXWA 1E56A 2ZUVA 1TFVA 2YDSA 4DM2A 5CPQA 2ZE0A 2E9BA 4YHGA 4JFUA 2WMKA 3SCPA 2GJRA 4JHOA 3VMOA 4J3XA 4WJXA 2CITA 2VMFA 1V3IA 2BY2A 3KL0A 3PZVA 4A4AA 1A47A 4ZENA 2XSAA 4N42A 1WDSA 3K4AA 5A8MA 3ZOAA 2Y5EA 2C7FA 2GK1A 4JKLA 1L0PA 2VX4A 1W9VA 1QNSA 4UFJA 1OBAA 1I1WA 1WP6A 4JZ5A 4W7VA 3GNOA 1NP2A 2VNCA 1W3KA 3VGGA 4PMDA 3VO0A 4QP0A 5A94A 2DSKA 3HN3A 1E6QM 4GPNA 5AYBA 1EO7A 5CPTA 3WH7A 3TONA 5A1AA 4P7QA 4LQ1A 3RJXA 1GOOA 3ZJ7A 4F66A 2QV4A 3PN8A 4B15A 4JIEA 5A95A 1B3XA 2E40A 3UETA 5F7UA 2XG9A 4L4OA 2WBKA 2JIEA 2DEPA 2A3HA 3O6AA 1UWRA 2QLYA 1E6ZA 2DIEA 3M07A 4MDPA 1WDRA 5BRQA 5JUVA 3MS8A 1J0IA 1CECA 5CZKA 4F9JA 3UG3A 4E2OA 1KGUA 3OG2A 4JL1A 1TCMA 1BFNA 3ARPA 4R5EA 4W84A 2E9LA 3F4VA 4F8XA 3TA9A 1EOKA 2ZICA 1GJWA 2PWDA 2O9RA 5CGTA 2WZIA 5LA0A 1PEZA 2WAGA 3VD9A 4ZE5A 3PZ9A 2OYKA 1WO2A 4CCEA 3QOMA 2BHUA 3A4WA 2J62A 1V02E 2XM1A 3WNOA 1J10A 1OD8A 5GNXA 2WK2A 4ML4A 3SCWA 4PMVA 2W62A 1HIZA 1N82A 1EH9A 4NI3A 4W5ZA 5A8OA 1UKQA 2IXVA 1VENA 2V3GA 1Q4NX 2W5FA 4FLOA 3MUAA 4AD2A 2Z1SA 1XH2A 5HXMA 1UR1A 4TTUA 3VIJA 4D1IA 4PSPA 5JBFA 2VCBA 2CBIA 2WSKA 1PX3A 1W2VA 4JFVA 3WQ5A 1TMQA 4D6JA 3WELA 4ACZB 3BLPX 1JG9A 3AFBA 2ZXBA 3K4DA 1EO5A 4D71A 4UR9A 1HXJA 1DWFM 1KQZA 1ISYA 3SUUA 2VVNA 4BZYA 2EJ1A 3VILA 3FAXA 2HISA 4ZXLA 1PZ2A 1F4AA 2PF0A 2Y4SA 2W67A 5EB8A 2W4XA 1UWIA 3WQVA 4ATDA 1V3HA 4D6GA 1E9LA 2O92A 1OD0A 2V3FA 3T0DA 4JCMA 4MB3A 3SUVA 4H8HA 1QBAA 1J18A 2A3EA 4P7LA 2WVUA 1BYDA 2O9OA 1KFWA 3WF1A 2BXZA 4J3UA 4CU6A 3MMWA 2EPMX 4U2YA 4ACYA 3G6LA 4D1JA 4E8DA 4F9DA 3UERA 4C7DA 1MYRA 3ZM8A 1MXGA 5D8ZA 4FMVA 1IV8A 4W7UA 3KL3A 1L8NA 4XB3A 1GPFA 2PWGA 1E6XM 3AIUA 2CKSA 1HVXA 1UR4A 1UOKA 1VFOA 4CU7A 1JNEA 1LG2A 4D6HA 1V08A 3VTRA 5A8QA 3CO4A 2O9PA 1M03A 1VAHA 2BNJA 2J4GA 3IJ9A 3AMKA 3EDJA 2WCSA 4UFHA 2DSWA 4V2XA 4QCFA 4U2ZA 3VD4A 1R7OA 4GINA 2FHFA 4LYPA 1JYVA 1OT2A 5ABHA 3MUZ1 5D9PA 4XZWA 1BG4A 5A6SA 3LPOA 4MNLA 4HZ8A 3VIHA 4AYSA 3BMVA 4C7FA 1V6YA 5E6YA 2A3CA 1NWRA 3CUFA 3VX0A 1BVNP 2J47A 3CHFA 3MANA 5A6JA 2V3DA 1LL7A 3KEHA 5DT5A 1DTUA 1VFFA 2XVLA 1BTCA 3WNLA 3BCFA 1EHAA 5ABFB 2E0PA 5E9AA 1EDGA 1WPCA 4EE9A 2VL4A 5AY7A 1ESWA 1UR9A 1PIGA 4AZBA 2DT3A 5I23A 2J8GA 4CD4A 5I0DA 3SCUA 2EPNA 1GUVA 2E9MA 1LL4A 3NJ3A 3TOPA 3WMSA 4D6DA 5FL0A 1QBBA 3ZSTA 3WQ4A 1OGSA 4PTVA 5BCAA 3W27A 1TE1A 1VB9A 1MW2A 2J74A 1UH2A 1W3JA 4OBRA 1NM9A 1V03A 2WPGA 2ZUNA 3DYOA 3WFLA 2XTKA 1GQLA 4TX6A 1OIMA 4AD1A 3N13A 3NSMA 2ZX8A 3I3BA 3AOFA 1U2YA 4E4PA 3OIHA 4FLQA 3MMUA 4JKKA 3AQUA 1SMDA 5DF0A 1FOBA 4HU0A 3WF0A 1AVAA 2WANA 4DWSC 4N0RA 1W1TA 4AZ6A 1JXKA 4NZCA 1OB0A 4TVDA 1B9ZA 1DWAM 5M03A 1QI3A 3POCA 5EFDA 1ZBCA 4EKJA 2CESA 3EDFA 3L2MA 1V02A 2ZUSA 1FH9A 4EAMA 4UOZA 3WL1A 3IJ7A 1NOWA 1W9DM 5A6AA 4LGXA 3VDCA 2GSJA 1UWUA 1AQMA 3AYSA 4PSRA 4URIA 3LMYA 1HVQA 4AMCA 3W82A 1CGWA 4J7RA 3KE0A 5A8NA 2B31A 3IAPA 3WD4A 3VUPA 1GVIA 2XGBA 4HU8A 4KRTA 1JDCA 3GXMA 1VBUA 2VJXA 3ZT5A 5CG0A 7TAAA 4PMOA 5FIPA 2EQDA 3DHPA 3OZOA 2QPUA 3W4RA 4AW7A 4YN5A 5CLTA 4UQCA 1D3CA 2J7GA 1GNXA 1PZ3A 2G3NA 4ATLA 3AJ7A 1WZMA 2J7DA 1ZJBA 1NP0A 1MFUA 4J28A 1ITXA 2QMJA 5BYWA 1HT6A 5IHSA 5LYRA 5ABEA 2ZWYA 1AQHA 3RM4A 1C93A 3N1AA 4OOUA 4B9ZA 1M53A 1E3ZA 5FCZA 3L4TA 3GNRA 3W6MA 1KBKA 2FGZA 3QHOA 4UOQA 3CZGA 5DT7A 4Z2HA 1LWHA 2OSWA 4XUYA 3GZAA 7CGTA 1IZKA 2FHCA 4RE3A 5HDRA 2VURA 4Y7EA 1ZJAA 1JZ7A 3CPUA 3I3EA 4H41A 3AIWA 3WD2A 1GOMA 1H3GA 1JGIA 4L4PA 1DWGM 4AZCB 1CLXA 3WKZA 1FFRA 3CZJA 1H4PA 1QNOA 1MW1A 3WFZA 3OB8A 5KZ6A 3GH7A 1K9EA 2IXUA 1CENA 1LF1A 4Q22A 4D6IA 1ZS2A 5I77A 4UQ9A 1G01A 4PMXA 4Z2KA 1GJUA 3SEPA 4CN4A 1R85A 3M46A 1KR1A 2E8YA 2WVSA 3AHTA 5FOOA 1R86A 5M17A 3L4VA 4MNKA 3PZNA 1HL9A 1E0VA 3AXIA 2WMGA 2J7HA 4PUEA 4QAWA 4BQ4A 5DFAA 4GO9A 2VQUA 1WCGA 1HJWA 3WD1A 1UD3A 3RO8A 2E3ZA 2OWCA 3CGTA 3DECA 4CD8A 1HKMA 2Y8VA 5KEZA 1XV8A 1I1XA 3ARZA 1LG1A 4S3KA 1KXQA 1XRVA 2VR4A 2Z1KA 4A3YA 1RD6A 4AY1A 2VO5A 2BY1A 3VM5A 2VOTA 3IANA 2E8ZA 1JAKA 1E72M 2C0HA 2Y8KA 1BGAA 4U31A 1JF6A 1FHDA 3N9KA 3UR7A 3T09A 5LA2A 4MB4A 4QFUA 1KCLA 6A3HA 1LWJA 2AAAA 3SIMA 1BPLB 4AD4A 1UUQA 2JEPA 4F79A 2C8NA 3W0KA 2X8RA 4H7VA 1XYZA 2A3AA 1ZBKA 2FH6A 4JL2A 4M82A 2VX6A 1CGYA 2W66A 3T0BA 1B1YA 1MQRA 3QGVA 3CH9A 1QI5A 2WLYA 1CXEA 4PMZA 3VGHA 3F5KA 3HMCA 4BQ5A 7A3HA 3BGAA 3VNYA 1B3YA 2PC8A 3VIKA 1GORA 1J11A 1EQPA 1R7AA 5I79A 3WMBA 4HOZA 5C8BB 3SUSA 2G3JA 1FP8A 2WMIA 4FK9A 4GZEA 2ZX6A 1QI0A 4CVWA 4W88A 3ALGA 3ARRA 3NIYA 3NDZA 5I78A 3T2PA 4HOWA 1E1FA 1RH9A 1R87A 5JBDA 5M5DA 3WDQA 2VUYA 2ZXAA 2NSXA 4PCSA 5GNZA 1V3LA 1JIBA 4PMYA 2JF7A 5IXEA 3WF4A 4U5IA 1OGGA 4WKHA 3OGRA 2V5DA 2BY3A 3WD3A 1CXKA 4GKLA 3TP4A 3CZEA 3VIGA 1J0YA 1CIUA 1LLOA 1O6IA 1V3KA 5BRPA 3AMLA 3UG5A 2ZIDA 3VOCA 2CCRA 4IPNB 2CBVA 2J7FA 4AIEA 4BQ2A 3PZIA 2EXOA 3ARVA 2VCAA 4KWUA 2UWFA 1UD5A 2NT0A 3BLKA 1JXJA 2HVMA 1UYQA 1JZ3A 4UFIA 5GQBA 5CLWA 4MJ4A 4AD3A 2YA0A 4Q7NA 3BMWA 5AC5A 3VM7A 4M8UA 2O9TA 4MADA 3QOKA 4V28A 2XVNA 3VIOA 3SCNA 4MNJA 2A3BA 1KR0A 1UD8A 5D4YA 3L2LA 4H2CA 2CBUA 4P7NA 3WY1A 4BS0A 3AIBA 4TTGA 2XGIA 9CGTA 3EDKA 2PBGA 2XIBA 3AS3A 3ZR5A 2VR5A 4W8BA 3AHYA 1Q6GA 3WD0A 3CLWA 4PTMA 3BAXA 5A2BA 3WQWA 4YHEA 2J7BA 1C3FA 4H8UA 1EIBA 1J0ZA 3FN9A 5CJ5A 3GH5A 2V38A 4W8AA 3GBDA 1V3JA 1BYBA 3DYPA 1YQ2A 1AMYA 3ALFA 3GBEA 1QNRA 3MMDA 5ABGA 1Q6FA 1OIFA 2V3EA 1TZ7A 1H41A 3FY1A 5HPOA 1CEOA 2V5CA 2VZOA 3ZO9A 1UKTA 2WVTA 1WZKA 3GTNA 4BCEA 4LYRA 1W3LA 2CKRA 4AZHA 2NW0A 4MB1A 1JZ4A 1UHVA 3VIFA 2J75A 2BV9A 5JIWA 1H49A 2VQTA 4HMDA 1KQYA 3ARQA 2YBTA 3N12A 1J0KA 3E1F1 1NH6A 1CWYA 4HZ7A 2EPLX 2WKLA 1C7TA 3CTTA 3OGSA 2WLZA 1E1EA 1JAEA 5A8PA 3WH9A 4P8UA 1FFQA 1VJZA 3AMGA 1UD4A 2OWWA 3AMCA 2WXDM 2G4FA 1GQKA 1OM0A 3RM8A 3CHEA 1E4IA 2CIPA 4CGTA 4J3SA 3RPMA 3T08A 3TTQA 3BSHA 1NWTA 3B9EA 1GOQA 1C8XA 4A3HA 3TTYA 2UY2A 2WM0A 1JYWA 1C8YA 3AZTA 1UWTA 1O7AA 1ISWA 3KWXA 3RMEA 1ODUA 3DYMA 1H1NA 4K68A 1NQ6A 4DWSD 3WUFA 1CYGA 1TVNA 1E6NA 2BFGA 2GVYA 4CD5A 4ACZA 4CN1A 4HPHA 1A3HA 3BAWA 4GZJA 4UFLA 2EBNA 2BVTA 3CZ8A 2DSVA 4JFWA 2DSUA 1JD9A 3ARSA 1XCXA 3AIQA 1WZAA 2DDXA 4H04A 4PBGA 1UH4A 1BHGA 2UY5A 2OWXA 1UZ4A 2QF8A 1GCYA 1W3HA 5JBEA 1C90A 2YDRA 4XV0A 2J7EA 1DP0A 3WDRA 4ZEPA 3QHNA 1W91A 3BAJA 2BS9A 4W8LA 1TG7A 3DHUA 3WNMA 5CGMA 2BHZA 1OWQA 4AD0A 4WF7A 3L4ZA 5A6BA 1BLIA 1SFSA 3CZKA 5BXSA 5D8WA 1HL8A 4PMNA 1J12A 3B9DA 2QMKA 3K1DA 1PX4A 3AROA 4CD6A 4P7OA 3AXXA 4UQDA 2VZVA 1CPUA 4S3JA 1K6AA 1G9HA 1Y7VA 1GOKA 2ZUMA 4TX8A 1NWUA 1UKOA 2WMIB 3T2OA 5E0FA 5HOSA 3WUEA 4MJ2A 2WMJA 1UA7A 5I6SA 5A2CA 1UZ1A 2E4TA 3AS2A 3VMPA 3WL0A 5A69A 2VTFA 5E0CA 4UFKA 3FHAA 3N15A 1XSIA 3NYDA 4WIWA 3SURA 4HMCA 3NSXA 1JFHA 4DUXA 1QW9A 2YKKA 1CZ1A 4BQ3A 2X1IA 4UNIA 3W24A
chains in the Genus database with same CATH superfamily
1PL9A 4B2DD 3G18A 1KM5A 1XD1A 4L64A 4J3TA 1LOLA 1K7FA 2Z29A 4AC1X 5CBIA 1AK5A 4DNHA 4N4PA 4C6FA 4HD5A 2QCHA 1XBYA 5F2MA 3CUHA 1GQIA 2AMGA 3O15A 1B3WA 4ZXOA 1ZTVA 2MNRA 2DV0A 4D6EA 2X1TA 2ON3A 4ZGYA 6REQA 1OC6A 4GIYA 2E6DA 3W7DA 3UT0A 1VBRA 1XH0A 1IR2A 2BVYA 2GK1B 4QDPA 1PYMA 4DF2A 1SZRA 4JTRA 2OLAA 2GDUA 3EB2A 1GT8A 1CLVA 3EX2A 3ZVIA 3DGBA 2HSAA 3GK0A 3P74A 3DCPA 4QG8A 4O1CA 4BWLC 3W1LA 2VP8A 3U57A 1QASA 1TVPA 1W31A 4PULA 3DBNA 4AISA 1BYAA 1LQAA 3H12A 4E38A 4S3EA 4E8CA 2I5QA 1IEQA 1T40A 4D72A 3FXYA 5A6MA 5D9MA 1G4SA 1Z48A 1NIUA 3HPXA 2BHYA 2OX4A 3M0YA 3AU6A 2ZRYA 1GWJA 1J0JA 5TIMA 3NQVA 4O12A 2I5IA 4AZCA 4ZA0A 4NI8A 1H7OA 1FHLA 2E5BA 3PZUA 1ZU8A 2PDXA 5CPNA 5J04A 3PBGA 4Z0JA 1QRQA 4YCPA 2DP3A 4Z1YA 1V0NA 1XL9A 5HPCA 1MZRA 2YZ5A 3KZPA 2OOFA 1QHOA 9RUBA 1NWSA 4R7JA 3R79A 3KDOA 2Z26A 1JGMA 1T99A 5HNUA 5IDZA 3NO5A 1HJVA 2EPHA 3GNDA 3BCDA 2WVVB 4EPEC 1G7UA 4E8GA 4ATWA 4WDUA 1FVPA 2YA2A 4QS6A 3FX4A 4MB5A 3RXZA 1DIKA 3PANA 4HK6A 3N6JA 2QV5A 4TXEA 1AL8A 1EDQA 2BY0A 3FYOA 4WSHA 3AS0A 2XN0A 4TUFA 4P8XA 1GQJA 3CBWA 2XWEA 3CAWA 1D7FA 4XZNX 1E1CB 4IQEA 1UD6A 3EA3A 3UVIA 1WAUA 1EIXA 4FXSA 2PMQA 4NZFA 2C19A 3LHTA 3GG0A 5AYZA 3TCSA 2GUYA 5C2XA 3CPRA 4Z1DA 3FLUA 1QVBA 4FS9A 3KRUA 4QG9A 1GVYA 4ALDA 1FP9A 1AH0A 2QYGA 3QV6A 3LENA 1OVDA 5E09A 3HGRA 4ZE4A 2B7NA 3GXTA 1XM3A 2ZX7A 3MSGA 1WE5A 4LBSA 1DVJA 2INEA 5K3VA 1K6WA 3WLNA 2D73A 3M5VA 1EGVA 3GXFA 4JFTA 4AWUA 1DHKA 2HPIA 1EP1A 1XYFA 3RPTA 4O8AA 1TKKA 1XP3A 1EXPA 5A6BD 2EEXA 2L5HA 4NX0A 1Z32X 1A0DA 1TIMA 2ACQA 4AQLA 4TV6A 4IIGA 3NQEA 2ZX9A 1X1ZA 1ITCA 4Z0SA 1VIWA 4ZO6A 3L0KA 4U3AA 3PZTA 1ICSA 1XYLA 3EPMA 1ZALA 2G3MA 1CGVA 1ZJIA 5ABFA 3TYBA 1QCWA 1FKWA 3VINA 4PTDA 1E9ZB 2VEKA 3MKKA 4LAMA 1U30A 2VX5A 4BK9A 4K8GA 3N25A 1P48A 3H4XA 3CL8A 2ZOXA 4DWDA 2DT0A 3W81A 4QDMA 4Q6XA 3WUBA 5TBOA 1E4NA 2CNCA 3FNDA 3S1WA 4WLCA 3NVDA 1KWGA 2FZMA 2CLIA 2OSXA 1UMLA 5IHRA 1VEPA 4ZO8A 5LNWA 1Y5VA 4RV8A 4PGLA 5I3IA 1QPNA 3DIPA 1V51A 4RNHA 5LNVA 2X0HA 3WJWA 4AX7A 2OT0A 3KOYA 1Y0EA 5I3FA 1B0IA 3ICJA 3RK8A 2D0FA 4LUSB 1E0WA 4NJGA 2VZTA 3B8VA 3KRBA 1QW8A 1NF0A 5BMXA 2ASHA 2YYTA 1ALDA 3KVJA 4NAEA 3QQ1A 5I00A 3L0GA 1E3XA 4KT2A 2NVCA 3MW7A 5I3DA 4IL0A 1RCQA 3XINA 4IH3A 3ITVA 4ZTYA 2H9AB 1VPQA 4Q8TA 2HDJA 5CJMA 4H6RA 1XH1A 2A7RA 2TRSA 4D9PA 1AL7A 1HF6A 4HA4A 4IFKA 4PA8A 2QT3A 1XBVA 3DXIA 4NZ5A 3I3DA 2E6AA 3W1QA 1GK8A 4XVDA 2RDWA 2CYGA 5K7JA 4YYFA 3C2VA 3K13A 1CDGA 4JYDA 1T8XA 3EWCA 1UR0A 5KITA 4O16A 2IQ0A 1JCXA 3CIVA 1ISZA 3HG3A 2IKIA 3TZFA 1TUXA 3IK2A 4NG3A 3C86A 1UASA 3MY9A 1HKKA 4Q8OA 4HHLA 4KESA 3FEMA 3G0SA 5AHIA 2WCAA 1O66A 1C92A 4DXXA 1XC4A 1NDZA 5HANA 3EMZA 3TYZA 4HPNA 3ZJKA 4JTQA 1HJQA 5E0KA 2OYMA 2REQB 3R0DA 4FF5A 1D9EA 5C71A 1R2RA 3M41A 3QSTA 3BICA 4DUVA 3ZZ1A 3R58A 3NQMA 3TFCA 3VCRA 1DWHM 4AHQA 3TH6A 4QJ1A 1JDFA 2IW0A 4XAGA 2FZ8A 1EDTA 3C0LA 5MF5A 5HR6A 3BK0A 4QNWA 3WQ8A 2P3EA 4B91A 5AHNA 2Y70A 3K8MA 4B2DA 1GJPA 5LXXA 1FBAA 3P62A 4R9OA 1V6XA 2AQVA 4ILSA 1DHPA 4KEVA 1PWLA 3T4WA 1B3ZA 2ANUA 3GM8A 1VGAA 1XIMA 1OFDA 5CQ1A 3HPSA 4IM4A 4AEFA 1RD5A 4IG2B 2V63A 4FNPA 4HYVA 4C1LA 4CQAA 5A2AA 4Z2LA 1JL8A 3KOFA 4LYKA 2C71A 4L65A 3THAA 1B4KA 2FPVA 2ZZ5A 4LF2A 3VNKA 1AG1O 1YNQA 4EACA 3O0KA 2WSPA 4E3TA 1OSEA 1WNOA 1Q6CA 1WX0A 1SW0A 4GBDA 2G50A 4U3CA 3O9NA 1UKSA 1KW1A 1HKJA 1V0LA 4M6PA 3WENA 4R85A 1RQHA 1P0BA 2G3IA 3MCOA 3W38A 3TTOA 2AAMA 4TV5A 1JD7A 2JIWA 4PTXA 4FOUA 4XD6A 1KXHA 4G7FA 1E6PA 3PZMA 1XR2A 3W1AA 4GIAA 3SFWA 3RILA 3B0YA 2IPWA 2XHYA 4IX2A 1GOWA 3QR3A 4CVUA 1BG9A 1J79A 4Z2JA 1XICA 3MHGA 3ARUA 1A49A 3CASA 4IFOA 3PUDA 1A5AA 4HK5A 2BVWA 1TV2A 4C7GA 1SO4A 1RLDA 5EFFA 3G1FA 4AWTA 1RR2A 2QZRA 1V6WA 1CTNA 1WB0A 1XIFA 2Q8XA 3XISA 4GQRA 4KCWA 3TYEA 1LDCA 4UZUA 2D2OA 1I4NA 4GD0A 1YTDA 2HXUA 3WUGA 1GG0A 3PTMA 3SCQA 5JIPA 3LERA 3GC5A 3ISIX 1JCLA 4DF0A 1VBHA 3WLHA 1BXBA 3WZ0E 2WNWA 2P53A 2BX7A 4JX4A 2NXGA 3TYCA 1V79A 4E2DA 3QY8A 5J5DA 2I1OA 3M5ZA 4JAWA 2WNZA 3B8TA 3GVQA 1C9DA 3EWZA 3N2MA 2NQ5A 2VZUA 2HMCA 2FHBA 1LP6A 3THDA 3SB0A 4HKPA 1TQXA 3SM0A 1SJDA 2OQYA 1G7VA 3SUTA 3F5LA 2HBXA 4BF9A 4GCAA 4OUEA 2SFPA 4HPGA 2DT2A 3N17A 3A21A 2Q09A 3FAWA 2WSQA 5IOBA 2YCJA 2Y8UA 3NUKA 4H9YA 4B3KA 2H8ZA 2JK2A 2PP1A 2WOQA 3AIRA 4IF2A 5BXRA 3M64A 1Q7ZA 4TR9A 3B8SA 1SZGA 4MWAE 4U28A 1TCDA 1W1PA 3MP5A 1GZJA 4CLMA 5E1QA 1KM6A 3GR4A 4NF7A 3NDYA 1G69A 2PP3A 1RCOB 3L5AA 2V67A 4L7ZA 3LOTA 3UWVA 3ZMRA 3L4YA 2JFEX 1IZCA 3MO4A 1P6WA 1J9YA 2FLIA 3POHA 4ZVJA 1L8PA 1W9BM 4HA0A 4K7YA 4U5KA 1S39A 3BE7A 3P6LA 3S6OA 2TODA 4X9YA 4MPKA 3DU0A 4WVXA 3VC6A 4G7EA 5K4ZA 4O1AA 2X7VA 2X1SA 2NX9A 4UTHA 1MUWA 1J0HA 1VD6A 1GYMA 2ZADA 1TE6A 3LX9A 4HN8A 3APTA 2ZYFA 2O0TA 1K9TA 3IGHX 1XLKA 5EYWA 4MUZA 3AMDA 3VKKA 5FD0A 1C8QA 5D2YA 2ZUTA 1RCXB 4DUWA 4WY0F 4S3GA 1H1ZA 3DENA 3ID7A 3TXZA 4B16A 3NEVA 3RDKA 1HNYA 4YTQA 1H0GA 3I7SA 2J77A 3W84A 3NQ6A 4LV9A 4H3DA 3V7PA 4IIEA 1TPH1 3ABOA 1TA3B 1ZBVA 3NXFA 3PBVA 3EWBX 1J5TA 2VCCA 1U5JA 4QLKA 2H6RA 3FOKA 4JOMA 3IV3A 4JYEA 1MUMA 3SY5A 4R9XA 3BARA 4JTSA 5AVNA 2EKGA 3URQA 4GY0A 5CBBA 4W5UA 2W27A 5EU9A 3SSZA 2WC7A 3EDDA 1VKFA 3WBEA 4ZFCA 1AD4A 3RIKA 3CUXA 2OPJA 4LB4A 1ISXA 3KTCA 4C65A 3LXBA 4I90A 5G2WA 3JUGA 4NNAA 1E56A 1I45A 2C1IA 2ZUVA 4UTJA 5EKYA 1GZ1A 2PTXA 3SGUA 1BKSA 1XIIA 3C52A 4DM2A 3P8JA 1U1JA 4DYJA 2ZE0A 3WBYA 3IVUA 1WDDA 3SRKA 2WMKA 3ZXWA 1DV7A 1A5BA 3VMOA 4WJXA 1V3IA 3QPZA 1EUAA 2BY2A 2XIMA 2XZ9A 2V81A 4A4AA 4HYWA 2EHHA 3W2MA 4FNUA 2PWVA 1Z44A 3TQVA 2PDGA 3ZLGA 1OFRA 4Q4OA 3IIZA 4OU1A 3W7IA 2VX4A 1QNSA 4N9EA 5FEXA 1I1WA 3OP2A 3N2TA 3R5EA 2GGIA 4EIVA 3KS5A 4TMCA 3R13A 1VFSA 5I3GA 5B7YA 1X1OA 3A23A 5FAJA 3MI2A 3M7WA 4MYXA 2I56A 2JKPA 3U3HA 3DDMA 1GOOA 4K1WA 3ZJ7A 4GX8A 4CNOA 3EOOA 2OTDA 4FAMA 1XQLA 3PN8A 3LD5A 3DESA 3WCZA 3BLOA 3W7HA 2JIEA 3O6AA 4IGHA 1UWRA 1E6ZA 2A79A 1KV5A 1KTBA 1LT7A 1I2NA 3KCJA 4XISA 3OVGA 3EWDA 1CECA 5CZKA 2C6QA 3HPZA 4XZMX 2VFEA 3CEUA 1OJXA 3OG2A 3EX6A 2B7PA 2PDKA 4W84A 4F8XA 3RLUA 4HNLA 2ZVIA 1GJWA 3UCDA 3NL2A 2OYKA 1UP0A 3MHUA 2VFFA 4XBKA 1OD8A 5G1YA 4CNSA 4DBUA 1N55A 3N73A 2F9RA 3R4IA 5BWAA 4W5ZA 5LNRA 4C1NB 3G5EA 1VENA 1T7LA 4LAKA 1S5TA 4A8RA 1AQFA 3N34A 3ERPA 4LB3A 1UR1A 4D1IA 2VCBA 1ZAJA 3HB9A 2CBIA 1PX3A 1Z42A 1W2VA 2R8WA 3LRLA 3WELA 2HE5A 5AYYA 2QCEA 1O5XA 5SWUA 1GVOA 3MDWA 2Z2BA 3H2NA 1ISYA 3SUUA 2EJ1A 3BW4A 3T0CA 2Y4SA 5BZAA 5D32A 1V3HA 4GMEA 4EPDC 4DUOA 1XIDA 2V3FA 4XG1A 2DZVA 2ZZ4A 3WLJA 1QBAA 4RR4A 1J18A 4P7LA 4B5NA 2PAJA 2IKJA 1BYDA 2O9OA 3I65A 5CAHA 4CU6A 4O18A 4L9ZA 4YYCA 3G6LA 2HCVA 3T0TA 3VOGA 1XLEA 2A7NA 5TNVA 4K1GA 5LHEA 1MYRA 4I6KA 1MXGA 1DORA 3DG7A 4PB3A 1B9BA 4Y9OA 4W7UA 3NVTA 1JDEA 3QYQA 4B5TA 7REQB 2OG9A 3FJNA 2PSNA 1EXBA 2X7WA 2XH2A 3NQAA 1LG2A 4D6HA 2J6VA 4K7VA 3W7NA 3CO4A 3W01A 1M03A 3G3MA 2FTWA 5H8MA 1IEXA 1IQ8A 3BW2A 3EDJA 3NZQA 3V1PA 5GVJA 4EXQA 1QPRA 2DSWA 5DXXA 4WCJA 3NO3A 3VD4A 1A80A 2YZRA 1JUEA 4WUIA 2QJHA 2CLFA 3FVDA 5A6SA 2RDUA 5AECA 3KUMA 1IE7C 3GFXA 1TREA 3TWAA 3EWYA 1SM9A 2B4GA 3P60A 2PTZA 1O5RA 2J47A 2Y7GA 3RNDA 3KEHA 4YWIA 3VI2A 1BTCA 3E5PA 1I6NA 3BCFA 1EHAA 2AGKA 3T8LA 5E9AA 2AL2A 3LZ3A 4LBRA 3VNLA 1UR9A 2EAWA 5CJNA 2DT3A 5I23A 3OQEA 3O6YX 3RLVA 3NNTA 2QF7A 3WMSA 5FL0A 3LM3A 3ZSTA 2VM8A 2R14A 4PTVA 5HMEA 3W27A 5BCAA 4WJ8A 1TE1A 1VB9A 1MW2A 3VE9A 1W3JA 4OVXA 4OBRA 4GGHA 4O0QA 2WPGA 2ZUNA 3RR1A 1REQA 3MSRA 1PO9A 4AB4A 1W3IA 3TROA 3N13A 1ZUAX 2ZX8A 4QEHA 2VFIA 3OIHA 1XKJA 4R3UA 3QJAA 5DF0A 1FOBA 4HU0A 4DWSC 4N0RA 5HQEA 2I17A 1OB0A 1QI3A 3LGGA 5EFDA 2CESA 1AJ2A 2ZUSA 3PUGA 1FH9A 1FXQA 4EAMA 1W9DM 5A6AA 1VH7A 4WY0B 1Q13A 2QJGA 5JU6A 4J7RA 3KE0A 5A8NA 2B31A 3BW3A 2QDGA 4KRTA 3UA4A 3EAUA 1IEIA 4FEZA 2UV8G 3ZT5A 4PMOA 5FIPA 3TQKA 5FSDC 2EQDA 3DHPA 4AW7A 2PLJA 4YN5A 4C6KA 2OX1A 1F8MA 4UQCA 4LEQA 2G3NA 2BGSA 2J7DA 1NP0A 1MFUA 5BOEA 3SN4A 4JTAA 3PSWA 5BYWA 4JTDA 2F6XA 5ABEA 4L6DA 5FESA 4PCNA 4EXAA 4HNVA 5B80A 1AQHA 1QOQA 3URAA 1TIWA 2NSOA 5AHEA 1SW3A 1C93A 2EGZA 2IQDA 1CB2A 1LORA 3L4TA 3W6MA 1QWGA 3CZGA 4DJDA 1A5OC 1QAPA 1E9IA 3GZAA 1GGOA 4OTKA 1IZKA 2FHCA 1DBTA 1ZJAA 2YCKX 3CPUA 4UR8A 4H41A 1TPVA 3SZ8A 1RJQA 1GOMA 1JGIA 3OHMB 4X61A 4H00A 6PTDA 2GDQA 2CLPA 3W1MA 1TTPA 4IMCA 1MW1A 1UP2A 3B8UA 3UWYA 4OT7A 3OB8A 3BLDA 2IXUA 4JIRA 1CENA 1HO1A 4GYPC 2ZRWA 1VYRA 3UW6A 4UQ9A 5LNUA 4LVDA 1GG1A 3E0VA 3DHFA 4CN4A 1R85A 3M46A 4ZQPA 5M17A 2YYUA 3PZNA 1CI1A 1HL9A 4EWJA 3AXIA 2PDNA 4XK2A 4JPGA 3CIWA 2FZBA 5DFAA 3G1AA 2VQUA 1HJWA 1UD3A 3MZNA 1H5YA 3CTLA 5EMLA 3GVWA 3P2VA 4Z42C 3ITLA 3LG3A 3FA3A 4S1FA 2PDWA 5EY5A 4FA3A 4BFAA 3C56A 1S2AA 4MMWA 1XRVA 1QK0A 1QPQA 2VR4A 3RGTA 2Z1KA 3KTSA 1FCVA 4F2TA 3VM5A 3LUTA 2PGRA 3CQ0A 1E72M 3ONBA 2Z2UA 2Y8KA 3RR4A 1IT7A 4U31A 1JJKA 1FHVA 4GNKB 1ADDA 1IEWA 2V8ZA 1PXGA 1XFBA 3KVKA 3W7CA 2ZDSA 2PDYA 1BPLB 4XAYA 2JEPA 2C8NA 5D33A 3W7RA 3VA8A 1XYZA 2TYSA 2FH6A 4JL2A 5A5WA 3GO2A 4LAUA 1KM2A 4LUJA 1W8GA 3BDKA 2W66A 3PPHA 4NZJA 1M9HA 2WLYA 2PDLA 4QJ3B 1AA1B 1AJ0A 4FXJA 1EJ7L 3TN4A 3B3DA 1J11A 4WY0A 1NDWA 4FHAA 4HOZA 1BXNA 1PTDA 1FP8A 2WMIA 3CQIA 3IVTA 2GVLA 4CQDA 4KEMA 4FK9A 3AJXA 3W1UA 4IP5A 5F4SA 2ZX6A 3A9IA 1QI0A 4W88A 3LBMA 2NLYA 3ARRA 3NDZA 3NIYA 5I78A 4HOWA 1A0EA 3SFKA 3T05A 1XRSA 3WDQA 2ZXAA 4PMYA 4Z17A 3WF4A 5HWNA 3A5FA 2BY3A 4A8LA 3IACA 2WNQA 5D30A 3VIGA 3KM8A 1J0YA 1REQB 4Y8EA 5EMJA 1D7KA 2ZIDA 1BQGA 3H7VA 3IIPA 3H2MA 4IPNB 3LCWA 1PDYA 1AMKA 2ZZ7A 1AD1A 1JRCA 2QAFA 3WMLA 2VCAA 4KWUA 2UWFA 5FEWA 3LHWA 3GZ3A 3QMTA 3I4KA 1JXJA 1IGWA 5H8UA 2P8CA 1ZP3A 1YKWA 5GQBA 2DZPA 4H7ZA 2YA0A 5AC5A 2PDBA 2O9TA 4L9XA 4Q4QA 4A22A 3VIOA 1FWDC 2AL2B 3C6CA 2J9YA 2CBUA 4P7NA 4QRNA 3WY1A 3CUZA 6XIAA 1TWSA 1Q63A 1GOXA 5MHBA 4NX5A 2VR5A 1M7PA 4DO7A 1OG6A 2YXGA 4PRTA 2OO6A 5A2BA 4HNTA 1JQVA 4YHEA 3MC5A 1DJXA 4H8UA 4N9CA 1J0ZA 2PTYA 1BWVA 2VEGA 4L1GA 3GBDA 3BUVA 1OY0A 3MI6A 1YQ2A 3HPFA 3R12A 5E9XA 1OIFA 2V3EA 1H41A 1D3GA 4MYAA 3UWWA 5HPOA 1CEOA 5LIUX 1UKTA 1R3QA 3ZFHA 4XAPA 4BCEA 3HIJA 3LY0A 2QUUA 3V3WA 2NW0A 3F2DA 3F4CA 4L1WA 2V68A 2QDHA 5E5CA 1H49A 2VQTA 1KQYA 3T9PA 4IQLA 1J0KA 4XAFA 4PUNA 3DG6A 1UC5A 1C7TA 1FKXA 1E1EA 3WH9A 2NV9A 1A53A 3M0HA 1A0CA 3L0NA 4G9PA 4AFYA 2QIIA 2WXDM 1Z41A 3QPEA 4B4HA 4C6DA 1OM0A 3RM8A 2I16A 1FWCC 2YFOA 2OGYA 5FF3A 4EPKA 3N6HA 4WGXA 4WEVX 4YMZA 4WXYA 1R9ZA 3TTYA 2E67A 1C8YA 3DFOA 3CXOA 1ISWA 3RMEA 3DYMA 2IMRA 3CM4A 3WUFA 3W00A 1TVNA 4NXSA 1UC4A 4Q32A 4CD5A 4HPHA 1KFKA 3TU9A 4GZJA 2DSVA 4JFWA 1H50A 3UZWA 1PE1A 3H22A 4H04A 3ZR4A 1BHGA 3S5ZA 5GJMA 3F2BA 1TWIA 1W3HA 3NPWA 1H7WA 3QHNA 1XIEA 4KS0A 3QZEA 5D2XA 2R91A 3NQFA 4A35A 1K1DA 3G1HA 1J2BA 5CGMA 1ONEA 1F73A 1JPKA 2RAGA 1PB0A 5BXSA 2X1RA 3F2CA 4N2YA 1GVFA 3PF3A 1HL8A 4RPQA 3K1DA 3AROA 4P7OA 3BURA 1XLLA 1UKOA 3VNMA 2WMIB 5HOSA 4O19A 1I2PA 2RDTA 4E4UA 5A2CA 1POJA 3AS2A 2FB2A 3VMPA 4J35A 1OADA 3W74A 3WL0A 1XSIA 3ITXA 3H4WA 1JFHA 3SN1A 1KRAC 3FKKA 1QW9A 3C61A 3FFSA 4BQ3A 3TR2A 3G1VA 4F0SA 3WQGA 1ZY9A 3VKCA 4O4VA 4RE2A 3B9OA 3D47A 4HNOA 5CSYA 1DQXA 1S2WA 1WYIA 5BMWA 4O1DA 3QGAC 2D0HA 3UJFA 3OBAA 4KW2A 1BSIA 3WDIA 2XFYA 4FF7A 3Q94A 2YDQA 1QNVA 1NY1A 5FACA 1RHCA 4ZO7A 2GUUA 4EF8A 1MNSA 5LGZA 3RU8X 2B7OA 4GXPA 4GIRA 4HTYA 2INFA 1B31A 1EZ2A 4HBKA 8TIMA 1EGMA 4GLEA 1XLIA 1K8XA 4Z1BA 3ZT7A 1UWAA 2E25A 1R3TA 2PI6A 4HMEA 3OO2A 1J01A 3E2VA 4DO5A 2P88A 5CSRA 1R2SA 2D3NA 1ZL1A 2DSZA 2BB0A 3G0UA 3R10A 1HKIA 2VI0A 2BTMA 3CUJA 1QO2A 3VNDA 4UTWA 3KW3A 4UWMA 4J3WA 2E6FA 2WSYA 1R8LA 2ZXQA 1H2JA 1XDJA 1WKYA 3A22A 2PEVA 2XPKA 1HFBA 4LWWA 3U7VA 1G4TA 4X3ZA 4XAZA 5G2HA 4JQ1A 2ZXDA 2DJLA 4NT0A 3PHAA 2GGJA 1UJPA 1HJSA 3SCRA 4G56A 1TA3A 2BGNE 1IT8A 1H5VA 4QE5A 3UA3A 1GZGA 2EPKX 3UCQA 3UEQA 4NVTA 3SR7A 4KWOA 3M0ZA 2Z7KA 3HU7A 3VCCA 1WDPA 2W61A 4LCSA 1JCJA 4S3BA 3RJYA 5CC5A 4GVIA 1J4EA 1OX6A 3D3FA 3WN6A 5C5YA 3WDHA 3NXLA 1Q6LA 1B2YA 3EX4A 1O5QA 3ZT6A 1WZLA 3GU9A 1HP4A 2P10A 1V3MA 3G0XA 4RDYA 4E6MA 3E3HA 4AVFA 5A6TC 3PS7A 4CNUA 4A6GA 5BXPA 1KLYA 1R9YA 3TNBA 4U10A 5CZSA 3O1NA 1DTNA 5H91A 4OZOA 3A4AA 4YTRA 2OFJA 3NL3A 1DJWA 3NL6A 2WBGA 1FH7A 1TPUA 1H1YA 5DMLA 5EMKA 3WIJA 3N2BA 1PBGA 1IHIA 1QI4A 3HV8A 4H9UA 4B90A 3W9ZA 1Y65A 3BPWA 3MBFA 1QK2A 3BAKA 4GACA 4WRHA 3ZWSA 1TELA 3STEA 2YBUA 3QEZA 1ODZA 2FFCA 5KTLA 4AH7A 2F2HA 3C2YA 2P76A 3WNNA 4PMQA 1R0MA 1VFLA 3HV9A 2PWHA 2XGZA 1X98A 4NIRA 1CXIA 3LRKA 3VVGA 3BVJA 3OBEA 2DQWA 3RX3A 1JYXA 3QZAA 5F2GA 1SMAA 3CHVA 4RCXA 4AWEA 3OODA 1SJCA 3V4BA 2WMHA 1W3NA 3I7RA 2G37A 4FX8A 1U33A 4CCCA 3GU2A 2GWGA 4M19A 1B3VA 2X16A 4K39A 1BQCA 3EMQA 1OGBA 2WZHA 1E6SM 4PMRA 3KAOA 4NU7A 1UG6A 1QI2A 2E1DA 2DVTA 3CV6A 8CGTA 1O5KA 3PPCA 5C70A 1MRQA 1W9XA 1MNZA 1QATA 1CLKA 1X1NA 4HYRA 2BZNA 4RLIA 4MZ8A 4KMQA 3L66A 1E71M 2J88A 5HNTA 5FJOA 1QPKA 1QFEA 3MMTA 2CBJA 1Q6EA 4JY9A 3N9RA 3BAYA 3MUY1 1S46A 2JQXA 4KFOA 4IQJA 1B57A 3SDOA 3VKAA 4FP1A 4OBTA 4PRWA 4AY8A 3AZSA 4DJEC 3VYLA 2NXIA 2ESCA 3TCEA 4HNCA 2X42A 4IIDA 2XVKA 1VYPX 5H2ZA 4H8NA 4QJ5B 1MFVA 8A3HA 1G94A 4B92A 4J27A 6CGTA 4MLRA 7REQA 4DO4A 2G8ZA 1E55A 2PDIA 4J2PA 1XG3A 1A5LC 2ACSA 3Q58A 1XLHA 4DVOA 3AHVA 1XLDA 4ZFMA 1YHTA 3AYTA 1B90A 1DIDA 4RL3A 4BY3A 2VGFA 1UUOA 5HMSA 2ZRZA 3K5XA 1CNVA 4OWGA 3CT2A 4I9TA 4H8VA 2BVDA 3W87A 3R0KA 4AZ7A 4C6IA 4H7CA 2R1KA 3TYAA 4R7WA 4NJIA 3AISA 1M65A 2JGQA 1TMHA 4Z1CA 3SCVA 3UESA 2YL5A 3PVFA 3WEOA 1G4EA 1E73M 3KOZA 4H6KA 1B54A 3M7SA 1GOIA 4F0MA 1C9WA 3E6EA 1ZBWA 2VT0A 4LJ3A 1Q6OA 6TIMA 2C1HA 5I5RA 2WPBA 4GY1A 2GWNA 1TRIA 3SW6A 2D3LA 5IDIA 1I0BA 4GYFA 4M51A 4IT1A 1KCKA 1E70M 4KRUA 3C2FA 1YPXA 4UQBA 4PUKA 2VWTA 1QHPA 1BAGA 4LX4A 1M04A 4M24A 3MYOA 1ONRA 4Q6JA 4PFHA 4UTFA 2X0YA 4C1NA 4D8ZA 1OT1A 4K37A 4PTWA 1LTDA 4NRSA 2XFRA 3TAKA 4TU1A 3GDKA 3KDNA 2MANA 4FLSA 1ZPTA 4D6CA 5CC7A 5E70A 4PUUA 1WKDA 2J78A 5TD4A 4RDZA 3N2CA 3ABSA 2ZKMX 3GH4A 5EA9A 1AJZA 4CQCA 1XHGA 3U2EA 3G1SA 3E96A 1ZHAA 2YGYA 3P5ZA 3WF2A 1RAKA 3G8EA 1TJ1A 3RMJA 3PWIA 2WSRA 5K9CA 3ANUA 3NQ2A 4E2BA 5CC3A 4AIUA 1FWTA 1WBHA 3FA4A 1KTCA 3N29A 2E77A 3WQCA 4Y9AA 1TPB1 1LRQA 3BQ5A 2DH3A 5A6KA 5AC4A 4UQEA 4NZ4A 3GS6A 4GI8A 4GX9A 3DX5A 4LVAA 1O1HA 1UR3M 5HNNA 4HCDA 1OFPA 2PBOA 1DWJM 3G24A 4AHPA 1WKEA 4N4QA 1BYCA 3E49A 2WM1A 2F7FA 2IS7A 4JQ2A 1HL2A 3D6NA 2IUZA 2KAUC 3S46A 1XIJA 4K8EA 1GYLA 1EPXA 2CZEA 2G41A 2BWGA 3VD7A 1J93A 3NSNA 4IMAA 2YA1A 3LRMA 3MP3A 3OLIA 1YNYA 4IGMA 5CGQA 2GZXA 4UTTA 2PZ0A 3U9IA 2JE8A 2D22A 3LDVA 3LPFA 3WH5A 4DZAA 3FDKA 3RYSA 3L5MA 3GHSA 3TN5A 3W22A 2XM2A 3E2SA 2VC9A 3W37A 5DMYA 1X97A 3AIEA 1G4PA 1JDAA 3OIXA 4J1OA 3LPGA 3PTKA 5BROA 1E4MM 4RPPA 1R5YA 1VJIA 1YX1A 1X6LA 3GYCA 1BKHA 3DFSA 1FDJA 2XINA 4G1KA 1UKPA 1UQYA 5GPRA 2WHJA 4CEUC 4CKQA 5C55A 1JZ2A 3MU7A 3PPGA 2X2GA 1O12A 5ENLA 2WWCA 3BSMA 1DIOA 3BH4A 1JCMP 4LRSA 4MAZA 3GXNA 1SPQA 1MQQA 4GYJA 3SGZA 1MW3A 1EJVC 4W93A 2NV1A 4PH6A 3HTWA 3W1TA 4KETA 3IJ8A 1TV3A 1PCKA 4IMEA 3ZS4A 5KINA 2QJIA 2CEQA 1A50A 5C2GA 3QFEA 1JNDA 2V9DA 5HJXA 1DQUA 3U7BA 2F38A 4ZO9A 3B9AA 3MWAA 4GO8A 3NQ8A 3W86A 3CB8A 1RQBA 4M0XA 2V2CA 2G3FA 3HFYA 3AIVA 3PPFA 3DG3A 1PX8A 4UFMA 1CX9A 1T41A 4MF4A 4DO6A 5BXTA 2PWUA 3M43A 5HA7A 4KIRA 2R6OA 2D24A 4EVZA 2YL9A 1LROA 4UTUA 1LL6A 3PTQA 2X2YA 4PBFA 3W7PA 4TVUA 4IOTA 1KRMA 3VDAA 1TJ0A 4GUFA 4G7EB 1X6UA 3CAVA 1P1XA 1KM4A 1H09A 3W53A 3O63A 1JPMA 3R89A 3L4UA 2XZ7A 1ZB5A 3IEBA 2ZX5A 4GI6A 3FEQA 4M1RA 1AUSL 1VF8A 4WK9A 2BBFA 1E51A 1YDNA 2WMFA 3UU0A 5DO8A 3C0SA 3FA5A 1R3YA 2YLLA 4GHRA 5ABTA 2DZAA 2XFFA 2PGEA 2AQWA 5L9FA 2Q8ZA 1FA2A 2PDFA 3L4WA 3WLSA 3HGOA 2Y5SA 5G1TA 2FJUB 1E43A 4H6QA 3NR0A 3GC2A 1Y5XA 4JNYA 2EF9A 5AC8A 3KS6A 3PUEA 4U33A 1KM0A 3S2NA 2A3LA 1RK5A 4OBSA 1W1IE 3VAVA 3RX4A 1GTHA 1NAL1 1E0XA 3ABXA 1VFTA 3SY1A 2PB1A 2W92A 4HPXA 4E5TA 1VHCA 9XIMA 1R38A 2GSEA 2WVVA 3A3WA 4ZSUA 4ROPA 3CMGA 2G95A 1V6TA 2CLMA 4X0NA 3HURA 3ZWTA 1AW1A 3NZPA 4KGLA 1EX5A 1W9UA 2Y2WA 4P7RA 4WOQA 4LSBA 3W2KA 3ZLHA 1K7EA 3SN0A 4C6MA 1LRTA 2CZ5A 2WV8A 3C8FA 4QCEA 3T8QA 3VMNA 1KXVA 2C3ZA 2CXGA 3AI0A 4J3VA 2GQAA 5ECUA 1FDYA 2E28A 2QULA 1QR7A 5E6ZA 3NQCA 4MZ1A 1LQ0A 4HU4A 2JF6A 4UXDA 3BL3A 2PURA 4RK8A 4UCFA 2PWFA 1VCGA 2FVKA 4AAJA 1F3XA 3TJIA 2ALRA 5CPQA 2E9BA 2BOFX 3UGVA 1SFTA 2PF8A 4JHOA 2NXHA 1AW5A 2CITA 2VMFA 3KL0A 3PZVA 2UBPC 5IBXA 5DMNA 2XSAA 5A8MA 1WDSA 3ZOAA 2C7FA 3LZ5A 2GK1A 1BSLA 5FA5A 3BGGA 5IRPA 1W9VA 4UFJA 1OBAA 3GD6A 2ZA1A 3C0JA 2OGJA 3GFZA 1NP2A 4YIWA 1M5WA 1WUFA 2OCZA 2ZZ3A 4O17A 5DQPA 1IYXA 4GBUA 1WOBA 4BEQA 4HVXA 1E6QM 3GY1A 4GPNA 5AYBA 5CPTA 3TONA 5A1AA 4LQ1A 4P7QA 4RW3A 4F66A 2DZTA 3WLQA 3LBCA 1FWSA 4LALA 2E40A 4IG2A 4ONVA 3UETA 2XG9A 4MJZA 3GU1A 2GYIA 2DEPA 2QLYA 2DIEA 1WDRA 5BRQA 5JUVA 3MS8A 2XIOA 1J0IA 1TSIA 3C2EA 1HGWA 2XU2A 4E2OA 4C6EA 4JL1A 1TCMA 1BFNA 1EJUC 3F4VA 1EOKA 4IWWA 2ZICA 3WX7A 3I10A 2PUZA 2O9RA 4MWAD 2WAGA 1MI3A 3CWNA 1XGDA 1DQWA 4LANA 3UZ5A 4CCEA 3QOMA 1TRDA 1YADA 2J62A 3OVPA 2REQA 2FMNA 1V02E 3WNOA 1J10A 5ECVA 3NQ7A 1IWPA 1ICPA 3TJLA 3V36A 3TLQA 4JIQA 2A6LA 1H51A 2W62A 1HIZA 4NI3A 1EH9A 1GVRA 2NLIA 5A8OA 1IIGA 2IXVA 1UZDA 3DUGA 4FLOA 4IMDA 4KIEA 2V5KA 3LGEA 1XH2A 3EKZA 3VIJA 4PSPA 3WK3A 2J8TA 2DZUA 1ONXA 2WSKA 3H8AA 4DNMA 2NZLA 1KRBC 3WQ5A 4KKXA 3M6YA 1FWEC 1EKOA 2CXEA 3IRDA 4BF5A 1M1BA 2VD9A 1P7TA 1YBQA 3B0PA 3K4DA 1EO5A 4D71A 1GKPA 1M6JA 3T42A 3LMZA 1KQZA 1I2RA 2VVNA 3L9CA 2PF0A 4UC5A 4AY7A 2W4XA 1Z3NA 3WQVA 4ATDA 4XSLA 4D6GA 3L2IA 1IWBA 3O8AA 2O92A 1OD0A 1MRAA 4NJKA 1Q6QA 1ME9A 3IRSA 4IFKB 4PL1A 4MY1A 4C1KA 4X60A 2H9AA 1D8WA 3IUHA 3CEPA 4MKSA 3TQ0A 4B4FA 2EPMX 4DJFA 1OX4A 3UWUA 3A9BA 4V15A 3W83A 1Q5MA 4C7DA 3ZM8A 4NAEB 1RVKA 2Q3OA 1IGSA 3LSBA 1IV8A 3HGSA 3KL3A 2DU2A 3IJDA 4LUSA 2BODX 2NX3A 4US5D 4Q33A 4FIRA 4TX9A 4PCPA 2PWGA 3HA1A 1E6XM 3WLMA 3IIOA 3AIUA 3N2XA 3A4JA 4MM1A 4CU7A 3CWOX 2D2GA 3EOLA 1RLCL 1V08A 5A8QA 4YS1A 2BNJA 3B03A 3IJ9A 3STFA 4HZMA 1X8CA 2VGGA 3W3OA 4CNPA 3T7VA 2XN1A 4JHMA 3L23A 1R3RA 1P0NA 3NTYA 1R7OA 4B5SA 4LYPA 1JYVA 4NZ1A 5ABHA 3MUZ1 3S42A 2FQIA 4MNLA 4AYSA 4FZIA 4C6CA 3SJ3A 4NAFA 1DPMA 1KFCA 2A3CA 1NWRA 3E2QA 1W5OA 3KLLA 4GNVA 2WJZA 2DW7A 5A6JA 2V3DA 3E12A 4X22A 3WO8A 1OYCA 4AMAA 3MJYA 2A5HA 4FI4A 1VFFA 5H1WA 2XVLA 5ABFB 1UUMA 3F03K 2CZFA 1EDGA 1WPCA 4DEFA 2VL4A 4UBPC 3NOYA 1PIGA 2QS8A 3F7JA 4AZBA 4B5WA 4EXBA 4LC6A 5I0DA 2J8GA 1B4EA 3JVAA 3SCUA 2EPNA 1GUVA 4LTSA 3HG4A 1OHLA 4F0KA 3CV7A 4HN4A 1KV8A 4QITA 4YL2A 4YCOA 5MKGB 1OGSA 1IXPA 1EL3A 4JIPA 4YTTA 2ADAA 2J74A 2ZVRA 3BJFA 1TPC1 3KX6A 3DYOA 2XTKA 1GQLA 1P0EA 1FDZA 4TX6A 3RO6A 1R2TA 4AD1A 5LGXA 2YFNA 1F05A 4RNIA 3I3BA 3AOFA 1U2YA 2ZTJA 4JTTA 4FLQA 3AQUA 1QDSA 5D03A 5C54A 3RCMA 3C5QA 1HO4A 4MUPA 1JPHA 3H55A 4TVDA 5M03A 3Q67A 3UXAA 1DJNA 1IEVA 3CL6A 4OE7A 2E09A 4UOZA 3KLKA 1NOWA 1OG0A 2GSJA 5L6UA 2J27A 4ZL1A 5TF0A 4J2MA 4BHYA 1AQMA 1HVQA 1CGWA 2R9RA 3IAPA 4M5PA 4HU8A 1JDCA 3GXMA 1VBUA 1E1CA 1Q2RA 4IIHA 3KVLA 1RV8A 5BW6A 1P0KA 5CLTA 3NPXA 1BWKA 3WK2A 3YPIA 1GNXA 3GRIA 4GVFA 1PZ3A 5KZEA 4RZBA 4QQUA 1ZJBA 4J28A 4XQ6A 4GABA 1HT6A 3O16A 3HPAA 3OQ8A 2ZWYA 1HW6A 1XLBA 4QXIA 4LBUA 6ENLA 3JU2A 3VABA 3RM4A 1S38A 4AEOA 3WK1A 5DMMA 4FSAA 4B9ZA 4CQ9A 2I9EA 3ENLA 2GPTA 1KBKA 2FGZA 1FWBC 3CMFA 4UOQA 1LWHA 4XUYA 1XUZA 4LCQA 4QHRA 3S0CA 1H7PA 1NSJA 7CGTA 2DORA 4ICCX 5HDRA 4Y7EA 3I3EA 3NAVA 1EP2A 3NG3A 1ZQ5A 3AC0A 1DWGM 2Z28A 4AZCB 5T8GA 2VFDA 3QLDA 4E0CA 2HVNA 5FI8A 5KZ6A 1Q8JA 4S3AA 1MO0A 3QXBA 2C79A 2FB3A 1YDOA 2DVUA 2DZSA 4Q22A 1ZS2A 5I77A 3TWBA 4GZ7A 4PMXA 5FJUA 2R1MA 3KOWA 2FZDA 3SEPA 4GUHA 5LNSA 3AHTA 5FOOA 5LIXX 1R86A 1YW1A 2PU0A 1P43A 3U8GA 2EJAA 1E0VA 4LVBA 1OFQA 2P8BA 3CC1A 4BQ4A 2FPTA 3W72A 3KTXA 1OYAA 4KF1A 4EF9A 3WD1A 4JD4A 3DKJA 2OWCA 1S1RA 2QCCA 3DERA 4UTKA 4IXXA 1LG1A 3TN3A 2WJEA 4ZR8A 1ZLPA 4X9SA 5DN1A 4A3RA 3OVQA 2GGGA 3PSVA 4A3YA 2YW3A 1RD6A 6REQB 1G67A 2BY1A 3K30A 1FWGC 2VOTA 2E8ZA 2C0HA 3S9YA 1MUCA 3RCYA 2DUXA 1FWHC 4XD5A 4BI7A 5H6HA 4KEUA 2OLSA 5D2TA 4IGSA 1I8JA 1VR6A 2AAAA 3N19B 2F6UA 3OEXA 3LXAA 2QDEA 1EBGA 3AXMA 3W0KA 4GH1A 3TJXA 3LS9A 2VX6A 4DZIA 2KX9A 1CGYA 3T0BA 1MQRA 5TAOA 2ZC8A 2HJPA 3HMCA 7A3HA 5I7GA 1B3YA 1GORA 4G6CA 1EQPA 1R7AA 2PRHA 4PRRA 3GE7A 4ZQCA 3E2RA 4GZEA 1LUCB 3ATZA 3B04A 3G8RA 4GRSA 1P1MA 4CVWA 4MSSA 4A8IA 3OOQA 3ALGA 4J40A 3QV9A 1RH9A 2QJNA 2NSXA 1XW8A 4PCSA 4H9ZA 4R53A 3A3XA 2JF7A 3K2GA 5IXEA 4O57A 3HMJG 1DYSA 1Q45A 2C16A 3TP4A 4F4RA 3QYSA 1CIUA 1V3KA 3NFUA 3VOCA 4S3FA 3TW6A 3AWNA 1OYBA 4BQ2A 4L5ZA 2EXOA 3ARVA 4UUIA 1M3UA 4H9MA 1LT8A 2BLEA 2RJGA 1JZ3A 3LXCA 4UFIA 4IPPA 4ADTA 4Q7NA 3BMWA 5HWJA 3TJ4A 3QOKA 2YPIA 3CLMA 1FCUA 3TR9A 1ADOA 1KR0A 2VWSA 1P4CA 2DZWA 4YJ5A 3AIBA 2PE4A 3LCXA 2PBGA 3NO1A 3TIMA 2XIBA 4YVXA 1S3TC 1Q6GA 4KWSA 3WQFA 3CLWA 3BAXA 3WQWA 4QS5A 3AXKA 5KMYA 4CEXC 1HKWA 4AX6A 3FN9A 4DI8A 5CJ5A 3BGJA 4FNQA 2Y6ZA 3GH5A 3IGSA 4MG4A 3R7MA 4MVAA 1POKA 3DYPA 3GBEA 3ALFA 1AH3A 4UMAA 4ASTA 3BG9A 2QCDB 2VZOA 1SFJA 1D8CA 3RHGA 3GG8A 4QTGA 5LXEA 4LYRA 4WGHA 4IJRA 1OCJA 5AZ0A 1JZ4A 1YXYA 9XIAA 5AHMA 2RUSA 1UHVA 3HF3A 3VIFA 2J75A 1OC5A 5JIWA 1L2QA 3ARQA 2YBTA 3N12A 1M41A 4FNSA 3PP7A 3CTTA 2WLZA 2XDFA 5A8PA 4P8UA 1FFQA 3E5BA 5CPMA 3AMGA 1UD4A 2OWWA 1AZ1A 4JQ3A 4DX3A 4NJHA 2I9UA 1E4IA 4J3SA 4JX6A 2IPJA 3T08A 3TTQA 2ZZ1A 3NZ1A 1NWTA 3B9EA 3S4TA 1GOQA 2RKXA 1S5NA 4NNBA 3OU8A 4A3HA 1QXLA 1XXXA 1TR9A 2UY2A 4ICNA 1XLFA 3LI0A 2FDSA 2ZFAA 1GVQA 5DCEA 5I06A 1GPWA 2BFGA 2P0IA 4HSOA 4GIEA 2GVYA 4ACZA 1X7IA 1A3HA 3BAWA 4UFLA 2BVTA 4JTFA 2JKEA 3ARSA 1IXOA 3AIQA 1L2UA 3TVAA 2DDXA 4PBGA 1UH4A 3UP8A 2XH0A 2QF8A 4HGXA 4HU3A 1QOPA 4O13A 5BRBA 3QTPA 2YDRA 4A3UA 4M6VA 5FF7A 1AH4A 5FJRA 5K9DA 3WYZA 3SGGA 1VHNA 3BV4A 3DHUA 5I3JA 1VFHA 1BD0A 4MJMA 5HQMA 4YU1A 3CZKA 3ZLFA 5C9RA 2HEJA 3GTHA 1ZP4A 1SJAA 2QMKA 4CD6A 2F6KA 1CPUA 4N7QA 1GOKA 2E7FA 4GGBA 3JS3A 4R88A 2WMJA 1UZ1A 2VTFA 3MTWA 5E0CA 4Q7IA 4Q8PA 3FHAA 3L5LA 4WIWA 3SURA 4IJBA 1KC7A 4UMBA 2YKKA 1CZ1A 2O7SA 1Z9AA 2PGFA 2I5GA 1UW9A 3LQLA 1DXIA 4RW5A 3JR2A 3TTSA 4MY8A 4FO4A 2E6YA 1JFXA 1JUKA 3GHUA 3ZYZA 1OCQA 3REQA 3DFNA 3K46A 3LNPA 2ABAA 4L6HA 3K1GA 2HNHA 2EPOA 2PLKA 1Q7MA 4XD3A 2OXNA 2YL6A 2YLAA 3IARA 3EBVA 2UZ9A 1H7NA 3SY8A 3VX1A 2JGYA 1EBHA 4PB5A 1FXPA 2ISVA 4MDOA 4ZOAA 4P8WA 4WKAA 4HHMA 4D8AA 2V2HA 4HP5A 3MVTA 2PWEA 4L9YA 4CU8A 1IZJA 3KP0A 1GHRA 3PUOA 4PCFA 4ROQA 3WH8A 1K9DA 1Q65A 1A5CA 3LK6A 1H0IA 1R30A 3AS1A 3GXIA 3PAJA 2ODOA 3NQDA 4GUIA 3RCNA 3U5YA 4US6A 2DIJA 2QUVA 3TAOA 4WZHA 3S2CA 3TW7A 3EOSA 5REQA 2J8FA 3GB6A 2BG5A 3QR0A 2INZA 1N2VA 4FNTA 4KCVA 3VD3A 3A47A 3BC9A 3CS2A 4GISA 4DXVA 4BF7A 1V6VA 1JEZA 1RXOB 4M81A 2XWDA 1A4MA 1BRLB 5CZTA 4EK7A 1U1HA 4AVNA 3O3RA 1NQKA 3R25A 1VJSA 4REQB 1OCBA 3WLKX 1NOUA 4MIMA 3S3GA 1TZZA 3W26A 3ITGA 4KGJA 3W75A 4FNRA 2D69A 1ZENA 1KD0A 1PKNA 4XBSA 2CWNA 2GGEA 4HB7A 3QN3A 3THUA 1PTGA 1FCBA 1Q6DA 1VPXA 2CC0A 3BLLA 4F2UA 5AYIA 1RVGA 3WDJA 2Y0FA 4JCLA 3WMCA 4AVOA 4QG6A 3PWGA 4DM1A 1UWQA 1HP5A 1J6OA 4UTLA 2GLKA 3M6DA 3NDOA 1NTHA 3VFCA 4M7TA 4XUGA 2PDJA 2OQLA 4OHQA 4I5UA 1LJYA 3WDPP 2ZRUA 3CAQA 1E6RA 1I60A 1MDRA 1TWZA 2Z0IA 4OIFA 1Z89A 2NQLA 3C3NA 1W2PA 1F5ZA 2VFGA 2OYLA 5GNYA 3M5YA 4GVHA 3O7UA 4AZ5A 2YXOA 1TV7A 3SCOA 4XIAA 1W1YA 3DZ1A 3O2LA 4Y9NA 2VUNA 3ITTA 3RUBL 1W3TA 1H11A 3G2GA 3CUIA 3IPWA 1CXFA 1XISA 1UQZA 4UIOA 2TPSA 4FLRA 4K2SA 1YEYA 4QJ4B 4TVCA 3GHRA 3F5JA 4WKFA 3DOPA 3DH7A 4MNMA 4RJEA 3FSUA 5D38A 3W29A 3UVAA 4KH2A 2F61A 3PWAA 3U4AA 3T6CA 3ARYA 3GNPA 3RF9A 2ZDRA 4L80A 3NEHA 4IHCA 4GK8A 3QQWA 4LC8A 1PCWA 1Z8AA 4IX0A 1K9FA 5CZJA 2I57A 3ARWA 2WHMA 4R34A 4GQGA 3VKBA 1EHNA 3IIXA 3PJWA 3VIIA 1CB7B 3NPUA 2WWDA 1DKWA 2W91A 1EPVA 1C7SA 3NZGA 2DJXA 5XIAA 1YTKA 2Z1VA 5FJIA 1CBGA 2DQXA 3EZ4A 1CXLA 4B9YA 5I07A 4RZ5A 3FIGA 3A5VA 3LM7A 3GIPA 4BJHA 3TA6A 4GUJA 1AQ0A 1KM3A 2XYLA 3H2AA 3S83A 2VEFA 3MUXA 1IXNA 2Z00A 5I03A 3UJRA 1U5VA 1E5JA 1PHWA 2R82A 4HNNA 5CKSA 2XN2A 2VYOA 1W56A 1BF6A 1H61A 4W86A 5CPSA 1A5NC 3LA4A 2QCMA 1C91A 4DBSA 3NM3A 4PEEA 4FOJA 1G6CA 1SZNA 1BTMA 1VCVA 2PRMA 3NURA 1IT0A 2Z4GA 5A6LA 8RUCA 3M0IA 3S8HA 3T2QA 1CT5A 1QMLA 3UR5A 4PYSA 3R11A 1TJRA 2WCGA 2QVNA 3VPLA 3UPMA 1FRBA 3ZJ6A 3C4UA 3QZ6A 3SI9A 3OZMA 3TNOA 2GFTA 2NUXA 4R27A 3BG5A 2YCLA 4AD5A 2DT1A 3VOHA 5DBUA 1HQTA 3B4UA 3M0XA 3ZVHB 1W6TA 3H6OA 3EGJA 4TO8A 1EQCA 2LLEA 3BSGA 2WHKA 4ADSA 1U83A 4I9MA 3J7HA 3VCNA 5JH2A 2HQAA 4AZIA 3U0HA 4MFDA 3CO8A 3LCGA 3KBNA 5GJNA 1MEIA 2BASA 4K6AA 4YPJA 2YB4A 3DC0A 2CPUA 3MB9A 2QPSA 1Q7QA 2A1YA 1XD0A 4Y2WA 5EMUA 4KRZA 4X0VA 4LRTA 3A4XA 1TTQA 4E4FA 3WQ6A 4JTJA 3SBFA 3UR8A 4HZ6A 2WB5A 4NXKA 4POCA 4GQQA 3H2OA 3W73A 4W85A 3WF3A 2C91A 2HWGA 2I7GA 5KETA 2POTA 3OBKA 1A5UA 2R1NA 2C14A 5EBAA 1XCWA 3B0XA 5JXQA 3OYZA 2FH8A 3UXLA 1UWSA 1F6PA 1OCNA 4LOCA 5I24A 2BXYA 2NQJA 3IUIA 1FWNA 5HUOA 2XH4A 2YJQA 2H3BA 2GVGA 4IISA 2JEQA 2YOCA 1F9CA 4DWSB 4GQ0A 1CGXA 2GJXA 4LUTA 1YRRA 5EGRA 3HOJA 4O8RA 2X40A 3UWQA 4ZB5A 3GXDA 2VDHA 2TAAA 1QPOA 3FW6A 3ZR6A 4Z1AA 2ZZ6A 5IFPA 4EANA 4LEFA 5A3HA 5XINA 2OQHA 4ADUA 3CUGA 3WNKA 4C90A 3N04A 3L65A 2QHAA 1IF2A 4A2RA 1BEUA 1M7OA 2D20A 1P6BA 3ZSSA 4JBRA 1KFEA 4GVGA 3D46A 5LKYA 1YDYA 1GONA 3AAMA 3MVIA 4I7VA 3M47A 1X39A 4JYFA 4PMUA 4XSMA 2PC4A 2HXTA 3ABZA 4XKYA 1JDDA 3WFAA 3EA2A 2VRKA 3QR1A 2GL5A 3TLLA 1H63A 1K8ZA 1T8QA 3QVQA 5EPDA 4DF1A 1KXTA 3LGDA 2XH7A 3WBAA 3A13A 3TN6A 2QKFA 3CQJA 4ECLA 1VFUA 3PG8A 3TQPA 3SIZA 2VGBA 2XVPA 3S1VA 1KRCC 1R3VA 3TC3A 3OLDA 3VGEA 3W71A 1B3OA 3P14A 3R2GA 1W1VA 3EOEA 5CEWA 4J9JA 4QDWA 3THCA 5DRIA 2Y85A 2VR2A 3GR7A 1WQ5A 3GAYA 3QHMA 2YDAA 2YIHA 3H70A 4IJCA 4B3ZA 3U2OA 3UJ2A 4HOXA 2NUWA 3XIMA 2YL8A 1JI1A 2POZA 1XX1A 1GYNA 3T55A 3UWEA 1G5AA 2OZ8A 3QF0A 4JFSA 2J79A 3EOUA 3KXQA 2CWXA 2WQDA 1YDVA 3B97A 3AYRA 4CUCA 5EMYA 3PBMA 2ZC1A 3HQPA 4O10A 1JPDX 1V4YA 1KBBA 1R46A 3IJIA 5LIYX 2XFWA 1RP9A 2ZWZA 4ZB0A 1KB3A 2NWSA 1QHZA 3TKFA 1V6UA 3DKLA 1LBFA 5HNRA 3C3UA 2WNNA 4PCTA 1N7KA 1NARA 2F84A 1EGZA 3OA5A 1BVZA 4OJYA 5FSEC 1SR9A 2PS2A 1TMLA 1KGWA 2CHNA 2YXXA 1XWYA 4Y9PA 1HGYA 4J4KA 1FWRA 2XJ7A 2Y62A 4PEKA 4JKMA 1PTAA 4XX6A 3WSUA 3APGA 3H24A 3VGFA 5BOOA 5F1VA 3VNIA 3N18A 3P81A 3OZYA 1PZ1A 4QR6A 4HT3A 2QEZA 4GC4A 2HK0A 3EWWA 3VZZA 4NRRA 4C5YA 1YMYA 2VVSA 3VIMA 2NQHA 1KFBA 2OT1A 1PJ9A 3IJ6A 1SR0A 1MSSA 3KBMA 4C6NA 4DYKA 4M56A 2E5DA 1K77A 2V5BA 2BP1A 2P50A 3DAQA 4HHHA 4FR1A 4O1BA 2QJJA 2OELA 3QW4B 2PDMA 1VEOA 2HROA 1ECEA 3UGRA 3JZEA 3UF9A 1LLZA 1IWAA 2V69A 2WW5A 1JCNA 4UTMA 2D1ZA 5LIKX 4P8VA 2PDUA 1YYAA 3UWZA 4MGGA 1PYFA 1OINA 3R1ZA 4V33A 3VUSA 3UYCA 4DJED 1PAMA 3ECQA 4AC7C 5BU9A 3BQ6A 1K4HA 3UD6A 1L6YA 4PUWA 4Z2IA 2ZA2A 3V1HA 2WKJA 1FH8A 2W9MA 4QLJA 2J24A 1PSCA 2TMDA 2DH2A 3MV11 1SZEA 1LRNA 3CV2A 3R8HA 2GJPA 3U2CA 3G6MA 3ES8A 3PFRA 2R24A 2J9ZA 3TV8A 4QLLA 2OU4A 1E15A 1QUMA 3UZXA 2W63A 3IVSA 3W7JA 3L21A 1NOFA 3RLHA 4W87A 3SAZA 4S2CA 1ICQA 2P1FA 3OZPA 2RGLA 3AHZA 4Z2GA 2QCGA 5HBFA 4WDWA 5AB3A 4QBXA 4QM1A 4RXFA 5CG7A 4GNJA 4BI6A 4MZYA 3G1XA 3CHDA 4HIBA 3M0MA 1XLMA 1XPYA 2KZHA 2YDSA 3HM7A 2GJRA 3G22A 4RXGA 1GQNA 1UP3A 5BU6A 3KCOA 5C9WA 1A47A 3U48A 3UY7A 4NYYA 1PKLA 3AYVA 4Q4PA 5G2IA 5M2FX 3G3DA 1W0MA 1WP6A 4XZHA 4JTIA 1EJRC 1S1PA 3H2EA 1W3KA 4NQ1A 4PMDA 4QGCA 5A94A 2FFIA 2XIJA 4AF0B 3HN3A 5DXYA 1X38A 4XZIA 3N9SA 3H4GA 1TV4A 2EG6A 1QT1A 3KFTA 3RJXA 2QV4A 2E1WA 4B15A 3QKEA 1TPDA 4JIEA 4GKTA 2HPMA 1B3XA 3CNYA 3AU2A 4L4OA 2WBKA 2OKTA 3FSTA 2PA6A 3TE9A 3VOJA 2A3HA 4MDPA 3E0FA 3H7RA 1VPYA 3TYUA 1RJPA 3TW9A 3WBXA 1WUEA 3DHDA 1MEHA 3UG3A 2XIQA 1OK4A 3RX2A 3ARPA 3W02A 2E9LA 1E9YB 2AGTA 3TA9A 2HVOA 3RN6A 3N4FA 1VBJA 5LA0A 4JQ4A 4Y9MA 4AYGA 1PEZA 3VD9A 4UMCA 4F2BA 2WJDA 3GDMA 3A4WA 4ZB2A 3O6CA 4NYUA 1GTEA 3A24A 3FJ6A 3EXTA 1EX1A 4JNZA 3MPGA 4ML4A 3DFYA 3SCWA 4PMVA 1N82A 1E0TA 1O1ZA 1UKQA 2H90A 3NM1A 3EX3A 4PUJA 3RRAA 3Q2DA 3MUAA 1X8FA 4MKNA 5DRCA 2Q8LA 3WLIA 2Z1SA 5HXMA 2VC6A 5K2ZA 2J9XA 4QAIA 2BXVA 3BLPX 3AFBA 4HSNA 2ZXBA 4XO7A 2Z2AA 1YIXA 3PB0A 1UPPA 4HJWA 4UR9A 1GEQA 2WO5A 1HXJA 3L68A 4GYKA 1DWFM 2OR2A 2OVLA 5T91A 4BZYA 3VNJA 3VILA 4ZXLA 1PZ2A 1UWIA 2OZ0A 2I14A 7ODCA 2F2KA 4YLWA 2V30A 2A6NA 4OGZA 3T0DA 1XPGA 2ZQ0A 4JCMA 2A3EA 3FCPA 3LLFA