2DDXA

Crystal structure of beta-1,3-xylanase from vibrio sp. ax-4
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
324
structure length
324
Chain Sequence
LDGVLVPESGILVSVGQDVDSVNDYASALGTIPAGVTNYVGIVNLDGLNSDADAGAGRNNIAELANAYPTSALVVGVSMNGEVDAVASGRYNANIDTLLNTLAGYDRPVYLRWAYEVDGPWNGHSPSGIVTSFQYVHDRIIALGHQAKISLVWQVASYCPTPGGQLDQWWPGSEYVDWVGLSYFAPQDCNWDRVNEAAQFARSKGKPLFLNESTPQRYQVADLTYSADPAKGTNRQSKTSQQLWDEWFAPYFQFMSDNSDIVKGFTYINADWDSQWRWAAPYNEGYWGDSRVQANALIKSNWQQEIAKGQYINHSETLFETLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-1,3-xylanase
publication title Atomic resolution analysis of beta-1,3-xylanase catalytic module from Vibrio sp. AX-4
rcsb
source organism Vibrio sp.
molecule tags Hydrolase
total genus 135
structure length 324
sequence length 324
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ddxA00
2VL4A 2V3EA 4ATLA 1S46A 1BYAA 5HXMA 1UD6A 1R86A 5GQBA 1JZ8A 4AD2A 4LYPA 1E6NA 4CD8A 2ZXBA 2ZXAA 2IUZA 2ZE0A 2J4GA 1JI2A 1JIBA 3CMJA 3ZT5A 2UY3A 4FLRA 4TXEA 3ZJ7A 4H8HA 5BRQA 1V6UA 1E72M 5BRPA 2D3LA 4AISA 2WHLA 2AOSA 5A69A 3VU2A 3GXFA 2OSYA 3WMSA 3WUBA 3GYCA 3VIJA 1BPLB 1WAWA 1DWAM 2CYGA 2XFFA 4WKAA 3WNKA 5HOSA 1OM0A 5JBFA 4U3CA 3N18A 1VBRA 3MMUA 1V03A 1V0NA 2J7HA 2EPLX 4ACZB 2J79A 3QGVA 4HP5A 3A4WA 4U2ZA 4RE2A 3PZOA 5D9NA 4UZUA 3AMDA 1HF6A 1M03A 3WQVA 4B3LA 3VIMA 1OIMA 1ISZA 4JFUA 4TTUA 4RE3A 1ODZA 1MQQA 2ZUSA 5EFFA 3AMKA 2J7EA 1ITXA 2W63A 1G0CA 3K8KA 3WENA 5A1AA 4NF7A 3A3HA 5A94A 2J47A 4BCEA 1UD5A 1CGVA 1KFWA 5FL0A 3WEOA 4PMVA 1WDQA 3VOCA 4CN4A 4P7LA 1CLXA 3VINA 3AIUA 3B9DA 3WF2A 3GXDA 2PBGA 3TTQA 1JYNA 1UA3A 3PZQA 1UWUA 2WVTA 1OT1A 1FH8A 3PN8A 1JXKA 1NWSA 5EMYA 2JFEX 2WCGA 5A8OA 3WFZA 5CG0A 1HVXA 2DSKA 1NWRA 1CGTA 1C8XA 1MVYA 5I5RA 2X05A 4ATDA 1BF2A 1H4PA 3WH6A 1V3IA 4TVCA 2RGMA 1WZAA 5M5DA 4JFTA 2V5CA 1GOOA 3GH4A 3GNRA 4UQCA 1Q4NX 2DSVA 1P6WA 1BVZA 1TCMA 2XVPA 1W9UA 3CZKA 5E09A 2DSWA 1L0PA 3OLEA 2F8QA 3WDJA 4HMEA 5JBEA 3RCNA 3ZJ8A 1B2YA 3WFLA 4L4OA 1QI4A 4W86A 4AZIA 3WDPP 3PZIA 4TOQA 1MQPA 2BHUA 1ZBCA 1VEPA 1BGAA 3IJ7A 1C92A 1B90A 1RH9A 1Q6GA 1PIGA 1QNOA 5A2BA 2EXOA 4QFUA 3L2LA 1EQCA 3NDZA 2XSBA 4J7RA 3TONA 1W9XA 3AZRA 2CERA 3CUFA 1HKJA 2VCAA 4GO8A 3VTRA 1KWGA 5DF0A 2YL5A 4AZCB 3CHCA 1WO2A 1Z32X 3ZSSA 2WXDM 1B3YA 2X8RA 2FGLA 3OGSA 2ZIDA 4GQQA 1XV8A 4AZGA 2GFTA 3GM8A 4IUGA 1EA9C 3MO4A 3U7VA 1TMQA 3WNNA 1GQIA 4JFVA 1A47A 1EO5A 1HP4A 1E0XA 3L4XA 4S3KA 4P7OA 5I79A 2XVGA 3WF3A 3MV11 3T0BA 1CGYA 1GNXA 1H0IA 3SCWA 1MW0A 3ARRA 2VR5A 4FLQA 5I0DA 1US3A 1CXIA 1E6PA 3UR7A 3QHNA 4PYSA 5I77A 2WZIA 1C90A 2C8NA 1UKSA 4H2CA 4D6EA 2XVKA 5AYBA 1J18A 4M56A 1H49A 5I6SA 1BYBA 2WHMA 4R27A 2W61A 5BXRA 3GDBA 2A3HA 2WMHA 5CSUA 4W8LA 4ACZA 3SCNA 3GZAA 5F7UA 1SFSA 3UG5A 1PZ3A 4LYQA 1JI1A 2Q8XA 3ZR5A 4IPNB 1BYCA 1VRXA 1H3GA 3PZVA 3W82A 2WHJA 4V27A 4W7UA 3WF4A 2BY1A 1JYWA 4W7WA 1GZJA 1OD0A 3WNMA 4OOZA 1CNVA 2Y24A 2YL6A 1V3HA 3MKKA 3ARSA 4C7FA 3ZJ6A 3MSDA 5A2AA 2WBGA 3PHAA 1J12A 3ZOAA 2VC9A 3GH7A 2Y8KA 2W4XA 1EOKA 2D0FA 3W6MA 3AISA 1JZ6A 2A3CA 4DUXA 3ARPA 5ABFA 2XVNA 1OB0A 1E4LA 4AD0A 2ZICA 4HOZA 4W87A 4URIA 4YHGA 3LPPA 3WQ6A 3CZGA 2JEPA 4NRRA 1V6YA 3QR3A 2FH8A 4J3WA 1NWUA 1JFHA 4M82A 1NP0A 1TA3A 1SMAA 2OSWA 2XSAA 5D9MA 3SUWA 1E5NA 3OLDA 4MNKA 3ZQ9A 2J7FA 1WKYA 1GOKA 4HU8A 4XZBA 4M29A 1OIFA 1YHTA 2ZWYA 4Z2GA 1JG9A 4DWSB 5C71A 2YA1A 3D5HA 1E5JA 3WIJA 1IZKA 2G3NA 1PBGA 1V0LA 2XPKA 3W37A 1F4AA 1V0MA 4CU8A 4J3SA 1UA7A 2WANA 2WLZA 2PB1A 5A8QA 2ZX8A 3OLGA 2ZX6A 3DYOA 5CPSA 2YBTA 4ZFMA 5IXEA 3M46A 1G9HA 1BAGA 3BC9A 4MJ4A 1W3KA 3AFBA 4PMZA 4UTFA 4BQ3A 4D6IA 1HJUA 1OGBA 3VMOA 7A3HA 3CUGA 1HL9A 5A6BD 5FL1A 4DWSD 4V28A 5AC4A 3WDRA 3VGEA 4AZCA 1V3MA 3L4TA 1HP5A 1W1VA 2J7BA 3HJEA 4UQDA 1NARA 1ESWA 2WVVA 3AIEA 4JKKA 4GQRA 1KQYA 4QLKA 5A6LA 4JL2A 3CH9A 5D9OA 1UH3A 5CGMA 4JHOA 4P8VA 4TVDA 3WUFA 3BAWA 3T09A 1E6SM 3CUIA 2EQDA 2J25A 1J0ZA 3NUKA 3CLWA 1CXHA 3EMQA 3CZLA 3W26A 1CXEA 3O6AA 4AXNA 3EDEA 3GH5A 4CVWA 1OGSA 4DUVA 2J7GA 2E8ZA 1HVQA 1M53A 3U5YA 2DEPA 2ZX7A 3CZEA 1GQLA 5BYWA 2VJXA 1V02A 2G3JA 1GUVA 3E1F1 3WKZA 1PPIA 3F4VA 1CECA 1E9LA 3PZNA 3U7BA 2WKLA 5LA0A 2DH3A 5CJ5A 3G6LA 2VZVA 3PTQA 1VFFA 3VNZA 5CPQA 1CGXA 2X0YA 3SUUA 4PMYA 1JGIA 4PTMA 1B3ZA 1GONA 2XWDA 2DGAA 4H7VA 1Y7VA 3AS1A 1JYVA 1QBAA 3VIGA 4PEEA 4HOWA 2ZUMA 2NW0A 1V02E 3IANA 3RDKA 3OB8A 3WELA 1GOMA 4D6CA 4CD4A 5I3DA 5IFTA 3L4ZA 3VD5A 5A2CA 3TP4A 1TUXA 1EOMA 3OA5A 1UHVA 3OIHA 1C91A 2J75A 2J62A 4HMDA 4KRUA 4ML4A 3SUTA 5JUVA 4TX8A 3ARTA 4QCFA 1C7TA 2WMFA 1BTCA 4LXFA 4PTWA 4CN1A 2VRJA 3VDAA 3PZMA 1J0YA 3SCVA 3IAPA 5FD0A 1PX8A 4L4PA 1KB3A 2VVNA 1HJXA 1I1WA 2FGZA 3M6DA 3GBDA 4M1RA 3EMZA 4JCMA 1DWHM 3CUHA 3WDHA 3VGBA 1HJVA 3LMYA 2JIEA 2XG9A 3B8SA 3AI0A 1BG4A 4F66A 3SCRA 4D6JA 5A6BA 4D6HA 4DWSA 2UY5A 2J78A 2F61A 3AZSA 1JL8A 2PI6A 4D1IA 4QDMA 5BXPA 5A3HA 8CGTA 1EHNA 1J0HA 3RO8A 3FAWA 2G4FA 1KR0A 1PX4A 2YDSA 3RJXA 3G6MA 3ZJKA 3VPLA 4MPKA 1PEZA 3T0DA 2D2OA 2BNJA 4ATWA 3FNDA 2VCBA 4N42A 4AD1A 3B9AA 4A3HA 4QLJA 3GTNA 1KBKA 2EPNA 1E4IA 2EEXA 3BXWA 4M80A 4D1JA 4KGJA 4MADA 3T2QA 1QHZA 1JZ4A 5I24A 1B30A 1GHRA 1E43A 2CNCA 3GNPA 4JKLA 1QNPA 2QF8A 3SCQA 3VX0A 1NH6A 2X2YA 1FHLA 3II1A 4MNMA 3VD3A 4CCDA 1V3LA 4AWEA 3VDHA 1LL7A 1FH9A 3DHUA 3WQWA 2CEQA 2PWEA 1BFNA 2DSZA 5A95A 1OBAA 1UWSA 3TOPA 2CIPA 1MW2A 3IAQA 3VMNA 4H41A 1US2A 4W84A 3RJYA 2WWDA 1UR1A 1XH0A 2BV9A 3CHFA 5E0FA 1PAMA 4OKDA 3LPFA 3VVGA 3K1DA 1MXGA 3SCSA 1QI2A 1W9PA 4WLCA 4E2OA 1JYXA 4AW7A 4JKMA 5EB8A 2V5DA 3ARYA 2V3FA 4TUFA 3ARVA 3APGA 4ZXOA 4XUYA 1UQZA 4M24A 1JDCA 3WF1A 4PCSA 3AROA 1VBUA 4H04A 3T2PA 2XFRA 4S3JA 3RM4A 1R8LA 1G1YA 4UFHA 3BLKA 3N12A 3ZO9A 3UG4A 2XFYA 1HT6A 2G3MA 4E4PA 2XUCA 2YA0A 4K68A 3VIIA 2YJQA 1JD9A 2WAGA 5M3WA 1OD8A 3FHAA 4AYSA 1MYRA 3UCQA 3AQUA 2D3NA 2Z1KA 1B3XA 5DO8A 4ZE5A 4EE9A 1JZ2A 4XB3A 1GW1A 4PMDA 3K8LA 1GORA 3WY1A 3BCDA 2W66A 1TZ7A 1V6WA 2WW5A 1VEMA 3PZTA 4HZ8A 5ABFB 4LGXA 2VNCA 2WYSA 1V3JA 3J7HA 2Y8VA 1EXPA 4CD7A 4ZEPA 1WZMA 5A6JA 3ARWA 5E6ZA 3WUGA 1GHSA 3WH7A 2VO5A 2ZXQA 3AIBA 1V08A 4P7RA 4W85A 1RP9A 1BQCA 3OG2A 1UKTA 3BMWA 4UZSA 1TA3B 1H0GA 3KL5A 4MB5A 1LL4A 2OLHA 3OGVA 3F5KA 3EBVA 3MS8A 4JHZA 3MUZ1 2A3AA 2EPOA 2FH6A 1FOBA 3PTMA 4LX4A 1KQZA 1ODUA 2W67A 4MAZA 1FP9A 2J77A 3QOKA 2E4TA 1UWQA 1X1NA 2QV4A 4PUDA 5A8PA 4OOUA 3ZMRA 2WPGA 1FFRA 3ZSTA 1B1YA 1LLOA 3HU7A 4HPHA 2E40A 4AZ5A 1JDAA 1R85A 1HIZA 1VENA 1O7AA 1KGXA 1HL8A 1H5VA 5A8NA 5GNYA 1DP0A 3T2OA 2EPKX 1E71M 2UY2A 4MNLA 2WVVB 4CD5A 1O6IA 3RM9A 1QNQA 3A4AA 4Q22A 3WNOA 1E73M 1KXQA 1UH2A 4GO9A 3M07A 1X6NA 4WSKA 2FHBA 3L4UA 4QAWA 3W24A 4X0VA 1F4HA 1WP6A 2DT1A 3BGAA 2X1IA 4CCCA 3WBAA 3RILA 3VIHA 1JD7A 1KR1A 2CESA 2O9TA 1QPKA 1I1XA 4HZ7A 2PWDA 3WD0A 4IPLA 2CHNA 3RMEA 4CKQA 2DPEA 4UOQA 1E4NA 3CPUA 3VGFA 2EBNA 2WSPA 3W81A 2CITA 3VIOA 3T0AA 1CTNA 3D3AA 5AC5A 4BZYA 3MMWA 1DEDA 1R87A 1G5AA 1WB0A 4KMQA 2GUYA 4FK9A 4CN6A 1CZ1A 4U5KA 4WIWA 2AMGA 6TAAA 2O9OA 1RD6A 3POCA 3BH4A 4PN2A 4MNJA 1NM9A 1E56A 1H1NA 4XV0A 5CZKA 3AIQA 3PTKA 2PF0A 1CLVA 1M04A 3KZSA 1FH7A 3UR8A 1AQMA 1CXFA 1JF5A 1E15A 1J0KA 1NQ6A 1XHGA 5GNZA 1UR8A 3OZPA 2X09A 2VUYA 4HZ6A 1UR0A 5BXTA 3UG3A 3GXMA 2XGBA 1QW9A 1E6XM 1UUQA 3N04A 2E8YA 4GZJA 5C70A 1XH1A 4MTVA 5DEZA 3UERA 1CIUA 3AHYA 3VX1A 5DT5A 2CXGA 1GVIA 3A47A 1WDPA 2OWXA 2DIEA 1R7AA 2CPUA 1W2PA 2JEQA 1E1FA 3U5UA 2XHYA 1HJSA 4CGTA 1TVNA 3NSMA 2ZUWA 2ZOXA 2WZEA 4ZE4A 2WB5A 3GXIA 2OSXA 4U3AA 1KCLA 2WMGA 4D71A 4MDOA 2WC7A 2EO7A 3S6TA 3CMGA 1JFXA 1E4MM 1NWTA 5ABHA 1BYDA 4WSJA 3GBEA 2GK1A 1J11A 1UZ1A 3CIVA 3QOMA 3A4XA 2E9BA 2YA2A 3S2CA 2CKRA 1KXVA 4JAWA 3SUVA 2WVUA 4B9YA 4D6GA 3RPMA 3UETA 1WNOA 1LL6A 1ZBVA 5CSYA 5BWFA 1JZ7A 3PZUA 5BROA 1DTUA 3WSUA 1M01A 2XVLA 1E0VA 5DT7A 3WQ5A 5D9PA 1J9YA 1LG2A 3ZR6A 3ZT6A 3BAKA 1PIFA 4EKJA 1DHKA 4PMUA 8A3HA 4EK7A 5FIPA 6CGTA 1AMYA 2W62A 3FHQA 1V3KA 2ZX9A 4EAMA 1C7SA 1KCKA 5DFAA 3W53A 4PBGA 3MU7A 1Q6FA 4A4AA 3NCOA 1E0WA 1E70M 2YKKA 5TD4A 2VZUA 1ISWA 4H8UA 5E70A 1VFOA 3TTYA 1JZ5A 1J01A 2WM0A 2XIBA 4W8BA 4EANA 2WKGA 3FXYA 1KXTA 3POHA 1LJYA 3PZ9A 3LPGA 3VIKA 3IJ8A 3ALGA 2D22A 2DQXA 2XYLA 2BVTA 2XTKA 3MUY1 3BAXA 1XRVA 2CKSA 2V3DA 2QLYA 2JF6A 2VX7A 2WSKA 4KH2A 3WEZA 3AIVA 1XCWA 2WZHA 1W32A 3AZTA 3WMBA 2NT0A 3BAJA 1CBGA 4LQ1A 1ISVA 3W25A 3HN3A 2E3ZA 1WPCA 1GQJA 5DMYA 3KL0A 3SURA 9CGTA 1E1EA 1D7FA 1UZ4A 3TA9A 2A3BA 1IV8A 4J3TA 4LYRA 1CEOA 1MW1A 3VM7A 1K9FA 4GI6A 3CGTA 3FN9A 4AD5A 1UD3A 1HX0A 2F2HA 1WDRA 1W2VA 4A3YA 1GCYA 4GZEA 1XSIA 3ZM8A 4E8DA 4GINA 2Y5EA 2BHZA 3W6LA 2WWCA 2GJXB 3K4DA 1PJ9A 1UYQA 3W28A 1CGWA 2HVMA 2UWFA 2JALA 3VIFA 1ISXA 4QP0A 2O9PA 2BY3A 1QI3A 3IJ9A 4J3XA 2J8FA 4PMRA 1AQ0A 5HPCA 3VO0A 1HN1A 4UR9A 3EYPA 1ITCA 1JAKA 1K9TA 2VQUA 2WCAA 2Y4SA 1GVYA 4WKFA 3FAXA 4C7GA 1EGZA 2CETA 2O9RA 4J27A 5LYRA 1BLIA 2W92A 1WZLA 4PMOA 1XH2A 4BQ2A 4Q7NA 4BF7A 3CHDA 1B3WA 5FOOA 1DWJM 3WUEA 5AY7A 3CBWA 2WBKA 4W93A 3W27A 1C3FA 1C8YA 2VX5A 4Z2HA 4JFWA 2QMKA 3NSNA 2BHYA 1D2KA 2DT3A 5A8MA 3ZT7A 3VGDA 1HKKA 4AEEA 3B9EA 3W0KA 5I2UA 4AZBA 3AHTA 4YN5A 4BQ5A 4JZ5A 5HNNA 3BAIA 1GQKA 1ISYA 1XSJA 4F9DA 3TTOA 2VR4A 5D8ZA 2DT0A 5KZ6A 4MB4A 3SIMA 6A3HA 3L4VA 1LWJA 4WF7A 4B9ZA 1UD4A 4HA1A 2YBUA 5HPOA 1TE1A 1V6XA 3EDDA 3VMPA 2GSJA 1QVBA 1BSIA 1VFMA 3KE0A 1JF6A 2C7FA 5FCZA 4BS0A 1XD1A 5JBDA 3N9KA 3W4RA 2HISA 4UNIA 4CVUA 1PZ2A 1SR0A 1EO7A 4PMXA 4AD3A 5LA1A 1TG7A 1MFVA 2WCSA 4P7NA 2VZSA 1EQPA 3MUIA 1MW3A 3EDFA 1UKOA 3AYSA 3THCA 3VD9A 1H11A 1GOQA 1HKMA 4GIAA 4ACYA 2Y2WA 1E6ZA 1V0KA 1ZJAA 5IHRA 2XIIA 1FA2A 1JXJA 3JUGA 1EDTA 5HDRA 3AHXA 2BXZA 7TAAA 3WBEA 1GOWA 3AIWA 4U2YA 2E9MA 3KL3A 3SCUA 2YLLA 3GNOA 1J0JA 5D8WA 1CENA 1TVPA 3FW6A 4U31A 4UOZA 2IXVA 4MDPA 4P8UA 1IZJA 3WDIA 4OJYA 2WK2A 3AXHA 1HKIA 2ZXDA 1WCGA 4UFLA 1L8NA 4CU6A 1FFQA 5I23A 3ZIZA 4HA4A 5LA2A 3RM8A 3AXIA 2EJ1A 1K9EA 1NP2A 2V3GA 3SCTA 5BXSA 1W1PA 2BY2A 4AZ6A 1R7OA 3N1AA 3WNLA 2GJRA 4PCTA 2GJXA 2WMIB 1UH4A 3VIPA 4JL1A 5BCAA 4KGLA 4WK9A 1OT2A 5E6YA 2QPSA 2YOCA 4PMQA 1BG9A 2XM2A 1UWRA 4UQBA 2J8GA 4JFSA 2QPUA 2XJ7A 4OUEA 4JCLA 1EH9A 1DWIM 1XC6A 1UKQA 3VGHA 3DC0A 1C93A 1QW8A 2WMJA 4X0NA 2VX6A 3WF0A 3BCFA 4NSBA 1PX3A 3VD4A 5GPRA 4V2XA 2D23A 1UR2A 4IISA 4FLSA 2E0PA 1CGUA 4UQAA 3AS0A 1WDSA 5CPTA 1K9DA 1GJWA 4WJXA 1UR4A 2VZOA 2UY4A 1E6RA 1V6VA 2PC8A 2FHCA 4J3UA 3NIYA 2V38A 3VDBA 4D72A 2CBVA 1U30A 1AVAA 3OGRA 2VT0A 2BFGA 2JF7A 3BAYA 4CU7A 2GK1B 2FHFA 3M7SA 3T08A 3QHMA 2ZX5A 4RE4A 5IDIA 5A6SA 4ZENA 1H09A 1CYGA 1G01A 2VX4A 2VRKA 4QCEA 4U33A 2NT1A 1E3XA 4C7DA 2G41A 4TVUA 1MFUA 2TAAA 3CTTA 1BHGA 1VIWA 1QNSA 1X6LA 2GDVA 1UD2A 2O92A 2VVSA 1ZS2A 1OWQA 3I3DA 3MSGA 1XYZA 4MB3A 2W91A 2PWGA 2DT2A 4AZHA 1BVNP 3AMGA 5FKYA 4XX6A 2VMFA 3AMLA 1EDGA 5EBAA 3ARQA 2VI0A 1B9ZA 4GPNA 3SEPA 2C0HA 2BY0A 5CGTA 2WC4A 4OZOA 4X9YA 2EPMX 3AHVA 2BVYA 2WVSA 5A6KA 1LWHA 1ECEA 5CLTA 2DIJA 1UQYA 3VM5A 3PBGA 4KRTA 1HJWA 2YL9A 1QI0A 2PWHA 3N17A 1UOKA 4DM2A 2ZUUA 2J7CA 4YPJA 4AIOA 4F9JA 4ZXLA 3TTSA 1ZJBA 2VRQA 1IT0A 2VTFA 2WHKA 2J74A 3MV01 3AOFA 2ZUVA 2D0HA 1XGZA 1HJQA 3QHOA 1E40A 3AYRA 2AAAA 3MUAA 1H41A 2YL8A 5ABEA 4FF5A 4PTVA 4KWUA 2FDMA 4OBRA 3I3EA 2GJPA 4F79A 3W38A 3ECQA 2D24A 3NSXA 5I78A 2JIWA 3WD1A 4UQEA 1KWKA 1XD0A 4Z2LA 3AIRA 4HOXA 2DH2A 1WZKA 1TFVA 3ARXA 1NOUA 2WMIA 4MAVA 2BVDA 3VDCA 2Z1SA 4QLLA 4FMVA 4UFMA 1HXJA 4PMNA 2CBJA 3L4WA 2WMKA 4J3VA 4W5UA 3WH8A 1VJZA 1XSKA 1RP8A 5KEZA 1M7XA 4PSPA 1UG6A 2NSXA 4AD4A 2CHOA 1CDGA 1W3JA 5JIPA 5E9AA 5IFPA 4RL3A 4D6DA 1KGWA 4YHEA 2RGLA 4Z2IA 4HTYA 4P8WA 4PUEA 4UQ9A 2BS9A 3OZOA 4UFKA 2DSUA 1OGGA 1H2JA 2CBUA 1CXLA 1B31A 3CZJA 3BSGA 1CWYA 2JE8A 2W5FA 3WD4A 1N82A 1VF8A 2DDXA 3RIKA 2YDRA 1E3ZA 5AYIA 4B15A 1QI5A 2CCRA 3K4AA 4MJ2A 3CZ8A 4DUWA 4W7VA 1B0IA 1MXDA 3MANA 2G8ZA 4XZWA 3K46A 3DHPA 4HPGA 3NDYA 4CUCA 2ESCA 3AS3A 4FLOA 3AHZA 4MB1A 5CXPA 4NI3A 2QHAA 1DWGM 4DWSC 4B3KA 1JNDA 2PWFA 4UOJA 3KWXA 3N13A 4PRWA 3WH5A 4E8CA 3KEHA 3HMCA 1RPKA 2J7DA 1KBBA 1MQRA 4IM4A 2G3IA 5M03A 4JIEA 3BSHA 4P7QA 3ARZA 5ECUA 3VD7A 3EMCA 3F5LA 5IHSA 3WQ4A 1EDQA 1Q6EA 1W3LA 4AC1X 3OLIA 4LPCA 1QBBA 3DYPA 4U5IA 4M81A 4W89A 3UEQA 3BLPX 3SCPA 5C8BB 1JNEA 3W29A 1OSEA 2E9LA 3L4YA 1C8QA 2D1ZA 4N0RA 1LG1A 1E55A 2XM1A 1QHOA 3U57A 2OWCA 1SMDA 2ZUTA 5A6MA 3WL1A 3AMCA 1OINA 3DYMA 4D6FA 3SUSA 2OWWA 4AY1A 1LQ0A 2GDUA 3VGGA 3SCOA 2VCCA 2VZTA 4W5ZA 4AZ7A 4CCEA 3ALFA 3O2LA 4CD6A 1W9VA 1SYTA 3WNPA 3OBAA 5A6AA 3ARUA 1QNRA 1D3CA 4GI9A 2GVYA 4B16A 1ZB5A 4HA3A 5HBFA 3VKKA 5M17A 1FHDA 3EDJA 1EHAA 1W3HA 1U2YA 3AICA 1NOWA 3O9NA 2OYLA 1UR9A 3AS2A 2OYKA 7CGTA 1OCQA 4NRSA 4NZCA 2YDQA 1XCXA 1LF1A 4H8VA 3FY1A 1BGGA 3WQ8A 1JZ3A 4R5EA 2VQTA 4UCFA 4TX6A 1GJUA 4GXPA 4GI8A 2YLAA 3K8MA 1K6AA 3UESA 1W9BM 2PBOA 1J0IA 3AXXA 4M8UA 2ZUNA 3VILA 4Y7EA 1VEOA 2D0GA 2VURA 1WE5A 1UWTA 4GZIA 4UFJA 4AIEA 3LPOA 1B3VA 1VFUA 5GNXA 2WNWA 1ZBKA 3NYDA 1YQ2A 2WLYA 1HNYA 2VOTA 1UKPA 1W1TA 4W88A 1GPFA 1W9DM 4PTXA 1QHPA 1J10A 1UWIA 3WEMA 1Q6CA 5E0CA 2QMJA 2MANA 3WDQA 3EDKA 3AJ7A 5JIWA 2X0HA 3WMCA 2XWEA 4J28A 5D4YA 1FP8A 3MMDA 4BQ4A 3VNYA 1JAEA 1VB9A 3CHEA 3N15A 3PZGA 2CBIA 1TR1A 2WC3A 1DWFM 2ZWZA 4W8AA 1Q6DA 3WH9A 4BA0A 4Z2JA 1MWOA 4UFIA 1ZU8A 5ABGA 5CQ1A 3IK2A 1A3HA 4TTGA 3A6OA 1ZL1A 1JDDA 2B31A 1CXKA 1VJSA 4AIUA 2OYMA 1W1YA 1NOFA 3NJ3A 5CLWA 3WL0A 1XYFA 1U33A 3VUPA 2IXUA 3CUJA 1E6QM 2YIHA 1ZBWA 1W91A 3F5JA 1KGUA 3I3BA 1VAHA 4WKHA 3DECA 3THDA 1KXHA 1UD8A 4GKLA 4HU0A 4PSRA 1CPUA 4HMCA 2D20A 3WD2A 4OIFA 3WD3A 2A3EA 3WN6A 3L2MA 3N11A 4Z2KA 2BXYA 3CO4A 4AEFA 2XGIA 5EFDA 4F8XA 1AQHA 4OBSA 4AMCA 1EIBA 1G94A 4DM1A 1QOXA 3BMVA 1GOIA 1I75A 4P8XA
chains in the Genus database with same CATH superfamily
1Q66A 2VL4A 1S46A 5HXMA 2OCZA 3W01A 1R86A 4CD8A 2ZXAA 3RR4A 3MCMA 3N2TA 2GVEA 1TV7A 1JI2A 1JJKA 1JIBA 4DO5A 1XUUA 1LRNA 3G24A 1R30A 4TXEA 5C9RA 2AL1A 3UXIA 3FGCA 4E8GA 5REQA 1E72M 1TPB1 2O4MA 1LOSA 5BRPA 4AISA 2X16A 3XIMA 2PDGA 1GQNA 2B7NA 2AOSA 3TW6A 5D33A 3EXSA 5TNVA 4RZ6A 1JRCA 3VIJA 4UTUA 3HPSA 3EOLA 5AC6A 4UXDA 2XFFA 3KFTA 4AFYA 3WNKA 1F9CA 3BV7A 3N18A 4AY7A 2E6YA 5TAOA 1V03A 2FB3A 2J7HA 4ACZB 2CLFA 2VFHA 2J8TA 4HP5A 3A4WA 4U2ZA 4RE2A 3OW1A 2YCEA 1HF6A 4B3LA 1OIMA 1ISZA 3KZPA 2AGKA 4RE3A 2EF9A 2ZUSA 4O11A 3VCCA 5IDZA 1WX0A 2VC6A 4NF7A 3REQA 2Q09A 5I3HA 4O1CA 4BCEA 5DY2A 1CGVA 3WEOA 3GDTA 3M0XA 3OYXA 3DFQA 1WDQA 4I8DA 3VOCA 5CG7A 4C6IA 1OADA 4NXKA 3VINA 3PUDA 2P50A 3AIUA 3R5EA 3WF2A 1JYNA 3UYIA 3IJLA 2QNEA 3OODA 4X60A 4EAYA 3PZQA 1LCOA 5JQ9A 3MT1A 1NWSA 3WFZA 5CG0A 1HVXA 2PDCA 4FEZA 2GSHA 4IJCA 3GS6A 3GG0A 1KRBC 4RPQA 1KD0A 4XTIA 3STEA 3AXKA 3LHUA 4UTIA 1H4PA 3WH6A 3CQHA 2WPBA 2V5CA 5I3KA 2HVOA 3LHTA 3GH4A 3GNRA 1V7AA 4XVEA 4C5ZA 4YTTA 5DXYA 4A3RA 5E09A 1HTIA 1L0PA 2H9AA 2Z2BA 1Q7QA 1GEHA 3F7JA 4MWAB 3RCNA 3ZJ8A 4GGHA 3WFLA 5CAKA 3PULA 3LMZA 3UT0A 1PTAA 2P8BA 2VGBA 3WDPP 4CEXC 4QXIA 1TCDA 2BHUA 2PSNA 3KUMA 3ENLA 4IPIA 3P82A 3MYOA 4XKYA 4X9SA 3L2LA 1EQCA 4J7RA 3AZRA 4LUJA 3SDOA 1YKWA 3WLNA 2ATMA 3G1FA 3LOTA 2YL5A 3IIXA 4MLRA 4UTWC 3BL3A 3W1XA 2FZNA 3OQEA 3UXAA 3VC6A 1XUZA 4I7WA 4QTGA 4DZHA 1B3YA 4I9MA 2X8RA 1XW8A 2PDJA 2X1RA 4GY7A 3KP0A 4AZGA 4O18A 3B97A 3FA4A 3PSWA 4IUGA 5KZDA 1LP6A 3TEVA 3MO4A 3WNNA 2GWNA 3H53A 4IMCA 4MY9A 4HK6A 8RUCA 3OIXA 5I79A 1GNXA 4OV4A 3OEXA 1KFCA 3ARRA 3ABQA 5I0DA 3SN4A 1US3A 4QE5A 3QHNA 5I77A 4BF5A 2C8NA 2XVKA 1XP3A 4PGLA 1R3QA 4M56A 4WSHA 4W4QA 3M0LA 3BJSA 2P3ZA 4ERGA 4LY8A 1YX1A 2WMHA 3VNDA 5CSUA 4ACZA 4QSFA 1PZ0A 5F7UA 5AHMA 4LYQA 4Q4OA 3UCCA 3A22A 3ZWSA 4W7UA 1KM5A 3PWIA 3W7QA 1CNVA 3MKKA 1SW7A 3MSDA 1XYMA 3L9CA 1J12A 3ZOAA 2VC9A 2CLIA 3V0TA 1FWJC 4REQB 4JIPA 1RVKA 4P61A 2WNZA 3C0SA 3WYZA 3THUA 1JZ6A 1DJWA 3KCLA 4X22A 3UVIA 3ARPA 4XO6A 3STPA 1E4LA 4UMCA 5FJJA 3UR2A 1GK8A 4F0SA 1A53A 5LIKX 3KBSA 3UZJA 1YLVA 1U83A 4NRRA 2DZAA 3GVWA 3R12A 5I02A 1Q13A 1NWUA 1E0UA 4MNKA 3ZQ9A 4XZBA 1AZ1A 3AYVA 2ZA1A 3MJMA 1EL3A 2OQLA 4M29A 3TV8A 3LRMA 4Z2GA 4DWSB 1BWVA 4ZQMA 2QCCA 2FTWA 5FESA 4MLJA 2IQDA 1V0LA 3Q4DA 4JIQA 4Q4PA 4J3SA 4MWAA 2R14A 2JQXA 4R9OA 3O07A 2VWSA 2WLZA 3ABOA 2A79A 4QDWA 2F38A 1F76A 3OLGA 5EMMA 1G9HA 3STCA 3S83A 1YTKA 2YZ5A 2HVNA 1VCGA 2XH0A 1EUAA 4MZ1A 1HL9A 1Q63A 3W1AA 1FWAC 3UJSA 1PXGA 1QU4A 3WDRA 3VGEA 2CLOA 2XFWA 1V3MA 3KX6A 2DZTA 1HP5A 4CQDA 2YR1A 4HGXA 4MWAE 3S1UA 1NARA 1QXLA 4JKKA 5A6LA 3AWOA 5CGMA 1KM3A 1FKWA 1KBJA 4O8RA 1IEXA 4TVDA 3WUFA 4IQJA 1OX4A 1E6SM 2G96A 4M51A 4Z42C 1BD0A 2J25A 1MO0A 4WDUA 4GYKA 4QSHA 3LCGA 1CXEA 3EDEA 3GH5A 1OGSA 4WQ6A 3BG3A 1XYLA 2ZX7A 4YCPA 3TYCA 5FF4A 4WXYA 4GFSA 1V02A 3EX2A 4LW7A 3M0HA 3PZNA 4GBUA 2W0UA 4QJ5B 2DH3A 3W7IA 1MZRA 4MKNA 2PPGA 5AHEA 5CJ5A 4LFYA 4BWLC 3PTQA 1VFFA 5CPQA 4N9CA 1ZAHA 3UXDA 4PMYA 1R3YA 5I09A 4HNVA 4HK5A 4AWSA 3KHDA 3P2VA 3W74A 1JYVA 1JEZA 3GUWA 4HOWA 1OFOA 1V02E 3ITGA 3UW6A 3IANA 3DAQA 3OB8A 3WELA 4HB7A 2QJNA 4GY1A 3L4ZA 3U3HA 5G4HC 1EOMA 4REQA 1JCNA 5HQLA 1UJPA 3EB4A 3OIHA 4O1FA 2J62A 3S8HA 1WUFA 3N6JA 1IIGA 4FX8A 4ML4A 4PRRA 3SUTA 3ITOA 1G4SA 4TX8A 3EWCA 3ITCA 1Q3NA 3R0DA 3DFNA 2WMFA 1W1A1 2P53A 3PZMA 5LIWX 3NQVA 3RLVA 3SCVA 5FD0A 1AW1A 1XS2A 4L4PA 2VEPA 4RXFA 3W84A 3S9YA 1I1WA 4M1RA 3GBDA 3BQ6A 2XG9A 3GG1A 4F66A 3SCRA 4ZO8A 4D6JA 4RW5A 1Y5VA 4DWSA 2INZA 2PI6A 5A3HA 1EHNA 1T41A 4RJEA 3BURA 3NL5A 4O14A 2C79A 3G6MA 4WRHA 3VPLA 3EX3A 4QQ3A 2Z4GA 4N42A 4AD1A 4QLJA 4R88A 1YNPA 2TPSA 4Y9PA 1PKMA 2A0NA 2EEXA 3LRKA 4D1JA 4HSOA 3DU0A 2F2KA 1AH0A 3T2QA 3N19B 1QHZA 4N6FA 5I24A 3G8EA 3G0SA 4TV5A 1E43A 2CNCA 3GNPA 4C6QA 2PZ0A 1LROA 4ZO7A 1AD1A 3CIXA 6TIMA 2VENA 4KEUA 3DERA 3L23A 3G1HA 1G4TA 1FH9A 4XAYA 3LS9A 1OF8A 3EWXA 1BFNA 2DSZA 4AQLA 1UWSA 3TOPA 3L0KA 4HNUA 3IAQA 3RRAA 3VMNA 4H41A 2QIIA 4Q7BA 1L6YA 2WWDA 4KCUA 4LVBA 2BV9A 4KWWA 3B8UA 1XFBA 4KIEA 3LRLA 3LBCA 3LA4A 3VVGA 4EOUA 1MXGA 1QI2A 1W9PA 4WLCA 4L64A 4JKMA 1IXPA 1PCWA 2G95A 4M24A 4YTRA 4DJEA 4IFKB 4PCSA 2CLMA 1EGVA 4QISA 4LCRA 3RM4A 2D2HA 4F0HA 3HPZA 3MI2A 3LCXA 2YYTA 2B4GA 2VFIA 2XUCA 4QNWA 3NPWA 2WO5A 2YJQA 4FP1A 1A5AA 1JD9A 2WAGA 4GJ1A 2GVLA 3HQOA 3QTGA 3TVAA 4B5SA 3TZFA 1W8SA 2QDDA 3H2MA 2EKGA 4A8LA 2NX3A 2D3NA 1LQ2A 1QT1A 1XYAA 4EE9A 4AVFA 3I7RA 4PMDA 4L1GA 3SR7A 1GORA 4RPPA 3O0FA 1KBLA 1GYNA 3BCDA 2W66A 2XISA 2WW5A 4FSAA 4HZ8A 1W0MA 4LGXA 1DV7A 2ZZ6A 1V3JA 3R13A 3BO9A 1MNZA 1EXPA 2FVMA 4CD7A 4C6OA 1X38A 4K8EA 3H8AA 4XD3A 2VO5A 1V08A 2CZDA 1CI1A 4AAJA 1UKTA 1OG0A 3RX4A 2PLKA 1H0GA 4MB5A 3KBNA 3N14A 3OA3A 1DKWA 3LM3A 2HPIA 1EIXA 3GVGA 4CNTA 1YDOA 1X7IA 4H9UA 3PPGA 4GH1A 3MUZ1 3SQLA 2H3BA 4LX4A 2W67A 4XAPA 1PHQA 3EB2A 4ZA0A 2YCKX 5DCBA 3OBEA 3RYSA 1TWDA 3WLJA 4Q6JA 5CGQA 3UQNA 1NELA 1TWIA 2PGWA 3IIOA 3UFYA 2WPGA 2FZ9A 2V0TA 2A2IA 3F4CA 1TX2A 1LLOA 4HPHA 1EBHA 5I3FA 4LNYA 1R85A 1HIZA 3UWZA 3T2OA 2ZRYA 1M6JA 2EPKX 4RNHA 3UBPC 4B5TA 1B4KA 3NQBA 1ZZMA 5EBUA 1O6IA 1DBTA 4Q22A 1G7UA 5HQEA 1E73M 2I9UA 2BOEX 5CC6A 3GIYA 4XBSA 2IKGA 3KVJA 3L4UA 4X0VA 1PVNA 2A6LA 1IWAA 2X1IA 4CCCA 3VIHA 3FDGA 5K7JA 1VZWA 2E68A 1DPMA 3LI0A 4IPLA 1B54A 2DJXA 1E4NA 1ONEA 2EBNA 4RX0A 3R2GA 1SJDA 1DE5A 4E2VA 3W81A 3WJWA 4BZYA 1R87A 3UWQA 4H9XA 2OMAA 2UBPC 3PAOA 4KMQA 1SVDA 2AMGA 6TAAA 1S2WA 4PN2A 2OTDA 4MNJA 1H1NA 1ZY9A 1G4EA 2ZFAA 5AHFA 2I14A 2PF0A 4ZODA 1YBQB 3QSTA 3QBUA 1JF5A 1QPNA 1J0KA 1NQ6A 1XHGA 5DMLA 4H1ZA 5BXTA 3UG3A 2V30A 3QPYA 4B3ZA 1QW9A 1J96A 1PYMA 1J5TA 4MJZA 5FSEC 5DEZA 3UERA 5J04A 1R3TA 2E6FA 1JUBA 5DT5A 2CFFA 5BU9A 3M16A 3V35A 3A47A 1AD4A 5JMUA 3RCYA 1OCNA 4IGSA 2JEQA 2BBFA 4LAKA 4LCQA 2PODA 3P0XA 4A2RA 2XHYA 3FJ4A 5DY3A 1HJSA 1TQXA 4CGTA 2ZOXA 1S5MA 5C9XA 2HS8A 2WZEA 5GJPA 3FSUA 1VC4A 1RCXB 4H2HA 1KCLA 1O5RA 2WMGA 3CQ0A 3LTPA 1LBMA 4FNQA 3P8JA 1P0BA 4NZ4A 3CMGA 1HW6A 3W7CA 4G6CA 1O5XA 4GG9A 3GBEA 3QOMA 4BI6A 1MDRA 3E5BA 2VDIA 2E9BA 1S2TA 3NPVA 3S2CA 1KTCA 5FJUA 4JAWA 2VM8A 4XZNX 2WVUA 4B9YA 3WMLA 2FDSA 5BWFA 2C0AA 1GTEA 5BROA 4P5UA 3WSUA 1M01A 4LUTA 3S5SA 5D9PA 2WJDA 2IKJA 1J9YA 5HNRA 3ZT6A 4JEJA 1B9BA 3KRZA 5FIPA 2CXEA 3FHQA 4FHAA 4UTWA 2ZX9A 1O12A 2WJZA 4MYXA 3LNPA 3NXFA 2DJLA 3MU7A 1FWBC 1Q6FA 2YKKA 3RFAA 2C3ZA 5TD4A 2ZRWA 4H8UA 1VFOA 1NQKA 2BDQA 1VLWA 4MM1A 3POHA 2I16A 4C6MA 2DQXA 2BVTA 2XTKA 3MUY1 1JPDX 5AYYA 1XRVA 4GA8A 2V3DA 1R9ZA 1XCWA 5D2TA 5F2GA 1S2UA 3H24A 3AZTA 2NT0A 2E77A 2WQPA 4NYYA 1ISVA 4BEUA 3HN3A 2Z0IA 1WPCA 3KL0A 3SURA 5I03A 3ABXA 1IV8A 4WY0F 1DQWA 3WFAA 2AAMA 4LYRA 3R4IA 3CGTA 3FN9A 4AD5A 4QJ3B 1W6TA 1WDRA 1YNQA 1GCYA 1RSCA 3EEGA 4GINA 2E1WA 5AYXA 5HULA 2V67A 2GJXB 5H6HA 1MRQA 2I7GA 3GDKA 2UWFA 3T9PA 4BR1A 1VPYA 2QYGA 4QP0A 1UUMA 1FDYA 2BY3A 1QI3A 4MG4A 3M6YA 3ZZ1A 2P88A 1ELSA 4INFA 5CZSA 2OT0A 4UR9A 3QZAA 2VQUA 3RLGA 1GVYA 3I10A 1EGZA 4ASTA 2O9RA 4J27A 1BLIA 1GYMA 1OK4A 3TYAA 2QEZA 2E6DA 3BLFA 1F2JA 1Z44A 1RY8A 2NQ5A 3KTSA 1UROA 1DE6A 1DWJM 5CSSA 1PUDA 3LHWA 5CKSA 1V51A 2YXXA 1C3FA 1PKYA 4Y9AA 3MSYA 1Q4WA 1D2KA 4TIMA 5A8MA 3ZT7A 3L65A 1HKKA 1MNSA 4B91A 3W0KA 1EJ7L 5I2UA 3C2OA 3AHTA 3IUHA 4JZ5A 3BLIA 1DJGA 3GNDA 1GQKA 4PE8A 4F9DA 3TTOA 2VEFA 3MVTA 2VR4A 3MBDA 2A6NA 3SIMA 4NX5A 4WF7A 5M1TA 1Q85A 2QJMA 4BKNA 2RAGA 1BSIA 1PHWA 5AHLA 3N9KA 5FF0A 2HISA 4UNIA 1PZ2A 4AD3A 3UA4A 7TIMA 1A50A 4P7NA 2JGYA 1K8ZA 3M0VA 4IIBA 3VA8A 3EOOA 5HMFA 3N29A 1EFZA 1E6ZA 2BVWA 4KEMA 5IHRA 1TTIA 3SY5A 3K4WA 2R91A 2F6XA 1VJIA 4ICNA 1GOWA 2E9MA 3GNOA 1FWIC 4JYDA 4B2DD 4UOZA 4MDPA 1VR6A 4DF2A 1HKIA 2ZXDA 1WCGA 3DG6A 2H8XA 4UFLA 1FFQA 4HA4A 3NFUA 1M7OA 3CQIA 1TWSA 3SCTA 3EX1A 4YU1A 1W1PA 2BY2A 1I2RA 3WNLA 3MW7A 3KRSA 3WLHA 2GJXA 2W6RA 3VOHA 3BTNA 3VKAA 1QK0A 1PE1A 2QPSA 1BG9A 3OOQA 3UG8A 3N3MA 1JCYA 1ZJHA 4JCLA 3CM4A 3VGHA 4NSBA 4O0ZA 2FZBA 1MRAA 2D23A 2E0PA 3EWUA 2C18A 2YB4A 4WJXA 5C9WA 4HHMA 3KDOA 1UR4A 2VZOA 2UY4A 3ABSA 1OZQA 2INEA 1OFEA 1HKWA 2SFPA 3M64A 2V38A 2O4QA 3VDBA 4G7EB 1V6TA 3N73A 1U30A 4LU0A 1BTMA 4YL2A 4N9DA 5B7ZA 1SUXA 2WKJA 1N8FA 1G69A 3IARA 2BFGA 4LAUA 3BAYA 5T8GA 2GK1B 3VKCA 1HUVA 2FHFA 5RUBA 1EJXC 3T08A 2X41A 2PDMA 3M4HA 4IWWA 2ADAA 5A6SA 4E3TA 4CQCA 2VX4A 4PBFA 1DHPA 3WK2A 7PTDA 1E3XA 3BSMA 1Z42A 1Q5MA 2QJGA 3CTTA 1BHGA 1XBZA 2Y70A 3C86A 1VIWA 2VEIA 1QNSA 4DZ5A 1QOPA 3EA2A 5LGZA 1R3SA 1SO6A 1QO5A 1XPGA 3I3DA 3SRHA 4POCA 2PU1A 5E93A 4AZHA 1BVNP 1K4HA 4XX6A 5EBAA 2ZTKA 1OJXA 2EG7A 2BY0A 1EWDA 5LIUX 2NUXA 4DYJA 1LWIA 1I60A 3F4NA 2OZTA 5A6KA 1ECEA 4NJKA 3PBGA 4ZB0A 3I6EA 2TYSA 2F6UA 3SZ8A 2ABBA 2Z7KA 4ZQPA 3N25A 1ZJBA 2VRQA 1XDJA 4OECA 5FF3A 4Y9MA 4O8AA 3QHOA 4MOZA 3AYRA 2AAAA 4ZFCA 1H41A 4FF5A 5EMJA 1FY6A 3WJZA 1YTEA 5I78A 4UQEA 3RITA 1XD0A 4Z2LA 4R33A 4WZHA 1YDVA 1J6PA 3ARXA 5HA7A 4MAVA 3VDCA 3DHDA 4UFMA 3AUOA 2H3DA 2I57A 1FCVA 1LT7A 4TX9A 5CPLA 3VABA 1UG6A 2FIQA 3NO5A 3P3BA 2NSXA 5EGRA 1E51A 5JIPA 3EA3A 4DXVA 4DIAA 5E9AA 3K2GA 5JXQA 1YYAA 3BLDA 4HTYA 4P8WA 4C1NB 1W5QA 2INFA 1W54A 4JDYA 2DV0A 2O55A 1OGGA 2CBUA 1CXLA 2V69A 2JE8A 2W5FA 2NQJA 2NWRA 1VF8A 1ZFJA 4HZMA 4GH3A 4GC4A 4G7EA 4DUWA 3W7GA 2OB3A 1GZ1A 1B0IA 3FYPA 1FVPA 2OX4A 2J9XA 1MXDA 4D8LA 3DHPA 4B5VA 1K02A 2ESCA 3AS3A 1PB0A 1QR7A 2G37A 1EXBA 4B3KA 2PLJA 4FXJA 1XIBA 3KWXA 4PRWA 1HO1A 1OC5A 5DANA 3HMCA 3TR9A 3QZEA 3ARZA 3LENA 5ECUA 3VD7A 3WLMA 3F5LA 4NUWA 2UZ9A 3GK0A 4K39A 3WQ4A 3WK3A 2ZCGA 4GJJA 1ZP3A 1ENUA 1ICPA 3T55A 1V5XA 3W29A 1QWKA 3W1UA 4KWVA 2C6QA 5CJNA 1GT8A 1TPC1 3VI2A 1QHOA 2TSYA 1A5NC 2GVJA 3W85A 3QGAC 2ZUTA 5LZLA 1OINA 1T5AA 3NXLA 3P5ZA 4D6FA 3SUSA 3TFXA 3VNMA 2OWWA 1LQ0A 3VKJA 3WJXA 2Z29A 4XSMA 4RR4A 4XQ6A 1VS1A 4CCEA 3ALFA 3LN3A 4EWJA 4JIHA 1SYTA 4C6FA 3W7LA 1QNRA 3TW7A 4B16A 1FDJA 4KWOA 3G5EA 3WK0A 5M17A 1AA1B 8XIMA 1EHAA 3HTWA 5H1WA 1NOWA 3L2IA 3O9NA 1UR9A 1R46A 1RQHA 4NZCA 4ERAA 1E9YB 1Z6KA 3WQ8A 1JZ3A 4UCFA 4TX6A 5DCEA 3V4BA 4HJFA 4GK8A 3LNMA 1U5HA 4L9YA 3UESA 4HA0A 3UF9A 3VOIA 3TYDA 1J0IA 3A9BA 3AXXA 3QF0A 4M8UA 1FDZA 2ZUNA 2C14A 3VILA 3T4CA 1FXPA 4YS1A 1QNVA 4AIEA 1VFUA 2PP1A 5C7HA 2PGRA 4DJDC 1DOSA 3FJ6A 1HNYA 4NNBA 1KFBA 1W1TA 1MDLA 4W88A 1W31A 3TKFA 1W9DM 4XSLA 4C1NA 5CC3A 4PTXA 4AEOA 1UWIA 4Y9OA 3IV8A 4FNUA 3GTHA 3EDKA 3OVPA 3AJ7A 5JIWA 4PB5A 2V63A 2A7RA 3KVKA 3C3NA 1F5ZA 2DORA 3MUXA 2EG6A 4Q3MA 5D4YA 2TMDA 4BQ4A 3VNYA 3CHEA 3PZGA 3ME3A 3V1PA 1AL8A 2Z00A 3K1GA 1M9HA 1LORA 5C0QA 5JU6A 1ZU8A 4JS3A 5ABGA 3U2ZA 3SB0A 3BJTA 1JCLA 1S39A 2DU2A 3NJ3A 3RPTA 3LQGA 3B04A 4HU3A 1MUMA 1W91A 1KGUA 4JTFA 3FVDA 1CPUA 4HMCA 3WD2A 1Z69A 3N11A 1FWFC 2XGIA 3L12A 3C2YA 1XYBA 4AMCA 3Q2DA 3D3FA 2BG5A 3NEHA 4DM1A 1QOXA 5H8PA 4YTQA 1I75A 4WVXA 4P8XA 4AC7C 4HJWA 2V3EA 4LWWA 1UD6A 4O16A 1OVDA 5GQBA 1E6NA 2IUZA 4PUMA 1ADSA 1X39A 2Y8UA 2FMOA 4NP7A 2HV5A 1NJJA 1T7LA 2F7FA 2UY3A 3PB0A 3ZJ7A 2A7PA 3C8NA 2V82A 4H8HA 1A3XA 3GR4A 5D37A 2V5LA 3FA3A 1YPFA 5A69A 1KO0A 3GXFA 4IQLA 4HHHA 3EOUA 3PBYA 3TROA 4J2PA 4MMWA 2CZEA 1BPLB 5HANA 1WAWA 1DWAM 3A64A 4WKAA 4JY8A 3QV7A 4FPSA 4U3CA 1VBRA 3MMUA 4NZJA 4G8TA 4N9EA 2EPLX 5EY5A 5I3IA 4FF7A 4KF1A 3QGVA 3VAVA 2Z25A 4H9VA 1XKYA 1DIKA 1SM9A 1M03A 4IG2B 4R53A 1FWHC 3OVGA 1ODZA 3QYSA 2W63A 5C2CA 2OXNA 2GLKA 3C0JA 4ADSA 3TQPA 2DVXA 5A94A 3ORWA 3MCOA 1S5VA 1UD5A 1KFWA 5FL0A 4EXBA 4PMVA 2J6VA 3KVMA 3NL6A 4P7LA 1CLXA 3L7RA 4AWTA 3B9DA 2PCEA 3TTQA 4XZLX 3CV7A 3N2XA 3BANA 4O0KA 3AU6A 5EMYA 3WQFA 3EKLA 2PD5A 4WHBA 5FI8A 1C8XA 1RBOB 5I5RA 3E9AA 1EWEA 2EPHA 1L2UA 2QCEA 1BF2A 2C1HA 1OEPA 3M0KA 2E28A 4ZB2A 4JFTA 3A21A 3TE9A 4GUGA 1WXJA 2ACQA 2PRMA 4KFOA 3BWWA 2XVPA 3S9IA 3OLEA 3NO3A 2F8QA 1EC7A 4I5XA 1NFPA 1QMLA 1CB2A 2E1DA 5D04C 4AH7A 3NPXA 3U9IA 1ZBCA 1BGAA 3LHVA 2X30A 2OEKA 1C8VA 3W7EA 1M65A 1OFRA 4QFUA 2XSBA 2ZBTA 1W9XA 2CERA 1ZPTA 1IGWA 3VTRA 3KW3A 3BLLA 4LH8A 5DF0A 2P0IA 1C9WA 3B8TA 4AZCB 1WO2A 1Z32X 3PB2A 2QCHA 2VGGA 1FWSA 3ANYA 4O57A 4IGNA 3OGSA 3A12A 1Y5WA 1OFQA 4O4VA 2ACRA 4KCVA 4O12A 2BSLA 3EWDA 2QUNA 3U7VA 1TMQA 1A47A 1EO5A 1HP4A 4M3PA 3SI9A 3W7OA 4K7VA 3L4XA 3TCSA 2R24A 2W9MA 1YADA 1FHUA 3QR0A 2XVGA 3LUTA 3T0BA 4WGHA 3SCWA 1MW0A 3SRFA 3LTYA 1O5QA 4ICMA 1E6PA 3UR7A 2HJPA 2WZIA 4D6EA 2QCDA 4I9AA 5EMKA 3TXZA 3EB3A 2YCLA 2WHMA 1EYWA 1R6WA 3TLLA 2W61A 4F0KA 3G1AA 3GDBA 1CCWB 2PDBA 4L6HA 4FI4A 1N8IA 1XIDA 1SFSA 3UG5A 1PZ3A 2OGYA 2Q8XA 3ZR5A 2ZRZA 1W5PA 1VRXA 3WJSA 3BW4A 1PTDA 2QS8A 3R10A 3PBWA 3WF4A 1H51A 1MI3A 1JYWA 1OD0A 3WNMA 3S1GA 2Y24A 3WCZA 3ARSA 4C7FA 2GQ8A 3ZJ6A 6PTDA 3E3HA 3PHAA 3KP1A 1GTHA 1NF7A 3DFPA 1AJZA 1IHIA 1RJPA 4GLEA 3W6MA 2D0FA 2XIOA 4Z0JA 4Z17A 4GQGA 4F2UA 1BF6A 3BOLA 2DVUA 3NURA 3KDNA 4AD0A 1LOLA 4LUIA 3G3DA 3ES7A 2Q8LA 3CZGA 2JEPA 1YPXA 3U4AA 1V6YA 1JFHA 4Q8MA 1SMAA 4LVGA 2OSWA 3OLDA 3A24A 4AVOA 2J7FA 1S5NA 4JN7A 4F0LA 1SU5A 1OIFA 3H2EA 1FTXA 3TSMA 1IZKA 1TJ0A 5I06A 4H6RA 3DGRA 1F4AA 4UMBA 1W3IA 5A8QA 4ZFMA 2Y7GA 1YE4A 4QIUA 4C6NA 1TELA 3MJYA 2TODA 4MJ4A 3BDKA 2YFNA 2Z2AA 3QV8A 4D6IA 3O6CA 3VMOA 3LCFA 3CUGA 3NTYA 5FL1A 4AZCA 2J7BA 3S46A 3HJEA 4HNLA 4CLMA 1VBGA 1Q2SA 2WVVA 4GQRA 1KQYA 4H19A 4QLKA 3CH9A 5D9OA 1UH3A 4JHOA 4GIEA 3LCLA 3DZ1A 4P8VA 3YPIA 2WJFA 5HJLA 2B7QA 2PDNA 2POZA 3CUIA 4LV9A 2EQDA 3NUKA 3CLWA 3E0IA 3CZLA 3O6AA 2HXUA 2RFGA 4KCTA 2J7GA 2E8ZA 2PF8A 2DEPA 1XG4A 1ALDA 5BYWA 2G3JA 3LEPA 1BVWA 2HDJA 3U7BA 3PBMA 1IEVA 1QAPA 1R2SA 1S3TC 2PZNA 5E1QA 2I5GA 4Q8OA 3TWBA 1Y0EA 3SUUA 4PTMA 4PTNA 3QY6A 3MPGA 3QPEA 2DGAA 3S1VA 3CJPA 4H7VA 3T8LA 1EGMA 3FEQA 4EPBC 4IQEA 2QXWA 1YE6A 3NG3A 4PEEA 2ZUMA 3HGRA 3RDKA 4AYGA 5I3DA 4YVPA 4B4FA 4DJFD 4AXKA 1TTJA 3IUIA 3VD5A 5A2CA 3CO8A 3E2VA 4PUWA 2IW0A 2O7SA 1C91A 2J75A 3D47A 4CQBA 3CC1A 4YWIA 3DENA 5JUVA 4YVVA 3NPUA 3RMJA 1VPQA 1C7TA 2A4AA 4LXFA 3ERPA 2PUZA 2VRJA 2QCNA 1K8YA 1PX8A 1AL7A 1GKPA 3OQ8A 5F2LA 1HJXA 3GIPA 3LMYA 6REQA 3B8SA 3AI0A 3ZXWA 1I0BA 1LT8A 4FX6M 2X0SA 3FYOA 4ZO9A 4GYJA 4QEEA 1JL8A 4H3DA 3BG9A 1JULA 2PGFA 1GYLA 3BGJA 5BXPA 8CGTA 2Z7GA 1RLDA 3LSBA 3ZJKA 2C1IA 3QV6A 5FEWA 4ATWA 2VCBA 2NVCA 4EWND 3RLUA 1A4MA 2BTMA 3JW7A 5CBBA 3GTNA 3HPAA 1P0KA 3IJQA 1J2WA 3QLDA 1CX9A 4ALDA 3MP3A 3BXWA 1V77A 2Z28A 5D2VA 3W72A 2BX7A 2QAPA 3M5VA 2G3FA 3B8WA 1ZLPA 3VX0A 3QW4B 1NH6A 4A8IA 4F2BA 2X2YA 1UBSA 2WSRA 3LXBA 3MI6A 4JBRA 5ABTA 1VKFA 3W1TA 1YNYA 4CNUA 5A95A 1KM1A 3GG8A 7ENLA 1OCJA 3WO8A 4D9PA 1MW2A 4QR6A 1XJBA 3KLKA 3IACA 1B4EA 3UJFA 2FPVA 4PUKA 3KS6A 1XH0A 1VFSA 3RF9A 3T81A 1PAMA 4OKDA 1NDYA 3HBLA 1Y65A 3LPFA 1THFD 1XIMA 1R38A 2NSOA 2J66A 3G3MA 4E2OA 2UV8G 3E38A 4KESA 2V5DA 3EX6A 2V3FA 4IOTA 3STFA 3ARVA 1H63A 3FEMA 3NM1A 1UQZA 1JDCA 3DEQA 3WQEA 3WLIA 4RKAA 1UZDA 3BUVA 2ZDSA 1G67A 4EXQA 3AROA 4H04A 3T2PA 4J5NA 4KERA 3NZPA 4GNKB 1ZNNA 3BLKA 3N12A 4NG3A 2XFYA 2G3MA 1ADOA 2XIJA 3PANA 1XRFA 2YA0A 2QF7A 3PF3A 3VIIA 1XLFA 2QR6A 1OD8A 4RDWA 3I6RA 1BSLA 1EF3A 3UCQA 3DDMA 2PLCA 4ZE5A 4XB3A 3RHGA 3RRXA 1TPFA 4XBKA 3R11A 1VEMA 3E12A 4ORIA 5ABFB 4IICA 3J7HA 1SJAA 3G77A 3RGTA 2NQHA 3WQDA 1GHSA 5HAOA 4C6KA 2ZXQA 3IGSA 3AIBA 4A3QA 1FWEC 4GCAA 4W85A 1BQCA 1DJXA 4L80A 4UZSA 1I2NA 1TA3B 4LRSA 1ICQA 5HMDA 3C56A 2G4JA 3L67A 4PFHA 3F4WA 4JHZA 2EPOA 3QKZA 2F9RA 4OHQA 4MAZA 3PPFA 3KLLA 5LIYX 5K4ZA 1Q7ZA 4ADUA 3TYBA 1X1OA 3E5PA 1FFRA 4HIBA 1FWDC 4JQ4A 3HU7A 2E40A 2O7QA 1VENA 5A8NA 3WK1A 5GNYA 4X2RA 3R6IA 1DIOA 2H8ZA 4NXSA 3HZ3A 4LAZA 1IYXA 3DOPA 3M07A 4WSKA 2FHBA 3FS2A 5MKGB 1JPMA 3W24A 1F4HA 3P7YA 1GKRA 3WBAA 3RILA 1KR1A 2CESA 4J4KA 5LNRA 5JH1A 4S38A 3UA3A 4HKPA 4Z1DA 1LRTA 1F74A 2CHNA 2YFOA 3RMEA 4ZBCA 1H7RA 4NNAA 5EPDA 1K8XA 1Q8AA 4EF9A 4G1NA 3NQ8A 4Q4MA 4ZR8A 1H50A 1IGSA 1XICA 1CTNA 3D3AA 2POTA 5AC5A 3MMWA 1N2VA 4HT3A 4IXHA 4L56A 3UNTA 4AHQA 4X63A 2GUYA 5G1MA 4FK9A 3UZ5A 5F2IA 4V1XA 5H8MA 4U5KA 4WIWA 4LF2A 4KT2A 1RD6A 3BH4A 3MKVA 4JY9A 1E56A 3R0KA 5CZKA 3AIQA 3S2MA 3IJDA 1DJZA 3LK6A 3KZSA 4M7SA 1RA5A 4ZQOA 3ZFHA 1CXFA 2EKCA 4ZB5A 3SGGA 1UR8A 2VUYA 3ATYA 1UR0A 2XGBA 4JN6A 1E6XM 1JPKA 3NGJA 5XIAA 5C70A 1XH1A 4H8NA 2QVNA 3WLQA 4LVAA 1CIUA 2Z1XA 2E09A 3W83A 3ZLHA 2CXGA 3EX4A 1RALA 2ZRUA 1TX0A 3T05A 3ZVHB 3QM3A 2OWXA 2DIEA 1V8EA 4B4HA 4JTSA 3HJZA 1W2PA 3NL3A 3C2RA 2ONEA 2Z24A 1UR3M 2ZRXA 1V7YA 1VD6A 3ES8A 5CBIA 4WR3A 3TNOA 4QS6A 3NSMA 2ZUWA 2HEJA 3IIPA 2Z1WA 2OSXA 5DRCA 1LUCB 4D71A 3GHUA 5D32A 1X97A 2EO7A 3UJ2A 3W7PA 3S6TA 1Z9AA 5ABHA 4RNFA 2NQ9A 4WSJA 3TSBA 3CIVA 1JPIA 3A4XA 1W3NA 4BF9A 2QUVA 4G9PA 3SUVA 3O0KA 4D6GA 3UETA 3HFTA 5FAJA 3MHUA 4GVGA 1GVEA 4IJBA 1TZ9A 1X8FA 1A49A 1E0VA 1RV8A 2XVLA 4IUOA 3T0TA 2CLLA 2CU0A 3GWQA 3DFYA 3RAOA 1DHKA 3U4FA 2PE4A 4EK7A 2OODA 4K3ZA 6CGTA 3S47A 4NIRA 3VUSA 2BOFX 1XC4A 4O19A 4PBGA 3W7NA 3DKJA 1KM6A 1AFSA 1EKOA 1Q8JA 4QNEA 3VOGA 2VZUA 5MKGA 1W5NA 1JZ5A 5LIXX 2Y63A 1X7FA 3FXYA 3M1ZA 4LSBA 3VIKA 2IPJA 1Z7AA 2R1PA 2D22A 2VD8A 4AF0A 3P74A 1MZHA 3QXBA 4LYKA 4A22A 2CKSA 1R3VA 4HTBA 3WEZA 3AIVA 3OO2A 3GHRA 3BAJA 1CBGA 4GACA 4LQ1A 3N6HA 1GQJA 2ISVA 3E02A 1TUFA 2Z2UA 4M6UA 3W2UA 1VP5A 2JK2A 4YWSA 3TA9A 2GJLA 4E4FA 1CEOA 4MZ8A 1MW1A 5FJRA 3PBVA 4AG0A 4GI6A 3GTXA 2Q3RA 2F2HA 3LCIA 1W2VA 4ZOBA 4A3YA 2ZZ4A 4E8DA 2IPFA 5E5CA 3TJXA 4PB3A 3W6LA 2P76A 3UJEA 2WWCA 3MO7A 2ABAA 5FJPA 2XGZA 4DBWA 4G2DA 4DVOA 1PJ9A 4JNZA 2OLSA 3URQA 1EPVA 4XO7A 3DFOA 3I7SA 1AQ0A 1KC7A 2DVTA 2H90A 2X1SA 4C65A 3EYPA 4XK2A 2Y4SA 3GO2A 4WKFA 3FAXA 1CT5A 4C7GA 3BGGA 1SO3A 3LV6A 3W7JA 2PGEA 3HF3A 3OP2A 3HGSA 4IHCA 5LYRA 3G1SA 1Y8BA 4X61A 4S3EA 3TUUA 4BQ2A 4JPGA 2DW6A 2ZVRA 1LM1A 1L6WA 1LQAA 2PDYA 4HSHA 4Q4RA 3LHYA 2GYIA 1S5WA 1KCZA 2RJHA 4DBUA 3HA1A 1O4UA 1I2OA 4UUIA 1YDYA 3C8FA 2BHYA 1AQFA 5AOUA 3NQEA 1H61A 1XX1A 2ANUA 1T8XA 1AW5A 4RZ4A 4AEEA 2HPMA 3B9EA 3MZ2A 4UB9A 3T78A 2RDUA 3PM6A 2NZLA 4J40A 4BQ5A 1KLYA 4S3GA 3DN5A 4LB4A 3LM7A 3U8GA 4RCXA 4KKXA 1W1IE 4K38A 3NQDA 2OO0A 2DT0A 5HWMA 3FA5A 5KZ6A 4MB4A 2DZVA 6A3HA 3L4VA 1LWJA 4XZ9A 5FJOA 3G1RA 3R94A 3HPXA 5HPOA 1C9DA 2YPIA 1V6XA 2GZXA 2GSJA 1QVBA 4LTSA 3ID7A 1VFMA 3KE0A 4KQNA 1TJPA 2WQDA 4HYRA 5FF7A 4AUBA 5JBDA 1DXEA 4J3ZA 4HCHA 3R25A 4CVUA 3ABRA 1XGDA 4QG6A 5HK4A 5LNUA 1GZGA 2PDHA 3A23A 5EYWA 4RNIA 4KEVA 3W2MA 1MFVA 2WCSA 5GVJA 3MUIA 3EDFA 1BRLA 3LBOA 3VD9A 5CAHA 1WXZA 2I5QA 1HKMA 1D3GA 2GJNA 4YTSA 1V0KA 1ZJAA 3PUEA 4CNOA 2XIIA 2DZUA 4LRTA 1EDTA 1FUYA 1ZSXA 2PTWA 3AIWA 4S23A 4GWEA 3DKLA 3SCUA 2YLLA 2OQYA 5D8WA 1CENA 1TVPA 2IXVA 1IZJA 3WDIA 1L9WA 1M1BA 2WK2A 3AXHA 2GVGA 2PDLA 5ECVA 1RY0A 5LA2A 3ZIZA 3RM8A 2Q71A 4WDXA 3AC0A 3F1QA 5KINA 4OBTA 2V3GA 5MF5A 1TPWA 4E2DA 4C6BA 5T26A 2YCJA 4FR6A 1R7OA 2PDUA 3N1AA 3FKRA 4GUJA 4DX3A 4MKVA 4H01A 1UH4A 1LLZA 4D2JA 3S5ZA 3JU2A 4GFIA 4WK9A 3H54A 3O3RA 2QKFA 4GYPC 3H2OA 4UQBA 2J8GA 4NQ1A 1XC6A 1UKQA 1C93A 1R3WA 2WMJA 4DI9A 1QUMA 2FVLA 1YEYA 2WZMA 2DQWA 3VD4A 4V2XA 4UQAA 3JRKA 1EP2A 3MP4A 1I9CB 1GJWA 3PJWA 3LLXA 3M5ZA 5HUOA 1ZRQA 5E0KA 1IEIA 3CMFA 4I5RA 1PV8A 2R6OA 4ZSTA 1EJTC 4ZOCA 2VEGA 1O94A 3VE9A 7ODCA 4XD6A 3I7QA 1AVAA 1RR2A 3O15A 2DIKA 4ZENA 4FAMA 1MXSA 1G01A 3GC2A 4U33A 4E38A 2G41A 1MFUA 5BOFA 1KFLA 4JIIX 2FZMA 2GDVA 3CLMA 2OPJA 5IBXC 4JTUA 3B4YA 3ZWTA 4FOJA 2PWGA 2DT2A 3EKGA 4NZFA 4NU7A 3CHVA 3AMGA 2HBXA 1EDGA 1CW2A 2VI0A 1PCKA 3W00A 2HWGA 2Y0FA 4JYEA 1LBFA 3PUOA 1BWKA 1PS9A 4JTDA 4X9YA 4B2DA 1EPXA 3AHVA 2BVYA 3TMQA 2WVSA 2VFFA 4DPPA 4JNYA 4PR4A 1FRBA 3VM5A 4TR9A 1JUKA 2QIWA 1QI0A 3N17A 4DM2A 1OX5A 3VZXA 2ZRVA 4ZQRA 1GG1A 3U6WA 1F6PA 3T7VA 5I3GA 2C1GA 3TTSA 1IT0A 2VTFA 3DI0A 1OFBA 4QJ4B 1EYEA 1UMYA 1B5TA 3WG6A 1E40A 3CL7A 5F4WA 2FDMA 2ZQ0A 3W71A 1ONRA 4OBRA 3I3EA 2ACSA 4ZZ9A 1X6UA 4F79A 3W38A 2D24A 3WD1A 2V6AA 4PUJA 4EXAA 2IQ0A 1X1ZA 1WZKA 1NOUA 4ZOAA 3B03A 3TSDA 3FJLA 1HXJA 2CBJA 3L4WA 3K30A 1SZEA 3W7MA 1T0OA 2X1UA 3WH8A 4YYCA 1XSKA 3TAKA 3GE7A 4UWMA 4LALA 4MUPA 1SR9A 2XN2A 4XG1A 3OPSA 4KIRA 5IFPA 4UNLA 1S1RA 4D6DA 1XRSA 1Q6RA 2W27A 4PUEA 5K9XA 5G1YA 3OZOA 4WDWA 2DSUA 1P48A 2XH7A 4A8RA 3VDGA 1CWYA 3FSTA 3WD4A 3U48A 1TJRA 1E3ZA 2YDRA 1LTDA 3CQKA 3NQFA 5FJIA 3A13A 3K4AA 4MJ2A 4HQVA 1D9EA 3KCJA 3S2NA 2G8ZA 3ZR4A 5I07A 3K46A 4HPGA 3NDYA 4AMAA 2OX1A 4MB1A 4NI3A 3R43A 1Q6QA 5C54A 4AU0A 1XF0A 1FCBA 4O1BA 1JNDA 1XBVA 4UOJA 3S5NA 1FCUA 3KEHA 2J7DA 1DIDA 4LT9A 1JR1A 4WJ8A 1XG3A 4IM4A 2G3IA 1IR2A 4J35A 2PDFA 1XLCA 4R7JA 5IHSA 4RZBA 1EDQA 3MC5A 2PTXA 4R3UA 1T99A 3UPMA 4OTKA 4EP8C 2ON3A 3LG3A 1GVOA 4WOQA 3SECA 1C8QA 1H7PA 1LG1A 1IF2A 2OWCA 2XN1A 3AMCA 2YXOA 1GOXA 4DUOA 1UB3A 4GHRA 4NZ3A 4IF2A 1Z89A 2GDUA 1W17A 4ZTYA 1M68A 3EPOA 3Q45A 3MTWA 2YGYA 3NQMA 2VCCA 4W5ZA 5BWAA 5CPNA 2LLEA 1WAUA 4LAOA 4RZ5A 4F48A 3ARUA 1D3CA 3QQ1A 4CCZA 1QWGA 3EAUA 1IT8A 1J4EA 3CAQA 3LV5A 1U2YA 2FZDA 2OYLA 1EBGA 1X98A 3N34A 2OYKA 4DJFC 2H6RA 5LXEA 1XCXA 4H8VA 4IIDA 1L6SA 2VQTA 1FWWA 4DAFA 3SGZA 2YLAA 4YIWA 3K8MA 1K6AA 2VP8A 2PBOA 3GU2A 2MNRA 3GC5A 3APTA 3EXTA 1XKJA 2JKPA 5J5DA 1VCFA 2VURA 1RZMA 1C29A 4Q4QA 3FCPA 5GNXA 1NEYA 2WNWA 2D69A 1KCXA 1ZBKA 4O53A 4IMEA 4BEQA 4Q8WA 4FOUA 2VOTA 4XZMX 1SW0A 1GPFA 1QTWA 4HVXA 3VKBA 3CPRA 2HXTA 1UASA 1QHPA 4JX4A 4PZVA 1K3UA 5E0CA 1S38A 4QGCA 2MANA 4JIRA 3H2AA 2HE8A 1F3TA 2AL2B 5AHIA 4J28A 2QGYA 3VCRA 3V18A 4JICA 1VB9A 3ANVA 4DN1A 2WC3A 3EGJA 1FQ0A 1WV2A 2X42A 4DJDD 3QMTA 2Z6IA 3VYLA 4W8AA 4FA3A 3W6YA 1M7PA 4UFIA 3B3DA 3W76A 3DHFA 1TPVA 4TTGA 3A6OA 1U1HA 3A3XA 3H4WA 3E49A 3ZLGA 1WQ5A 3CUJA 1E6QM 4H7CA 1P7TB 1D8CA 3I3BA 1VAHA 3GSMA 4W9TA 3THDA 1UD8A 3WLPA 3LU2A 4PULA 4M6VA 1BXBA 4Z2KA 3CO4A 3KBVA 4AEFA 5EFDA 5C7VA 3KXQA 3DG7A 4FOKA 2I9EA 5KMYA 4KBXA 4OE7A 3VCNA 3P0WA 3BMVA 2I17A 3IGUA 2PTDA 4AHOA 3C0QA 2QCFA 1PKNA 2ZXBA 5CH9A 4GVHA 3GUGA 3IGXA 1EJVC 1T8QA 3TOYA 5BOOA 1QATA 2XZ9A 3VZYA 4FLRA 2DZBA 3W2LA 5BRQA 1V6UA 2QAFA 5C55A 1LLWA 3GAKA 4DLFA 1VYPX 2D3LA 2J9ZA 5FF2A 3UWYA 3H70A 3VU2A 1ZAJA 2I5IA 2OSYA 1SFJA 3GYCA 1I8JA 2X7WA 4L65A 1P6CA 1HGWA 4JXCA 1KFKA 5JBFA 3OJGA 3UD6A 2BOGX 3L5LA 1V0NA 1P0EA 1SFTA 3PS7A 2XIMA 2V2CA 5D9NA 3AMDA 2Y7EA 4HHPA 3VIMA 4Q8TA 2QCGA 2DZSA 4JFUA 3QGKC 4O15A 4TTUA 3T44A 1MQQA 3AMKA 2J7EA 4O50A 1G0CA 5K9CA 5A1AA 4QQUA 2J47A 1D7KA 1P43A 4CN4A 1KFJA 2XZ7A 2E25A 4LBSA 3GXDA 1DQXA 1WKEA 1UA3A 3G2GA 1UWUA 2WVTA 1OT1A 3IUDA 3PN8A 1JXKA 1A0DA 1UP2A 5DMMA 1F3XA 1OC6A 5I00A 3GY1A 4DQWA 1VQTA 1UIPA 2AL2A 4MF4A 1CGTA 4Q33A 3H12A 3W22A 1MVYA 1REQB 4ATDA 3DXIA 4LCSA 1V3IA 4TVCA 1W5MA 5TIMA 3WLSA 3PJXA 5M5DA 3P93A 1ADDA 3CV2A 2DSVA 3M0YA 3W07A 1TCMA 4MYAA 1W9UA 3CZKA 8TIMA 4HMEA 2FYMA 5JBEA 1B2YA 3M7WA 1CB7B 1TTQA 1QI4A 1UP3A 4W86A 3WLTA 4AZIA 3PZIA 4TOQA 1MQPA 1VEPA 3IJ7A 1B90A 4DBDA 4XD5A 1QNOA 2I1OA 1JCJA 2EXOA 5G1TA 3TONA 1P1XA 3CUFA 1HKJA 4GO8A 4S2CA 1LRQA 1L6FA 3CHCA 1T6MA 3FIGA 1XXXA 1ZENA 5EKYA 1HG3A 3ZSSA 1GVQA 3D46A 2FGLA 4N4PA 2ZIDA 1AJ2A 1ZJIA 4NJJA 3GRIA 4GQQA 3S6OA 5BMXA 3CL8A 3ICJA 2YSWA 1GQIA 1XPYA 4JTJA 4JFVA 1P0DA 2V2HA 4YYFA 4S3KA 3BLOA 1E9ZB 1NVMA 2OZ3A 2BWGA 3H55A 4FLQA 5FA5A 1R47A 3H2NA 1EX1A 2Y88A 3TAOA 1C90A 1UKSA 4GXWA 3N2OA 3AU2A 1VBJA 1XINA 1J18A 2V5JA 1H49A 2G50A 5FEXA 3W75A 2HE5A 4R27A 2VR2A 1OC7A 4W8LA 1SJCA 4DPQA 4IFKA 3SCNA 2NXIA 4H9TA 4K2SA 3QJAA 4DO6A 3AYTA 1L8PA 3F4DA 3PZVA 1WDDA 2ZKMX 3GDRA 2WHJA 4V27A 3TLQA 2BB0A 2YZRA 1GZJA 4LS1A 4N7QA 4OOZA 4GYPA 1V3HA 2A3LA 3MHFA 3SO7A 5A2AA 5EMLA 2WBGA 3O16A 4O0QA 3GH7A 1SZNA 2B7OA 4JTTA 3TA6A 2W4XA 1EOKA 3B05A 1SSGA 3I65A 1TPEA 3CV1A 2WSYA 2A3CA 3ITTA 2XVNA 1OB0A 3E6EA 3NQAA 3TU9A 1DJIA 2D2JA 4QDPA 4W87A 4ADTA 4YHGA 3WQ6A 2QCLA 1JDEA 3QC3A 2HTMA 4F3HA 1REQA 4J3WA 5AN7A 3NOYA 3OHIA 1ZCOA 1E5NA 3MZNA 1GOKA 3TX9A 3RLHA 2ZWYA 3WJYA 1JG9A 1GEQA 5C71A 2YA1A 1E5JA 4GUFA 5L9FA 2G3NA 3SN0A 1V0MA 4CU8A 1K7XA 3KOZA 3BW2A 1J2BA 4NY2A 2PB1A 2ZX8A 3DYOA 5CPSA 3ITYA 3M46A 5IBXA 1KV5A 3FJNA 1W3KA 3AFBA 3HPFA 4PMZA 4ZQCA 5GJNA 4UTFA 2QQ6A 4BK9A 1HJUA 1OGBA 1TRDA 2Z27A 7A3HA 4LUYA 5A6BD 2ISWA 3SQMA 5AB3A 5AC4A 2E67A 1NFGA 3W1QA 3LZ5A 4UQDA 4UTJA 2XH2A 5GJMA 4WOZA 1RUSA 3UZYA 3BAWA 3T09A 3URBA 1WKFA 3HIJA 3RO6A 3C6CA 3GFZA 2ALDA 5H2ZA 1CXHA 3TXVA 3EMQA 3BZJA 2PC4A 4NYUA 3KBMA 3RG6A 5REQB 4XISA 4DUVA 3UYCA 2W79A 3L5AA 1M53A 2GPTA 1S1PA 3H2FA 3U5YA 3RPDA 3TTEA 3TW9A 1VIZA 3PP7A 2VJXA 4C60A 1GUVA 2Q3OA 3F4VA 3LY0A 1RVGA 2WKLA 5LA0A 5KETA 1XISA 3C2EA 2WNNA 2VZVA 3B8IA 3UWWA 3VNZA 4NKCA 1P5BA 2HNHA 1CGXA 2WM1A 1TKKA 1B3ZA 2XWDA 1KRAC 4XAZA 1Y7VA 1YBQA 3H7UA 4QM1A 2ZZ5A 1QBAA 1Z48A 5T9BG 3VIGA 1F8MA 2NW0A 3QMSA 4TV6A 1GOMA 4CD4A 1RQBA 3TP4A 1TUXA 3APYA 3TN4A 2PS2A 1V79A 3OA5A 1UHVA 1EEXA 3U2CA 3B8VA 4HMDA 3A3WA 4KRUA 4DHGA 3E96A 3XINA 3ARTA 4QCFA 3I6TA 4I6KA 2J88A 4LB3A 4DO4A 4IP4A 4UTTC 3W2KA 4O4WA 4K7YA 4QEHA 4PTWA 3DI1A 4CN1A 3FXGA 1XIEA 3VDAA 1WXYA 1J0YA 2VVNA 3EMZA 4JCMA 1DWHM 3CUHA 1TMHA 2NQZA 3VGBA 3S0CA 2JIEA 5BW6A 2ASHA 1Q6OA 3RU8X 4FX7A 4HCLA 2XIQA 3KAOA 4D6HA 2RDXA 2H9AB 1XR2A 5I7GA 1UP0A 3KOYA 4F0MA 3C2FA 3RO8A 1OFDA 2CZFA 2G4FA 1KR0A 4YTUA 1PX4A 1TIWA 3RJXA 3VXGA 1ICSA 1PEZA 3T0DA 4GQ0A 2PMQA 3FNDA 1JQXA 1D8WA 2C91A 4JQ1A 2ZZ2A 5A6TC 2OG9A 1KBKA 2HK1A 1J8VA 1RJRA 3IVSA 2EPNA 1E4IA 4M80A 1O95A 1A0EA 1U5VA 1UC4A 3M0IA 4KGJA 3E0FA 3Q65A 4CNPA 3CWHA 5PTDA 1B30A 1GHRA 3GXNA 3EPNA 4JKLA 4A35A 1QNPA 2QF8A 5I3JA 3G1DA 1FHLA 4MNMA 4Q4KA 2GDQA 2HNEA 4AWEA 2QW5A 4G56A 5IRPA 3WQWA 5AVHA 2PWEA 2CWXA 2NLYA 1GVSA 1KKOA 5CPMA 1EA0A 2CIPA 1US2A 3RJYA 4D8AA 2IS7A 5HNTA 1H7WA 2R1KA 3CHFA 2XU2A 3CB3A 5E0FA 3SRDA 4IP7A 4MY1A 5LSMA 3K1DA 4C91A 1JYXA 4AW7A 4DJFA 4TUFA 3APGA 4ZXOA 4XUYA 2O0TA 3B40A 2Y62A 4BWLA 4JTLA 2ZZ1A 2V9DA 4BY3A 5DMNA 1K70A 1SGJA 4NZ5A 4H7ZA 3SFWA 1G1YA 3STGA 1OFAA 3H2CA 3UG4A 2F6KA 2DUAA 4E4PA 3H4XA 4K68A 4GKTA 2PEVA 5M3WA 3FHAA 4U10A 1DXFA 5DLCA 3EZ4A 3BMXA 1R0MA 3G0UA 1JZ2A 5DO8A 1NIUA 3HGJA 1GW1A 1XRTA 3K8LA 5K2ZA 3SY8A 2PWUA 1F61A 3LX9A 1V6WA 3PZTA 3G0XA 4DYEA 2VNCA 2VEKA 3V5CA 4ZEPA 4NT0A 1WZMA 3TZNA 3ARWA 3NZ1A 3B9NA 1LYXA 1XLDA 3SW6A 3OG2A 1I0DA 3BMWA 1RBLA 1BWLA 3KL5A 1LL4A 1ITUA 1PTGA 1EX5A 1XM3A 2OLHA 1POKA 3F5KA 3R8GA 3S2JA 2QCMA 3MS8A 2FH6A 1BKSA 1FOBA 3B0XA 1RAKA 4V33A 4LC8A 1XLJA 5DBTA 4DF1A 1KQZA 1RHCA 3M47A 5AYZA 2IQTA 1R2TA 2FZ8A 1FP9A 3W87A 3QOKA 2E4TA 4QRNA 3DC8A 2PLMA 3L21A 3BICA 2QV4A 3QVQA 3LLDA 4QAIA 4PUDA 4OOUA 3ZMRA 3ZSTA 1B1YA 2Y85A 3EA1A 3IIZA 1JDAA 3W3OA 4H6EA 4GE8A 1HL8A 1RJQA 4K1WA 9XIAA 4N9BA 3QR1A 2PDKA 4GNVA 3CIWA 1TV2A 4JD4A 4MNLA 5CZTA 1VFLA 3JVAA 3NZRA 1UH2A 3K5XA 3PPHA 2P0OA 1SQ7A 4BFAA 4OU1A 2FMNA 4D8ZA 4QAWA 2BP1A 1OX4B 3V5FA 4QROA 1JD7A 4TQTA 2FPYA 4MKSA 5ENLA 1QPKA 1I1XA 2YW4A 2V5BA 4HZ7A 1TSIA 4NX0A 4GABA 4CKQA 2DPEA 4L1XA 4UOQA 4HHLA 3CPUA 2IPGA 1XQLA 1M3UA 4KW2A 4S39A 3HFYA 2FQIA 2WSPA 2CITA 3T0AA 1AZ2A 2GWGA 1G5AA 1WB0A 4J1OA 1UPPA 4CN6A 1S2VA 3W7KA 1WOBA 1F6YA 3S5OA 2G5WA 4GCXA 3POCA 1AH4A 1NM9A 4XV0A 3ITLA 1J5SA 2B7PA 1IZCA 1CLVA 4WCJA 3L5MA 3VC5A 3UR8A 1AQMA 3ISIX 4Q32A 2J27A 3OZPA 2X09A 4HZ6A 2QUMA 1W1B1 2GSEA 3GXMA 4UBPC 5A8GA 1UUQA 3N04A 4O1DA 2P1FA 4GZJA 3GKFA 4MTVA 4ILSA 4C90A 3B4UA 3G1VA 3UY8A 4Y96A 3A9IA 4IL0A 5DXXA 1R7AA 1FKXA 1DXIA 1Q7MA 4HNNA 2CPUA 1VLIA 2P3EA 1AJ0A 2BGQA 1E1FA 3U5UA 1YPIA 5FJTA 2J6XA 1R3RA 4P2VA 5K3VA 3UPWA 1W1ZA 1KRMA 3GXIA 3H6OA 4FNSA 4PC8A 1A5SA 4U3AA 3B9OA 4MDOA 3QY7A 1R2RA 1JFXA 1E4MM 1NWTA 2GK1A 1IXNA 2ISDA 4IMFA 2CKRA 4N02A 1LL6A 5CSYA 1JZ7A 4JYFA 1FXQA 3BE7A 3SGUA 3TK7A 3W7DA 1LG2A 5DCDA 3BAKA 3BG5A 1PIFA 3GFXA 3QV9A 4PMUA 8A3HA 2V8ZA 3CUZA 4L61A 1KCKA 3W53A 2QJHA 3KS5A 3GDMA 4A4AA 5FACA 3S1WA 1E0WA 1E70M 6ALDA 1ISWA 5E70A 1KTBA 3AUJA 1FWGC 1FBAA 2WM0A 4R7OA 3LDVA 2WKGA 3NOEA 1LJYA 3ALGA 3I4KA 2XYLA 1TV3A 4L9ZA 1ZHAA 2GOUA 4S3AA 5AHNA 1A5CA 3URAA 2QLYA 4I9TA 2VX7A 1GPWA 2WZHA 1W5OA 1W32A 3M0JA 1XQKA 2NQLA 3NWRA 3UGRA 2FJUB 1HZYA 2NUYA 4PODA 2E3ZA 5DMYA 3W1RA 1JVNA 1D7FA 4DBEA 2A3BA 5F1UA 1EJUC 1YRRA 3FV9A 2TRSA 4NJHA 4J3TA 3HG2A 2BZNA 2VYOA 3QC0A 3VM7A 1ONXA 1XLLA 4FO4A 3N9RA 1HX0A 4NL1A 1XSIA 2OGJA 1ZCCA 4GBDA 3P80A 2W3ZA 2BHZA 4ZOEA 4EIVA 2CWNA 4C1KA 4PCFA 3SN1A 3EPMA 3THAA 4AIBA 1TQJA 3W28A 2HVMA 3UVAA 3P67A 2JALA 3VIFA 2OOFA