2DDXA

Crystal structure of beta-1,3-xylanase from vibrio sp. ax-4
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
324
structure length
324
Chain Sequence
LDGVLVPESGILVSVGQDVDSVNDYASALGTIPAGVTNYVGIVNLDGLNSDADAGAGRNNIAELANAYPTSALVVGVSMNGEVDAVASGRYNANIDTLLNTLAGYDRPVYLRWAYEVDGPWNGHSPSGIVTSFQYVHDRIIALGHQAKISLVWQVASYCPTPGGQLDQWWPGSEYVDWVGLSYFAPQDCNWDRVNEAAQFARSKGKPLFLNESTPQRYQVADLTYSADPAKGTNRQSKTSQQLWDEWFAPYFQFMSDNSDIVKGFTYINADWDSQWRWAAPYNEGYWGDSRVQANALIKSNWQQEIAKGQYINHSETLFETLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution analysis of beta-1,3-xylanase catalytic module from Vibrio sp. AX-4
rcsb
source organism Vibrio sp.
molecule tags Hydrolase
molecule keywords beta-1,3-xylanase
total genus 135
structure length 324
sequence length 324
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ddxA00
1UKSA 1NQ6A 3BSHA 2VX7A 3B9EA 2VT0A 3WF4A 4P8UA 3FY1A 4AZ7A 1CNVA 3GXFA 1KBKA 3AS3A 2WW5A 4ZE5A 1PBGA 1R86A 2E0PA 3NSMA 2J4GA 2Z1KA 4EKJA 1C90A 2J25A 3WKZA 3T2QA 4C7DA 3VGHA 4UQDA 4CN1A 2PF0A 3RCNA 3WEMA 2G3MA 1GZJA 2GDVA 2J7EA 1FA2A 1B90A 4CGTA 3QOMA 4AIEA 1UZ1A 1CXEA 1SMDA 1KQZA 3AIEA 1KGWA 5KZ6A 3JUGA 3WUEA 1M04A 3SEPA 1E1EA 4UR9A 3HJEA 2JIWA 5BROA 2V3DA 1FH7A 1C8YA 4CD7A 4MJ4A 1O6IA 2XWDA 4Z2HA 3OBAA 4AD4A 3WENA 1JAEA 3F5KA 1GUVA 1M7XA 1Y7VA 3K1DA 1OCQA 1UH3A 3AJ7A 3CZLA 2G3JA 1EDTA 4MB5A 2YIHA 3CHEA 2WHJA 3NCOA 1WAWA 1FFQA 3OGVA 1MWOA 4HZ6A 4JL2A 1D3CA 3FHAA 1TR1A 1V02A 4EAMA 9CGTA 4NI3A 1BPLB 2GVYA 3N1AA 5BXPA 1JNEA 2YA2A 1ZL1A 1G0CA 1OT2A 1LL4A 4XV0A 2XSAA 5CSYA 1HJSA 2V38A 4U3AA 1PIGA 4F9DA 4HP5A 2DIJA 4TVCA 5CPQA 3MO4A 4TTUA 3AIBA 2GJPA 1W1PA 2XM2A 4P8WA 1UA3A 1J9YA 3SUUA 1E3XA 3VU2A 2WPGA 5HDRA 4J7RA 5I6SA 4PTMA 4D6EA 4HOXA 2WNWA 1JI1A 1J0YA 1SR0A 5DFAA 4OIFA 4LXFA 4HOZA 1ZS2A 3ZJKA 3WDQA 1EHAA 1LL7A 3VX0A 1UH4A 5DT5A 5HBFA 1EDQA 4H2CA 1B9ZA 5ABFB 2W66A 3NSXA 1P6WA 3MANA 2JFEX 1HKKA 2WZEA 1J0HA 1V3KA 1TCMA 1JDDA 4KRTA 1QI2A 3GH5A 4AD5A 3NSNA 3VGBA 2V5CA 3OGSA 3OLDA 1I1WA 3ALGA 2WB5A 4GXPA 3QHNA 2VOTA 3BLKA 1QBAA 1HKMA 2CITA 3WH6A 4N0RA 3UEQA 4DWSB 1FH9A 1UWQA 2YBUA 4MB3A 3ZT5A 5AYBA 2V5DA 4PTVA 4U5KA 3UERA 1H5VA 3WDJA 4FF5A 1QW9A 1HIZA 1QHZA 3AMGA 2YKKA 3ZSSA 2X1IA 3RM8A 4MAZA 4ZXLA 4PMYA 4AZCA 3I3DA 3VMNA 4D6HA 3AXIA 3BGAA 1YQ2A 2JF7A 4LYRA 2ZUTA 3O9NA 2VQUA 3CZ8A 3BAWA 3W29A 4CVWA 4JFSA 5JIPA 1UQYA 2QMJA 1NP2A 1CPUA 1UWRA 4R5EA 2D23A 4RE4A 2DH2A 1E73M 1HJQA 1WNOA 3CMGA 1QOXA 1GOOA 5CJ5A 1GVIA 5BWFA 4IPNB 3SCSA 2XTKA 4PN2A 1XCXA 1GVYA 5A1AA 4H04A 2XVGA 1ZBWA 3MSGA 3VIPA 1B3WA 4KRUA 2UWFA 5CPTA 2CETA 3GH7A 4UFIA 3AIQA 1OIMA 2E3ZA 3KE0A 1BGGA 3U5YA 5BYWA 2BHUA 2G41A 3AMKA 5A8NA 3N11A 3ZSTA 1J01A 1WZAA 4CCDA 1FP9A 3MMDA 4MNLA 1XH2A 3M7SA 4JZ5A 4ZXOA 3THDA 2XPKA 4GKLA 2XG9A 4UTFA 3MV11 3AQUA 2A3HA 1W32A 4U5IA 1V3HA 1A3HA 3GDBA 3WNOA 2GSJA 4AZCB 1PAMA 3OLEA 3L4WA 4JKLA 2XSBA 3N9KA 2DT3A 2ZXBA 2BS9A 4GZEA 1C8QA 1AQMA 1EXPA 4QDMA 3W38A 3N04A 1US2A 2BHYA 4PYSA 1ISXA 3WBAA 3ARVA 1WO2A 1RP9A 2FHCA 4P7OA 3EMQA 2OWCA 1JD7A 2Y5EA 3WUFA 4A3YA 4JKMA 4K68A 2CBJA 2NSXA 3RM4A 1HF6A 3DYPA 1JZ6A 1WZLA 1V3JA 2DSKA 4C7FA 5EBAA 1G9HA 1GW1A 3RILA 4E4PA 5ECUA 4J3TA 3WDIA 5KEZA 5D9PA 1C91A 2J7FA 2VCCA 3CZEA 4FLOA 3K8KA 4ATWA 1LJYA 2J7HA 1HKJA 1HJXA 1DWGM 4F66A 4ZEPA 1CDGA 4JHZA 3VX1A 5A69A 4OKDA 2XIIA 2PWFA 3BLPX 4J3UA 4J3XA 3LPOA 3CUFA 2A3AA 2BVDA 3CZJA 2CBUA 4BS0A 1KFWA 1XV8A 4PMNA 5M3WA 5GNXA 5JBEA 2ZX6A 4QP0A 5CZKA 1TFVA 5E6ZA 1UWSA 3T2OA 2FDMA 2XVNA 4JFUA 1OT1A 1GOIA 1UH2A 2WVVB 1H1NA 4BF7A 2GDUA 1RP8A 1UYQA 1JNDA 1VEMA 5CSUA 1KXTA 4S3KA 1HNYA 1UD3A 1B3XA 2WVTA 3RIKA 4DM2A 1JG9A 2WMJA 1E4LA 3KEHA 3T0DA 2GK1B 4ZE4A 1JYXA 3BAJA 3F4VA 3N18A 1F4AA 4Z2JA 5IHRA 1LL6A 4LGXA 4TXEA 3UCQA 1V02E 1C8XA 1VJSA 3VO0A 2XVLA 2DT2A 2CEQA 3ARPA 5BCAA 5LA1A 3SUTA 1XGZA 3WNNA 4NZCA 1ITCA 4P7QA 2WVSA 1J0KA 2X05A 1Q6FA 1UD6A 2ZUWA 1B3YA 3BMWA 4UFHA 3AOFA 4H8HA 1ZBVA 3E1F1 1E71M 1VENA 2WAGA 1E6QM 2ZOXA 1TA3A 2ZUSA 3WNLA 3K4DA 2Y8KA 1DWJM 2X09A 4Z2KA 2E8ZA 1G94A 1W2VA 1Q4NX 6CGTA 4AIOA 3TP4A 2O9OA 5A8OA 2F8QA 1OGBA 1WDPA 3TONA 1EQPA 4AISA 3CGTA 5DF0A 3WD4A 2VO5A 1E0WA 2PWEA 3ZOAA 5I24A 3T2PA 3CUIA 1L0PA 4W86A 2BY1A 4BCEA 1QW8A 3AXHA 1W1VA 1TUXA 3WQ4A 5E9AA 1HJUA 4DUWA 4AZIA 4TTGA 4UQCA 5A2BA 3W82A 2GJRA 1J12A 3A47A 1QNSA 3WDPP 1WP6A 4QFUA 3PZNA 5A6BA 5I78A 2DEPA 2VR5A 2OLHA 2DPEA 3A4AA 4ATDA 2BFGA 1HP5A 2BXYA 3VD4A 4AD2A 4IUGA 2D20A 4D6FA 5M5DA 1RPKA 2UY5A 1KCLA 2DSUA 1D7FA 1J0JA 2YA0A 2VZSA 1BGAA 4DWSD 5ABGA 8A3HA 3KL5A 2EPNA 5CLTA 1J10A 4UOQA 3SUVA 3U5UA 4HZ7A 3DHUA 4W85A 1EOKA 2J74A 3QGVA 1YHTA 1E70M 4OBSA 4UFLA 2BVYA 2WWDA 1JZ2A 5D9OA 4WIWA 3W53A 2VI0A 4E2OA 1EHNA 3IANA 3MUIA 4LX4A 4CN4A 1BVNP 2ESCA 4GI8A 1C3FA 2WK2A 1VFFA 5A3HA 1H4PA 2WYSA 5E0CA 4OUEA 2RGLA 1NOUA 1PX8A 1JL8A 3AXXA 2DQXA 3EDEA 1M03A 2PWHA 3SCPA 1EDGA 5A6LA 4XB3A 3ARUA 3A6OA 3WY1A 2EEXA 3CUJA 4UNIA 4M8UA 2PC8A 1BVZA 3II1A 3ARYA 3OG2A 5JUVA 4KWUA 3SIMA 4D1IA 2YDRA 2EBNA 1V6XA 3N13A 2VUYA 1JF6A 2X2YA 1H3GA 3WL0A 2XJ7A 4E8CA 2EPMX 5IHSA 1DWFM 3FNDA 2QV4A 1E5JA 1I75A 1KGUA 1E5NA 2VCAA 2D3LA 1CXIA 1B30A 4GO9A 3S6TA 3W0KA 4JFVA 3ZT7A 2DGAA 1H0IA 2BHZA 1XD0A 1KXVA 1G5AA 1LG2A 1CXLA 2YL5A 1ECEA 3N12A 1NP0A 1L8NA 2Y2WA 3UG3A 3A4XA 3AHYA 2XGIA 4GI9A 2YL9A 1DP0A 1H41A 5A6JA 3WFLA 3HMCA 2WLYA 5A6AA 5I23A 1BLIA 4MJ2A 1KCKA 5IDIA 3AS0A 4M24A 3VINA 4M82A 1GHRA 3ZJ7A 2J8GA 3GH4A 4MADA 4CU6A 5CGMA 4FMVA 3W81A 5I0DA 1CXFA 1TZ7A 3DYMA 1B3ZA 4L4PA 3VGEA 7TAAA 5DMYA 1WDQA 1E72M 3TTOA 3VDAA 3WH9A 3T0BA 4EANA 1GOMA 1VEOA 4PMRA 5D4YA 2NT1A 3VGFA 1E4IA 1BFNA 1RH9A 1E4NA 4AZ5A 3W6LA 4CN6A 2ZX9A 2YOCA 1QNQA 5C71A 2WKLA 2ZUUA 1WE5A 5JIWA 2PBOA 3WEZA 1CIUA 2WVVA 4UFJA 3PZIA 3PZGA 4TX8A 3AHZA 3OB8A 3L4VA 1M53A 4PMOA 8CGTA 4DM1A 2YL8A 4AEEA 1QVBA 3UG4A 2CKRA 1H11A 2G8ZA 5GNZA 4OOUA 3ARXA 1MW1A 1V3LA 3GXIA 4CU8A 1XHGA 1GPFA 2ZE0A 1S46A 5BXTA 1K9TA 1J11A 1R8LA 2DT0A 3OZPA 3VOCA 3WNMA 1U33A 2B31A 1UD2A 3CUGA 4AYSA 1XSJA 2QF8A 1HN1A 2W92A 4AW7A 1VAHA 1QHPA 1Z32X 3WQ6A 4PUDA 4U3CA 1WZKA 4U2ZA 4D6GA 1FH8A 4PMXA 7A3HA 1W3KA 1QNRA 4W87A 2FH6A 1XCWA 2JE8A 4D6CA 3MUZ1 4W5ZA 4HMEA 1EA9C 1Q6DA 2WHMA 3CZKA 4JCLA 4P7NA 1BHGA 6A3HA 4PUEA 2VRJA 1MXGA 4W5UA 5CGTA 2GUYA 4P8XA 3EMCA 4AC1X 3QOKA 2QLYA 3RJXA 5CXPA 3ZMRA 1ZU8A 3VIGA 1IV8A 3KZSA 4NRSA 2TAAA 4JIEA 2XGBA 2CHOA 4KGLA 1HKIA 3BAYA 4BQ4A 3ZT6A 2F61A 1W91A 1ZB5A 1GCYA 2W63A 1KBBA 1V6VA 2XVKA 2D24A 3AIRA 3WDHA 1CECA 3VIIA 1KQYA 2W62A 4PMUA 4YPJA 1MYRA 2X0HA 4CCCA 2ZWZA 1JXJA 1ITXA 1UG6A 2Y4SA 3L4TA 5DEZA 4BQ3A 4PCTA 3BCFA 3M46A 2Z1SA 2DIEA 5I3DA 2WMIB 3W6MA 4X0NA 4BQ2A 3WNPA 1H0GA 2GJXB 1N82A 1CGTA 4UQ9A 3OZOA 3ARTA 2A3EA 1LLOA 3SCTA 4MNKA 4BZYA 4J3VA 2RGMA 1OGSA 3QHOA 2JF6A 3VD7A 3WL1A 1MQPA 2CHNA 4U33A 3LPGA 1UKTA 5JBFA 3MS8A 1E40A 4ML4A 1OD8A 2WSPA 1UA7A 1OINA 1UR8A 1IT0A 4PCSA 1MW2A 3VGGA 2F2HA 5A95A 1CGUA 2VZTA 1I1XA 1IZJA 3EDDA 3PZQA 4C7GA 1XH0A 5A6SA 1JZ7A 3VPLA 1BF2A 1W9UA 4MNJA 4ATLA 1OM0A 1SFSA 5CQ1A 1W9XA 4KGJA 1JF5A 2J47A 3IJ8A 3J7HA 3ARZA 4WKFA 3QR3A 3LMYA 2WZIA 4HMDA 4GI6A 3BAKA 1NH6A 1QI0A 2IUZA 2VX5A 1H49A 3FXYA 1QBBA 1JYNA 2VJXA 3L4UA 3WMCA 2D1ZA 5D8ZA 1CWYA 5HPOA 1TE1A 1HJVA 2X8RA 4M81A 2CCRA 2VMFA 1M01A 4P8VA 2E9MA 1X6LA 4FK9A 2DH3A 3U57A 1XC6A 3ARQA 3M6DA 5A6BD 3MSDA 2EQDA 4AZGA 3MUY1 4HA3A 1V3IA 1JZ5A 2WWCA 4OBRA 2DSZA 3GBEA 3DECA 1HL9A 2IXVA 3W37A 1B1YA 1TA3B 5FL1A 4W89A 3EDJA 1QI5A 1J0ZA 3OLIA 2DSVA 1XD1A 4B9ZA 1JAKA 1QNOA 1GNXA 3N15A 1XYFA 4WJXA 3CBWA 2CBVA 2WMIA 1WZMA 1K9EA 1AQHA 3GXDA 3O2LA 1VF8A 2FGZA 2VRQA 1GHSA 4DUVA 3CTTA 3AFBA 5M03A 1VFOA 3VD5A 2JEPA 4Z2GA 3FHQA 5DT7A 5GNYA 2CIPA 1OBAA 2VCBA 1GOQA 1H2JA 3DYOA 3BAIA 3G6MA 4KMQA 3CO4A 4AD1A 3EBVA 3VIMA 2XFFA 4W7VA 3L4ZA 2A3CA 1V08A 3T09A 3UG5A 2D0HA 1VRXA 4WF7A 2G3IA 2BVTA 4Z2LA 5EMYA 4YN5A 3N17A 5E09A 2BY2A 4MB4A 1GJUA 1OD0A 1QHOA 3CHCA 4IISA 3WMBA 4Q22A 5I79A 2W67A 4UQEA 3GTNA 2WKGA 3OLGA 5HNNA 1KR0A 4JCMA 2YL6A 4WSKA 3ZR5A 1UWUA 3I3EA 2WBKA 5A8QA 4W8AA 1VFUA 1Q6GA 3GBDA 2CXGA 1JIBA 1UD5A 3W28A 1ISZA 1H09A 4PBGA 4HU0A 1BQCA 5D8WA 1CGWA 1K9DA 2O9PA 1E55A 2YA1A 3ARSA 4ZFMA 2FHFA 3PZVA 5EB8A 1XSKA 4LYPA 1ZJAA 1LG1A 2AAAA 1DHKA 1E0VA 1HT6A 4W8LA 3VMOA 2NW0A 2J79A 4E8DA 1E56A 4QCEA 5GPRA 5FCZA 4UOJA 2ZUVA 6TAAA 2PWDA 2D2OA 3WFZA 1XH1A 4TUFA 4B16A 3VNZA 1V6YA 4PMZA 2QMKA 3AROA 3U7VA 3ZIZA 3GYCA 3KWXA 3ZM8A 4GINA 3THCA 1QI3A 3WF2A 1DEDA 2YLLA 1E6NA 3L4XA 3SCVA 3DHPA 3MUAA 4HTYA 5D9NA 4Z2IA 2EPOA 4FLSA 1DTUA 1HJWA 1NWRA 2OYLA 3K46A 3WNKA 3AIWA 3LPPA 5A2AA 4PSPA 3ALFA 3GNPA 1QI4A 3AZSA 2HVMA 3WDRA 3WQ5A 3W4RA 1VBRA 1OB0A 4QCFA 3AYRA 1KR1A 1HL8A 4W7WA 4HMCA 4M29A 1GONA 1VIWA 1CLXA 3K4AA 3AI0A 2J7CA 1MW0A 1R85A 1B3VA 2V3EA 3HN3A 1E0XA 3GZAA 3VVGA 3VKKA 3OGRA 1GJWA 2UY4A 1K9FA 3BC9A 2WLZA 2D0FA 4MNMA 3VDCA 4W7UA 1FHLA 2OSWA 1XYZA 2QPUA 3IAPA 3IK2A 2V3FA 4MTVA 2W61A 2XYLA 3W27A 3GXMA 4CUCA 4GQQA 1E6PA 1BYDA 4DWSA 3BCDA 2VTFA 1MXDA 1NOFA 3SCUA 2MANA 3AS2A 4M56A 3CHDA 1MFVA 2WZHA 4TVDA 4AXNA 2XM1A 2VR4A 3WH5A 5EFDA 4B3LA 3F5JA 2WANA 2ZX7A 4CU7A 4MAVA 2AOSA 2G3NA 3L4YA 1JD9A 5I2UA 5LA0A 4WSJA 5A2CA 1MQQA 4PMVA 1UOKA 3KL0A 3OIHA 1JYVA 3K8LA 2OWXA 2D0GA 1R7AA 2EPLX 1E43A 1NWUA 1BG9A 1XSIA 3AHVA 3B8SA 1JI2A 4AZ6A 2E40A 1ISVA 2PB1A 1BAGA 2WXDM 4D6JA 3RDKA 1TMQA 3RMEA 4WKHA 3TTSA 3VMPA 4AMCA 2E9LA 1PX4A 3L2LA 2PBGA 1SMAA 4J28A 3L2MA 1CTNA 3CHFA 1CBGA 4CD6A 1E6RA 3VIJA 1CXHA 1KB3A 3IJ7A 5E0FA 1PZ2A 4ZENA 2W4XA 1VFMA 4GIAA 2WCAA 1E15A 1UKPA 2ZIDA 1BTCA 2DT1A 2UY3A 1XRVA 2YLAA 3B9DA 1MW3A 1R87A 4CKQA 4N42A 5C8BB 2EO7A 5LA2A 4TOQA 4XX6A 1K6AA 2O92A 1JYWA 1E6XM 2WMFA 5CG0A 3VTRA 4W88A 4QAWA 2J78A 4UQBA 2WVUA 4MDOA 4MPKA 1ESWA 1B0IA 1E9LA 2E9BA 1PZ3A 1ZBKA 2J7DA 1C93A 2CKSA 2ZUNA 1VJZA 2ZXAA 2VL4A 3WQWA 4AWEA 5ABHA 3VIKA 4AEFA 3AZTA 3D5HA 1PPIA 5E70A 3AHXA 3WD3A 1UR2A 2W5FA 3VNYA 1PEZA 1WCGA 4R27A 3WQ8A 3WD2A 1JZ4A 1UHVA 4Q7NA 2JALA 2EXOA 2VZOA 4B9YA 2IXUA 1UR1A 1B2YA 4PRWA 4W93A 4XZWA 1CYGA 1WKYA 5I77A 3CPUA 1PX3A 1V0NA 2YDQA 1C92A 3FAXA 2J75A 4PTXA 4WLCA 4D72A 2BV9A 4OZOA 2EPKX 2J8FA 3PZTA 2GFTA 2UY2A 4URIA 1EIBA 3AMDA 3WD1A 3A4WA 3ZJ6A 4AZBA 3TTYA 3MMUA 4P7RA 3ZR6A 1NOWA 3BMVA 3WQVA 4KH2A 3WUBA 1AVAA 4CD5A 2XVPA 1OIFA 1UR4A 4JL1A 1KWKA 1WDSA 2AMGA 3APGA 4W84A 1U30A 4V27A 2GK1A 4UFMA 2VX4A 3TTQA 3QHMA 4H8VA 2XFYA 1HXJA 1AMYA 2E8YA 1ZBCA 4CD4A 2ZWYA 2EJ1A 3VILA 3UETA 3SURA 5M17A 4L4OA 2ZICA 5BRQA 1NARA 1DWAM 5A94A 1GOKA 1CGVA 3EDKA 1OGGA 4EK7A 3WN6A 2O9RA 2OSXA 5AC4A 3A3HA 3VIHA 1US3A 4H7VA 4ACYA 1OWQA 3SCOA 1JFXA 3B9AA 1EGZA 4LPCA 1ZJBA 5FKYA 1ODUA 1Q6EA 4UZSA 2YJQA 3UR7A 2CPUA 3VM5A 4UQAA 2YDSA 4HA1A 2J77A 5CLWA 2BNJA 1E4MM 3ZO9A 4BA0A 1GORA 1J0IA 4FLRA 1FOBA 3ARRA 2JEQA 2VURA 1GQIA 1V03A 3VD9A 3GNOA 5BXSA 4UCFA 4W8BA 1ISWA 4LYQA 4ACZA 3CIVA 5FIPA 3MMWA 3WF0A 3WMSA 2XWEA 1QNPA 2XFRA 1V6WA 4PMDA 2VVSA 1UWTA 1UD8A 1W9DM 1UQZA 5FOOA 5A6MA 4PEEA 4P7LA 4B15A 4QLLA 4EE9A 2PI6A 3PTKA 2BY0A 2DDXA 4UZUA 2NT0A 3GNRA 4HZ8A 5C70A 2ZUMA 3PZMA 3AS1A 4YHEA 1V6UA 3W25A 3UR8A 3SCQA 1PIFA 1G1YA 2CERA 4NRRA 3FN9A 1DWHM 1E6ZA 3WF3A 2QHAA 1UKOA 1CGXA 3SUSA 5AY7A 3DC0A 2CNCA 2O9TA 3PTMA 4XUYA 1JGIA 4D71A 3D3AA 4F79A 2DSWA 3O6AA 4U2YA 2E4TA 3NJ3A 1V0LA 3AMCA 2VZVA 2VC9A 4QLJA 1BYCA 4F9JA 4WKAA 4HOWA 2WHKA 4IPLA 2J62A 4TVUA 2ZX5A 1KXQA 1NM9A 1W2PA 2VRKA 3PBGA 4AY1A 4V2XA 2PWGA 4RE3A 1WPCA 1JXKA 1V0KA 3TOPA 3PN8A 2FGLA 1UUQA 1EQCA 1X6NA 3RJYA 4J3WA 4JFWA 4H41A 2C8NA 1U2YA 4CCEA 1E3ZA 7CGTA 4WK9A 4QLKA 2C7FA 1V0MA 3AISA 1TVPA 3WH7A 3AYSA 1CLVA 1EO7A 1SYTA 1W3HA 1J18A 1IZKA 1CXKA 4S3JA 4J3SA 2WSKA 3VDHA 5A8PA 1TVNA 4HPHA 1B31A 2WHLA 3EDFA 2CBIA 3BSGA 3RM9A 2WC7A 4RE2A 2CESA 1GQJA 2FHBA 2VVNA 1EOMA 3S2CA 1G01A 1GOWA 4MDPA 4AD0A 2XUCA 1HX0A 3WBEA 5HOSA 1HVQA 5A8MA 2VZUA 3AIVA 5TD4A 3RO8A 1EO5A 1W1YA 2FH8A 3BAXA 1BSIA 2HISA 2XHYA 3AZRA 1W3LA 3SCRA 2VQTA 3KL3A 2OWWA 3I3BA 1R7OA 3NDZA 5LYRA 2C0HA 3WH8A 1JFHA 1LWJA 3IJ9A 1W3JA 1HP4A 4JAWA 3W24A 4PTWA 1CENA 3POCA 3PZUA 4LQ1A 4CVUA 2QPSA 5GQBA 2Y8VA 1GQKA 2WMKA 5IXEA 3MKKA 3NDYA 2WM0A 4OOZA 5ABFA 1JZ3A 1JDAA 4PMQA 2ZXDA 3FAWA 5I5RA 1FFRA 4JKKA 3NYDA 3CZGA 2YBTA 1BYBA 4PSRA 3CUHA 5ABEA 4UOZA 4MB1A 4X9YA 2OSYA 4H8UA 4DUXA 1W1TA 2CYGA 3AHTA 1KXHA 1D2KA 2OYKA 2WMHA 1CEOA 3SCNA 3POHA 1VBUA 1JZ8A 1NWTA 2Y24A 3G6LA 3ZQ9A 3MU7A 2BY3A 4GZJA 4GQRA 4M80A 1LWHA 4YHGA 3WSUA 1VB9A 4F8XA 1GQLA 4X0VA 1BG4A 1FP8A 1CGYA 3WUGA 5CPSA 1KGXA 5EFFA 3ARWA 1W9VA 3PZOA 1MFUA 1W9PA 5AYIA 3PHAA 3CMJA 2WCGA 1CZ1A 1UD4A 1QPKA 5F7UA 3PZ9A 3AIUA 5IFTA 4V28A 3AICA 3K8MA 2BXZA 4B3KA 1AQ0A 4M1RA 3VIFA 3W26A 4CD8A 5IFPA 2WMGA 3WEOA 1KWGA 1BYAA 2A3BA 5AC5A 4D6IA 5HPCA 1VEPA 3VDBA 3NUKA 4GPNA 1C7TA 3GM8A 1PJ9A 4ACZB 2G4FA 3CLWA 4AD3A 2J7GA 1O7AA 1X1NA 4GO8A 3T08A 3BXWA 3WIJA 1HVXA 1UWIA 2WCSA 4HA4A 3RPMA 3ZJ8A 4IM4A 1FHDA 2V3GA 3VGDA 2GJXA 4FLQA 4U31A 1WDRA 3CH9A 1LQ0A 2ZXQA 2D22A 3IAQA 1F4HA 1E1FA 2WBGA 4RL3A 4J27A 3VUPA 2W91A 4HPGA 4OJYA 1UZ4A 2J7BA 3PTQA 1W9BM 1A47A 1C7SA 3EYPA 3T0AA 5E6YA 3UESA 5BXRA 4UFKA 2ZX8A 5HXMA 2Q8XA 3SUWA 3U7BA 4JFTA 2X0YA 4NF7A 4XZBA 1OSEA 3VD3A 5FL0A 1ISYA 1DWIM 5DO8A 4AIUA 1LF1A 4A4AA 4D6DA 1EH9A 1NWSA 1UR0A 2WC3A 2OYMA 1MQRA 3WF1A 1RD6A 1WB0A 2VNCA 4D1JA 4Y7EA 5JBDA 2D3NA 3VIOA 4NSBA 1ODZA 4TX6A 1V3MA 1JDCA 3BH4A 1Q6CA 3EMZA 4GZIA 1MVYA 1UR9A 4BQ5A 4HU8A 5D9MA 5A6KA 3VM7A 3MV01 4JHOA 2XIBA 3WELA 1UKQA 5BRPA 3SCWA 2JIEA 4DWSC 3FW6A 3M07A 3OA5A 2WC4A 4AZHA 2VX6A 4A3HA 3F5LA 3HU7A 3AMLA 3TA9A 5FD0A 3WD0A 3ECQA 3NIYA 1E6SM 3LPFA 1TG7A
chains in the Genus database with same CATH superfamily
4UMBA 5HJLA 1NQ6A 2VX7A 3B9EA 4ONVA 3FY1A 3AS3A 4ZE5A 2RJGA 3GUWA 1IF2A 3NSMA 4FB7A 2NX3A 3CAVA 4EKJA 1C90A 3UGRA 4LB4A 3EOEA 3N14A 2P1FA 4AIEA 1EP2A 3QC3A 2PMQA 3UXDA 1XLKA 3KBNA 3MY9A 5HQMA 4A8RA 4QG6A 1PV8A 3JUGA 2EGZA 3QEZA 3B03A 2VENA 2NUYA 3U4AA 3W7OA 4UR9A 1TWWA 1FH7A 2Z00A 5E93A 1DJXA 1IIGA 3S8HA 2TPSA 2XWDA 1ELSA 4Z2HA 3DU0A 1JAEA 1TJ0A 4RPQA 1XLFA 3TROA 1TJPA 1UH3A 3AJ7A 1EDTA 3QJAA 4MB5A 3CHEA 3AO0A 1XF0A 3NCOA 4FHAA 1FFQA 3SRKA 4HZ6A 3G77A 1D3CA 2AQWA 1V02A 1RJRA 4EAMA 1BPLB 2GVYA 3N1AA 2ZE3A 3GG8A 1JNEA 2A7NA 2YA2A 1ZL1A 1OT2A 3G8EA 1ZPTA 4U3AA 1PIGA 4F9DA 1CCWB 2OX4A 2QIWA 4GYPC 4DXVA 2GVLA 3AIBA 1W1PA 2XM2A 4P8WA 3VZYA 2OZ0A 1J9YA 2XDFA 4ZO9A 5I6SA 4PTMA 4HOXA 2WNWA 3HPXA 3SQLA 3ZJKA 3INPA 3VX0A 2X2GA 5LIXX 1R30A 2VELA 3VXGA 4DXXA 1KRBC 4XZNX 2YB1A 4H2CA 1NVMA 3R8GA 5ABFB 2FPVA 1XWYA 4WJEA 1TWZA 1EJVC 3H23A 1JDDA 2IS7A 3EOLA 3KDOA 4KRTA 1QI2A 3MCNA 5IOBA 3NSNA 3AWOA 4GVIA 3M44A 1NELA 1AW1A 5LNWA 1RBAA 3BLKA 2FKPA 1EP3A 4DWSB 1FH9A 4MB3A 4ZCWA 1XG4A 1OCJA 3WDJA 1DQUA 3ZSSA 3RM8A 3WLSA 2D69A 4K38A 5HANA 4ZXLA 1NFGA 5LHEA 3EWZA 4D6HA 1W31A 1SJBA 3BGAA 1YQ2A 2ZZ6A 2JF7A 2B7QA 3NGJA 3CZ8A 3GE7A 3P5YA 4JFSA 1UQYA 3WQEA 2E67A 1NP2A 1CPUA 1UWRA 2D23A 4RE4A 5EGRA 3W71A 2NVDA 3GLCA 3TWBA 1GOOA 1TWIA 1X8FA 4IPNB 3FJ6A 4JTCA 4WR3A 3WQDA 1EA0A 1XYLA 4H04A 3VIPA 5D03A 4UFIA 4B5UA 1ZZMA 1OIMA 3OTRA 3GXPA 4XKMA 4UBPC 3DBPA 3AMKA 5A8NA 3MMDA 1XH2A 4HHLA 1W6TA 2FYMA 3M5YA 4JZ5A 3U2CA 5EYWA 3NL2A 3LCXA 3Q67A 3KHDA 1TV2A 1VBHA 5FJIA 1Q6RA 4M19A 4QEEA 4U5IA 1A3HA 4AZCB 1PAMA 4XBKA 4S3BA 5BU9A 1C8QA 1KM1A 4IMGA 3N04A 3S5SA 2OOFA 4AQLA 3W2JA 1I45A 1GKPA 1WO2A 1RP9A 3PAOA 3NQGA 1AZ1A 2OWCA 1EBGA 1XIBA 3SY5A 4F2UA 1JD7A 1OEPA 2Y5EA 2OEKA 4JKMA 1RQHA 1HF6A 3ZLGA 1PKLA 1WZLA 1OYCA 1NQKA 1G9HA 1GW1A 3RILA 4F0HA 3CV2A 1WXYA 3ITCA 5D9PA 1C91A 4FLOA 3CZEA 4ATWA 2P88A 1XJBA 3BCJA 4ZEPA 3VX1A 5A69A 2PWFA 3SI9A 2GVGA 4J3XA 4J3UA 3I6TA 5FJUA 2BVDA 3SDOA 5GNXA 2ZX6A 4JQ2A 6ENLA 3N4EA 2Z2AA 3NXFA 1EJRC 3T2OA 4E4UA 1MDRA 1OFRA 1YPFA 3W1RA 1P0BA 1IEWA 1H1NA 3W70A 1YPIA 2QCEA 2QDDA 1UYQA 1VEMA 3PY2A 1KXTA 3DI1A 1HNYA 4H9XA 3RIKA 4DM2A 1JG9A 1I9CB 4XZMX 1EEPA 4NASA 3S4TA 1E4LA 1NF7A 4GXWA 2YPIA 1A5UA 3BK0A 3T0DA 3TLQA 1KBLA 1XBXA 1AL8A 3MJYA 5JH2A 2CLLA 4LGXA 4Q3MA 3QTGA 2FZ8A 5JVLA 4DJEC 4O54A 4E3VA 1ME7A 4R7OA 2PP0A 4Z1YA 2CEQA 1VYRA 3ARPA 3ZWSA 4PL1A 3VNDA 5AHMA 3BTNA 4JN6A 4MYXA 4GY1A 2VFFA 4UFHA 2WOQA 3AOFA 4H8HA 1ZBVA 4BI6A 3ENLA 2HK1A 4WZHA 3S2JA 1TA3A 2ZUSA 2Y8KA 3M0MA 3TYAA 2E8ZA 1G94A 1A50A 1GTHA 4AIOA 2QJGA 4Y6GA 2F8QA 1OGBA 1WDPA 3TW9A 1EQPA 4AISA 3KBWA 1XIGA 1K4HA 3TQVA 4UTHA 3C3NA 2TODA 2EJAA 5CPOA 3CUIA 4LVDA 4C1KA 4Z1AA 3WQ4A 5E9AA 1XLGA 3P14A 4DUWA 3CEPA 1RR2A 3H21A 3GHRA 4UQCA 1YMYA 2DZWA 3SGGA 1WP6A 3M5VA 4CCZA 2C14A 3PZNA 1AW2A 3BG5A 2V82A 4UIOA 1TQJA 4GX8A 5I78A 2Q3OA 3ABSA 4M6PA 3PSVA 1DJNA 3A4AA 3VD4A 2ZTKA 3ABOA 3UWWA 4GJ1A 1XUUA 3I65A 1DXFA 3BV7A 5M5DA 3MBFA 1AH4A 4J3ZA 2DSUA 1J0JA 5MF5A 1GEQA 1S39A 2YA0A 1RALA 1N8FA 2Z1XA 3TN4A 3GQYA 4EXBA 2JKAA 3B06A 3CQ0A 1ADSA 1L6GA 1P6CA 1IEQA 2YXOA 4M6QA 1W54A 4PRRA 4AG0A 4ZVJA 1JZ2A 3S5OA 5D9OA 3PBYA 4PCNA 3S5ZA 1EHNA 1SJAA 1BVNP 4BF5A 2OQHA 1C3FA 2RH9A 2WK2A 4L64A 5GJMA 2QDEA 2AL1A 2WYSA 5E0CA 1Q63A 2RGLA 3KOXA 3PNUA 5DY3A 1TTJA 3SCPA 1EDGA 3TMLA 1UJPA 5GVJA 4O1DA 2E1WA 1BVZA 3U2ZA 1Q4WA 5F1VA 3II1A 3ARYA 1JCYA 2YDRA 4KCVA 3HQOA 4C60A 2VUYA 2BGQA 3BW4A 1VPQA 3WL0A 3WLQA 1ONWA 5G2IA 3MDUA 2DZUA 1JPKA 3NG3A 4L6DA 2QV4A 1E5JA 3PF3A 2VGGA 1E5NA 3KCOA 3AJXA 1OC7A 1FCVA 3S6TA 4JFVA 3ZT7A 1NFBA 2DZXA 3UZWA 1PTGA 2IQDA 2OZ3A 3R79A 4GG9A 3QV9A 3QV6A 1ECEA 5G4WA 5E1QA 3W1NA 3A4XA 1LTDA 2YL9A 4GBUA 2R1MA 1XIMA 2WLYA 3S2NA 3TSDA 1WA3A 3AS0A 5LZLA 1KCZA 4Q4OA 5JXQA 5G4HC 1GVSA 2I1OA 3EB2A 3MI3A 4KF1A 5CAHA 1B3ZA 1OX6A 1XQLA 3VAVA 3T0BA 3BDKA 1VEOA 2DU2A 5D4YA 3WG6A 3VGFA 4M7TA 1E4IA 4B4HA 3CJPA 3EWWA 1RH9A 1E4NA 4QS6A 2NXGA 4IQJA 2Z27A 3UWEA 2PTWA 2WKLA 3B0YA 2WVVA 4KT2A 4UFJA 3PZIA 3GVQA 4Z17A 2FTPA 2B7NA 5D37A 1M53A 4E4FA 4DM1A 2VD9A 1GTEA 4XZIA 4AEEA 2MNRA 2G8ZA 4OOUA 2UBPC 4CU8A 1K9TA 1J11A 3OZPA 4OGZA 4NX0A 1UD2A 2PDBA 2A3LA 2AGKA 3LGDA 2INEA 3ZLFA 1HN1A 1VAHA 1QHPA 3L23A 3CL8A 4U2ZA 4D6GA 1AL7A 2XN0A 7A3HA 1I0DA 1W3KA 1XCWA 4FNQA 3REQB 4HMEA 1EA9C 2WHMA 3CZKA 4JCLA 4DI8A 4PUEA 1TPH1 2VRJA 1H5YA 2GUYA 2WKJA 4Y96A 1ZU8A 1QK2A 3USBA 2E68A 1J8VA 3W7MA 2VEMA 3EEGA 1ZB5A 1GCYA 2W63A 1KBBA 4PUUA 1YPXA 1TPEA 1KM5A 4MJMA 1R6WA 3N6QA 4PMUA 4IG2B 1FWAC 1DE6A 3EX3A 3GIPA 4OBTA 1MYRA 4NY2A 1JVNA 1AD4A 3K5XA 1JXJA 3BVJA 4K1WA 4RZ5A 3EAUA 1UG6A 1PTDA 2OQYA 3M0ZA 3L4TA 3DH7A 3L5LA 1NDZA 1S2UA 4JQAA 2DIEA 4KW2A 2BOGX 4WOQA 1Z42A 4X0NA 3VI2A 4KPLA 4AB4A 3QC0A 3K30A 4BJHA 3HPSA 3VD7A 3TQPA 3HQ1A 5CC3A 3GDMA 4E2DA 3EX6A 3LD5A 2ZCGA 1UUMA 2WSPA 3R25A 3P60A 1OINA 1RA5A 3NZPA 3GYEA 1MNZA 2QPXA 2F2HA 5DRCA 3IJ6A 2REQA 3SJ3A 1IZJA 4C7GA 3LENA 3M1ZA 4O8AA 1XH0A 1TX0A 4ZR8A 4ATLA 2NQ5A 1SFSA 2BGNE 4H7CA 3E2VA 1TJRA 2VGFA 2X1SA 4JXCA 3IJ8A 4DZHA 3LMYA 1KFCA 3G0XA 2R1LA 3LTSA 1GGOA 3BAKA 3DBNA 1F74A 3DFPA 1VD6A 3CYVA 2OEMA 2D1ZA 1XS2A 5K4XA 5HPOA 3CUZA 2E9MA 3GDRA 1AG1O 4FK9A 1A53A 3IUIA 4ROPA 3U57A 3ARQA 4HNVA 4HCDA 3OHMB 1GVFA 5EBUA 4ZZ9A 4AZGA 1HFBA 1QPNA 3ATYA 4TMBA 1V3IA 2QJMA 4C6MA 2QDHA 1RY8A 4OBRA 2DSZA 3GBEA 1E1CB 3CQKA 1HL9A 4R9OA 3V75A 5FL1A 3EDJA 1DJWA 1QI5A 2QUTA 2G50A 2OLAA 4O15A 1K7XA 3FK4A 1ZAHA 2CBVA 3W7QA 3OYZA 3SRFA 5BW6A 3GXDA 1SPQA 2VRQA 3QW4B 4K1GA 3CTTA 3O3RA 3H4GA 3KXQA 3CT2A 3A21A 3TXZA 3GAKA 5FF4A 4PEKA 3FEQA 4Q32A 3W76A 3M0HA 3ATZA 3ZVHB 4UTTA 3A4JA 1LBLA 3BAIA 3JS3A 3PPHA 3CO4A 4AD1A 3EBVA 4W7VA 3L4ZA 2A3CA 1XLHA 1HGWA 2PPGA 4HIBA 4IIHA 3UG5A 1H63A 3AUJA 1GG1A 5HULA 5B7ZA 1AH3A 2G3IA 3GHUA 3BOLA 2BVTA 1WOBA 1XI3A 3N17A 2GVEA 4IPIA 3RUBL 4C90A 1QHOA 1JQXA 4IISA 5HR6A 3CB3A 4Q22A 5I79A 4A3UA 3MUCA 3OLGA 1U83A 4DPQA 4C6CA 1THFD 4GVHA 3TYCA 4X9SA 4B2DD 2XSXA 1FCUA 3I3EA 3EWCA 1TREA 2QZRA 1T40A 1POJA 2GUBA 5D2YA 3JZUA 2ZRUA 1OQFA 5G2HA 2OG9A 5C9WA 1CGWA 1UIPA 1E55A 2YA1A 3ARSA 4BWLC 4N9EA 1LQAA 4Y8EA 2I7GA 3PBVA 2I17A 3PZVA 4IPPA 4EP8C 3GR4A 1ZJAA 5K9XA 1DHKA 1HT6A 2BXVA 4W8LA 1Z48A 2NW0A 2J79A 4E8DA 3QY8A 4IQEA 5FCZA 2ZUVA 3IGHX 2D2OA 2PP3A 1OFEA 4WRHA 3RLVA 3U7VA 1XUZA 2PDKA 3GYCA 3KWXA 1XC4A 3WMLA 1RD5A 3UZZA 4C6JA 1XR2A 2OB3A 1GVEA 4YXGA 3MUAA 3B4YA 3P3BA 4HTYA 4FLSA 1DTUA 3UR2A 3AIWA 3SN0A 5A2AA 4IP7A 2DZVA 4PSPA 3OOQA 1P6BA 1HGYA 2Y88A 2Z6JA 3M47A 3W4RA 2Y70A 2P8BA 3TJXA 4UTWA 1G7VA 1XICA 1PZ1A 5C2CA 1GONA 2RJHA 1VIWA 2OGYA 3K4AA 2J7CA 3DEQA 4IF2A 3VKKA 1ZQ5A 3OGRA 2UY4A 1IXNA 5BOFA 3NQAA 3PG9A 4XKYB 3HZ3A 3URAA 2NQJA 2POTA 2A5HA 2HRWA 1IZCA 3IK2A 5D33A 2W61A 3VKJA 1CB7B 1DTNA 4ZB2A 4L1XA 2XYLA 1BRLB 4DBSA 1E6PA 1VCFA 3A5VA 2XU2A 1DJIA 3BCDA 1IE7C 2YYUA 4NXKA 4OECA 3CHDA 3CQIA 1MFVA 2WZHA 4JTUA 3U4FA 4TVDA 2PDXA 4RDVA 4AXNA 4JR5A 4MY1A 5DX7A 2CLKA 2NV9A 3ORWA 3YPIA 2AOSA 3KLLA 4HHHA 2FZDA 5I2UA 1Q6OA 1MQQA 1UOKA 1FWFC 1JYVA 3H70A 3NFUA 2OWXA 2QVNA 1W1A1 3EPNA 3MKVA 3LHUA 3UNTA 3B8SA 1H51A 2E40A 1FWCC 3NZRA 2WXDM 4BI7A 1TMQA 3RMEA 4WKHA 3VMPA 2ISWA 1PX4A 1ALDA 4LC6A 4J28A 1ITQA 1FWSA 3QRHA 3TH6A 5E0FA 1PZ2A 2ON3A 3GVGA 1VFMA 3DFTA 4GIAA 1F6KA 1VHCA 2WCAA 5EKYA 3SR7A 4K3ZA 3F2DA 1BTCA 4DYEA 3H2CA 3M0VA 4FNTA 1R87A 4AY7A 2WPBA 5TF0A 3E0IA 2ACSA 2G95A 5F2LA 1P5BA 3IVUA 2WZMA 3V0TA 1E6XM 4Q8NA 4IFOA 4QAWA 1WV2A 1D3HA 4JX5A 2DVUA 2XFWA 2J78A 2DFAA 4LYKA 2WVUA 5HJYA 2QF7A 1E9LA 2E9BA 2H9AB 3W1MA 4ERGA 3OBEA 4AWEA 2E6AA 2XN1A 1Q6QA 3IK4A 4AEFA 1RQBA 3EB4A 2PA6A 3P84A 4ZB0A 4N6FA 4M3PA 1XYBA 4JIHA 2W5FA 3GIYA 1WCGA 3KBSA 3WD2A 1UHVA 4Q7NA 1GZGA 4YNGA 3KTSA 1VFTA 2Y7EA 3V35A 1AODA 3C0LA 1B2YA 2POZA 4YTQA 3RPDA 3CPUA 1PX3A 2YDQA 3HG3A 5CBIA 3M5ZA 4Z1DA 1M1BA 3OVPA 3V0UA 2UY2A 3SBFA 3A4WA 3W7EA 2G96A 3U9IA 4RV3A 3TTYA 4Q8OA 3MMUA 3VOJA 4LALA 1DJQA 1N55A 3WQVA 1GKQA 4TU1A 2PDCA 2Z2UA 3RR1A 1MZRA 4CD5A 3I6RA 1GT8A 3WQFA 3W84A 1UR4A 1OCBA 3MSYA 1A49A 3DDMA 4C91A 4JL1A 1KWKA 3APGA 4W84A 3P81A 4V27A 2GK1A 3P74A 3LMZA 1SO6A 2BASA 2PAJA 3QPZA 3H4XA 3UWUA 2FGBA 2R1NA 2OO6A 2Z28A 1ZBCA 5TBOA 4RZ4A 1K7FA 1LDCA 2HPIA 1FWRA 5M17A 2R24A 4L4OA 3N6JA 1DWAM 5AKQA 1GOKA 1CGVA 1W37A 3W86A 4KEUA 1YBQB 1XYAA 1JGMA 3BW3A 2O9RA 1LOSA 1O5QA 2ZDSA 3N25A 4K39A 3LX9A 3VIHA 1US3A 2C71A 3NPUA 4I6VA 3B9AA 1EGZA 3GWQA 5CZJA 3JR2A 4DYKA 1ODUA 1Q6EA 2VFDA 5PTDA 4IIFA 2P8CA 4AU0A 4O0ZA 2YDSA 2V6AA 4JTAA 2J77A 2VEGA 1E4MM 3T81A 5C0QA 4FLRA 1AQFA 4CNPA 1FWNA 2TSYA 2R94A 4UCFA 5BXSA 3LBOA 1ISWA 3CIVA 3NO1A 1WKFA 2ZC8A 3WLLA 2DY3A 4MGGA 1MEHA 3TJLA 1AJ0A 3IJDA 4C6BA 5A6TC 2OPJA 4MKVA 4MPQA 1W9DM 2GWGA 3G1AA 1OYBA 3DENA 4OWGA 5HWJA 4EACA 1LCOA 4QBXA 2W0UA 4UZUA 2NT0A 4NNCA 3GNRA 1KC7A 3S5YA 2BOEX 3W25A 5FESA 3UR8A 3UY8A 4JHMA 4NRRA 1AH0A 1UKOA 1CGXA 3HJZA 3W87A 1VJIA 3PWGA 2CNCA 1IQ8A 1X98A 5G5IA 4XUYA 5T8GA 3PUGA 1ZP3A 3PUOA 4K36A 3GNDA 3OYXA 3UCDA 4GH3A 4FR1A 4S39A 2VZVA 2VC9A 4QLJA 1BYCA 4KWVA 1S5NA 2DVXA 1UPMB 2WHKA 3C52A 2ZX5A 1W2PA 3OODA 4PBEA 3ITVA 4RE3A 3TW6A 3N6HA 1V0KA 3I68A 3DOPA 3QV7A 2VFEA 3BMXA 4ZA0A 4LAUA 2Z26A 1KBIA 4WDTA 3UZ5A 5FJPA 1U2YA 1XQKA 2QNEA 4AWTA 3LU2A 4QEHA 1B57A 1K3UA 4DJFD 4A2SA 2CLOA 3QLLA 3O16A 1TTPA 2GJNA 2GDQA 4S3JA 2WSKA 5FI8A 4HPHA 3M7WA 2WHLA 1I2QA 3RLGA 3HFTA 1OX4A 2FHBA 2VVNA 4I5RA 4S1FA 3S2CA 2FB3A 3B8IA 1O5KA 4AD0A 2XUCA 3VZZA 4E3TA 3G2GA 1S38A 1MRAA 2GYIA 3VNMA 5TD4A 2QJIA 1W1YA 1BSIA 2XHYA 3SGUA 1W3LA 1G4TA 4U4MA 4B5VA 3NDZA 5LYRA 4DY1A 1UPPA 2VUNA 1D8CA 3IJ9A 3GFYA 1W3JA 1HP4A 4IJBA 3CUXA 4PTWA 1CENA 1QUMA 3NVTA 4DBUA 2DW6A 4X60A 1YNYA 4AF0B 1GQKA 2WMKA 3NDYA 2AL2B 3CC1A 4HSOA 1HTIA 2RAGA 4C6NA 2DZBA 4QTGA 2NV2A 1EC9A 4PMQA 4J35A 3FAWA 5I5RA 1TIWA 4JKKA 3HBLA 3N73A 3S46A 1BYBA 3XINA 3LQLA 4MB1A 3VABA 4S3EA 4GUJA 4XAGA 1VKFA 3F2BA 2NXIA 2YXXA 5DXYA 3MW7A 4J40A 1YW1A 4GISA 1JZ8A 2Y24A 1YDNA 4CLMA 2F84A 2BY3A 4GZJA 4K6AA 2Z1BA 1R2TA 1Q7QA 4AVFA 2HNHA 3LHVA 3N29A 1KM3A 1UMYA 4YMZA 5CAKA 1WXJA 4OU1A 3AYVA 1TV8A 2FVKA 3WJXA 1CZ1A 1K8XA 1QPKA 1FX6A 5F7UA 1UZDA 3AICA 4B3KA 4M1RA 2C3ZA 2YW4A 3C0SA 4HN4A 1JRCA 3W26A 5IFPA 2VWTA 1KWGA 4D6IA 5KZEA 4C6OA 4Z08A 3GM8A 1WBHA 1TRIA 4AD3A 1P0NA 3S0CA 3ZVHA 1O7AA 4GO8A 2QUNA 2CC0A 2B7PA 2P10A 4XSLA 1YDVA 3E2RA 3ZJ8A 3WLMA 1FHDA 3H8AA 4MOZA 3JVAA 5F1UA 2GJXA 3L0NA 4U31A 1WDRA 3P82A 3R11A 3E12A 1A5KC 5CC5A 3IAQA 1H7WA 3N4AA 3Q45A 3FKKA 1HO1A 1O95A 2PD9A 3LGEA 3VNIA 3B40A 1JCJA 1KM0A 1DIDA 4OJYA 1UZ4A 2J7BA 4LW7A 4WY0A 3UXIA 2NUXA 1ICQA 3UXKA 3BJSA 4X2RA 1EUAA 2Q8XA 1IXOA 3SUWA 3GTFA 1WUFA 4US6A 4H8NA 4NF7A 3M0LA 5FL0A 1DWIM 3O0KA 4ZQPA 2RDTA 2PDWA 3B0VC 4A4AA 1WQ5A 3LRMA 1WB0A 2V68A 4TX6A 3MTWA 3EMZA 3UPMA 4WVXA 1UR9A 4I90A 3MV01 1OG6A 4JHOA 3DHDA 4EPDC 3SCWA 1K8YA 4LS0A 3FW6A 1C9DA 4YTRA 5J8LA 1EJWC 2GOKA 4AZHA 1J5TA 4QJ5B 3K13A 1KM2A 3RX4A 3HU7A 4LNYA 2ANUA 3MYPA 4A29A 4PZVA 1CW2A 3TYZA 2I16A 3ECQA 1VBGA 3A3XA 1LLWA 4MUZA 4G1KA 4N9DA 4R33A 2HS8A 1WXZA 3HIJA 4V1XA 4AX6A 3BSHA 4ERIA 1M9HA 4GY7A 4FOJA 4KS0A 4P8UA 1CNVA 1KBKA 2WW5A 3PFRA 1PBGA 1R86A 1A5CA 1ZP4A 1ZGDA 2OVLA 1OFQA 2I5QA 1AK5A 1Q66A 1YXDA 4L9ZA 2Z1WA 1CX9A 2J25A 1T5AA 3P61A 1S1PA 3T2QA 2J8TA 2NSOA 1SFLA 3GU1A 2XIMA 1F05A 4UQDA 4CN1A 4QE1A 3RCNA 1XBZA 5KETA 2J7EA 1FWWA 1IHIA 4LTSA 4JIPA 1UZ1A 4FZIA 1XGDA 3DG7A 1SMDA 4I7VA 4MWAD 3LCGA 4UTKA 3QW3A 4G8TA 4AYGA 3I6EA 4WY0B 4H83A 1BEUA 4DVOA 3E0VA 4HNNA 2VDIA 3W01A 2PDUA 3EOOA 2JIWA 1C8YA 6PTDA 1O6IA 3RLHA 2ICSA 2V0TA 3WENA 4GIYA 5C2XA 2J9XA 1GUVA 4RNIA 4OE7A 3K1DA 4UTMA 3FOKA 3GIQA 3HFYA 3CZLA 3ONBA 4WHBA 1FQ0A 3W1XA 2GSEA 3LV5A 4UXDA 3OGVA 4GGHA 2G97A 4UB9A 3FHAA 1TR1A 4O0QA 4NI3A 1DYSA 4CEXC 1TV4A 9CGTA 3BZGA 3BO9A 5BXPA 4EXAA 4Q4SA 5AHLA 5JH1A 2GGJA 3DERA 4XV0A 2XSAA 2QGHA 5CPMA 1A5SA 4HP5A 3QVQA 5CPQA 1V7AA 4POCA 1YIXA 3SY1A 2FFCA 2GJPA 4XIMA 1OADA 2AGTA 2AMXA 1UA3A 3SJNA 3TCSA 5HDRA 4J7RA 2PSNA 4D6EA 1JI1A 1SR0A 3RU6A 4OIFA 3EWDA 1ZS2A 2ZVRA 4JGDA 1EHAA 3GHSA 2X7WA 4PBFA 4WSHA 5TAOA 4QISA 3NSXA 4FIQA 4H4IA 4GYKA 1HKKA 4UTIA 2WZEA 1J0HA 1TCMA 3O07A 5LNVA 3ITOA 3OLDA 1P1XA 3LTYA 2WB5A 3GDKA 1SZFA 1HKVA 1T8XA 3FX4A 3VA8A 5RUBA 3WH6A 2HSAA 3S1XA 3NQCA 3ZT5A 3FFSA 1LP6A 3W1UA 5AYBA 3LHTA 4YU1A 1DIKA 1XLAA 4E2VA 4KCWA 4PTVA 4RDYA 4U5KA 3UERA 1H5VA 1M7JA 4DXKA 3O7UA 4RUBA 3AMGA 4Q4PA 3LHZA 4XBSA 4YTSA 1V93A 4PMYA 3NPWA 1PVNA 3VMNA 5KMYA 3AXIA 3Q65A 3GNXA 4ADTA 1E0TA 1SVDA 3R2GA 3O9NA 2VQUA 2F6KA 5EMKA 1VLIA 2QMJA 4JTDA 2Z2BA 3B04A 4R7JA 1E73M 5MKGA 1WNOA 3CMGA 3LB0A 1QOXA 3QFEA 3QKZA 2VC6A 4AEOA 2YSWA 1BRLA 3SCSA 3KVJA 1JCNA 5A1AA 3EKLA 5CPTA 3HPZA 3GH7A 1ONEA 4LNCA 3W7KA 3KE0A 5F4WA 2Y8UA 3LXAA 3FVDA 1EXBA 4CCDA 4MNLA 8TIMA 1V5XA 3M7SA 4ZXOA 8RUCA 1E51A 1K03A 4NG3A 3MV11 3AQUA 2V2CA 1W32A 1RCQA 1ZTVA 3I4EA 3GDBA 3OLEA 4NP7A 4HK5A 4O13A 3N9KA 5FJTA 2ZXBA 2E6DA 3F4DA 3WYZA 3G8RA 1AQMA 4LAZA 3TEVA 1EXPA 1I4NA 8XIMA 1SZGA 2BHYA 1ISXA 3WBAA 3LOTA 4DQWA 1RLDA 5AFDA 2FHCA 1ZHAA 4P7OA 3EMQA 3THAA 3R58A 3BOXA 4Y9PA 1W3IA 4JNYA 4XVDA 1J6OA 4A3YA 1LBMA 3K1GA 2OMAA 1N8WA 3OG3A 3RM4A 3S1VA 1J93A 3FGCB 1EEXA 2DSKA 3GTIA 2PFHA 4J3TA 3WDIA 3K8KA 4BY3A 4F66A 3D3FA 4DIAA 3UJFA 4OKDA 3LPOA 3LZ5A 2GWNA 4FI4A 5CH9A 3E96A 3CZJA 2CBUA 4FR6A 3T40A 1XV8A 4PMNA 3NNTA 5CZKA 3QY6A 1TFVA 1VBJA 2I9EA 4R88A 1UH2A 2WVVB 4BF7A 1U5HA 2GDUA 1MEWA 1TTQA 2HK0A 3KVKA 4Z1CA 3O0FA 1E9YB 1JNDA 1H50A 3LY0A 5CSUA 4S3KA 3C2FA 3G22A 4JTJA 2ODOA 2WMJA 1JR1A 5A8GA 3CH0A 4MWAB 3KEHA 4AFYA 3FA5A 4F2TA 3LI0A 1JQVA 3DESA 1YTKA 2PLMA 3UCQA 4NZ4A 1V02E 2ISSA 3NO5A 2DT2A 3W7IA 2V67A 5BCAA 4JQ3A 3UJRA 3WNNA 4GMEA 4NZCA 3R0UA 1W3NA 3OVGA 2WVSA 1J0KA 2BDQA 4LY4A 3IGUA 4O14A 4XUGA 3FIGA 4XD6A 4FO4A 3VFCA 4I7UA 1RVGA 3NO3A 1PHQA 2Q01A 3E6EA 3K4DA 1VYPX 2X09A 4M5PA 4YCPA 1Q4NX 3DGBA 5FF2A 3WLPA 2JKEA 3TP4A 1J2WA 5A8OA 3R13A 2NQZA 3F03K 1V51A 4R3UA 5K9DA 3CGTA 5BRBA 4JTQA 1AA1B 2PWEA 1F6YA 1L0PA 4BCEA 1UCWA 4IH3A 1NJJA 1M3UA 4CNUA 4YVPA 4TTGA 3W82A 2GJRA 1D3GA 3WDPP 1QNSA 4DO5A 5BZAA 1M65A 3HF3A 1UC5A 4N4PA 4LBRA 4Z0SA 2FJKA 5D2XA 4PB4A 3GSMA 5A6BA 3Q2DA 4CEUC 3CT7A 2VR5A 2OLHA 2DPEA 4ATDA 1HP5A 4YTUA 3R1ZA 2HVNA 4O57A 1GWJA 4LS2A 4AD2A 3UY7A 3TDFA 4C5YA 4PE8A 4L5ZA 3DXIA 2I56A 3PJTA 2BGSA 3PBUA 4GA8A 3UF9A 2J6XA 3OW1A 1X38A 1IYXA 2J24A 2V63A 3TIMA 4DWSD 1FHUA 3KBJA 1XM3A 3H26A 1J10A 4MKNA 3U5UA 4HZ7A 4UMCA 4LV4A 1EOKA 2J74A 5EMMA 1XLEA 1E70M 4OBSA 4H19A 1U5JA 1QJWA 2WWDA 3BG9A 1DE5A 4WIWA 1MZHA 2AQOA 3W53A 1FWIC 3MUIA 1VFFA 4KFNA 2KAUC 1H4PA 4DZAA 2X0SA 3W00A 4OUEA 3AXXA 2DQXA 3CQHA 2PWHA 3T44A 4DNHA 3OP2A 4Y8FA 4UNIA 4M8UA 1VLWA 3QTPA 3LSCA 1MO0A 3O6CA 3OG2A 3G24A 4KWUA 3TNOA 4D1IA 5K4ZA 1XG3A 4U10A 1JF6A 2PUZA 2ZZ2A 3CPGA 2QAPA 3P6LA 1KTBA 4N7QA 2EPMX 3LCFA 1HW6A 2HBXA 2NUWA 3RO6A 2DUXA 1XLBA 3FNDA 1L6FA 1KGUA 3THUA 2D3LA 3SN4A 1B30A 3V36A 4IGHA 5LNUA 1TPB1 2O7QA 4FXFA 1TQXA 9XIAA 2DGAA 5F2MA 4I5XA 2BHZA 2PGRA 4HJWA 2GVJA 3GC2A 3PM6A 2VEFA 1CXLA 2DQWA 3PULA 4DJFA 2ZFAA 3W1TA 3GFZA 1L8NA 2Y2WA 3AHYA 5HA7A 3ONCA 4GI9A 4R34A 1H41A 3C4UA 5HMDA 4FOKA 4MJ2A 1KCKA 4FX8A 4M82A 3JW7A 1GHRA 3CIXA 2GL5A 4G6CA 4HJFA 2P0IA 3UP8A 3G3DA 2ADAA 3W81A 1TZ7A 5CC6A 1BQGA 3DYMA 3VGEA 1WDQA 3TTOA 1VR6A 3WH9A 4LS1A 3K2GA 4QJ1A 2CLMA 5DXXA 1BFNA 4AZ5A 4CN6A 2P3EA 3JRKA 3UBPC 4KIEA 2ZUUA 3WEZA 3OB8A 4PMOA 8CGTA 4US5A 1HKWA 2OCZA 2CKRA 1H11A 4F0MA 1MW1A 1BXCA 3GXIA 2TYSA 1Z8AA 5BXTA 4AHOA 1R8LA 3VOCA 3WNMA 1U33A 2HEJA 4AYSA 3IPWA 2QF8A 4I6KA 3SM0A 3W2LA 4PUDA 4U3CA 2YFOA 3VOIA 2GQ9A 1QDSA 2EAWA 2FH6A 1F2JA 5AYYA 4XZLX 4QQ3A 2G3FA 2QGYA 4C5ZA 4ZQCA 3USZA 3APTA 4S3GA 5E9XA 4IMEA 1QR7A 2CXEA 1UASA 1LRNA 1UW9A 2G37A 1EPVA 1BWVA 2MUCA 3EWXA 2RKXA 3NQMA 3ZMRA 3CLMA 2TAAA 4DBEA 4O10A 3CO8A 3QF0A 4IT1A 2ZRVA 2CHOA 2BODX 4Q4QA 4H3DA 1W91A 1F9CA 1RCXB 2D2HA 5AECA 2GSHA 3KW3A 4RCXA 4B90A 4DHGA 3NM1A 1KQYA 3MPGA 4NAFA 1S5MA 1SO3A 3K4WA 4YPJA 1R3RA 3RAOA 4GWEA 2ZWZA 3GW0A 1XDJA 3S9IA 1RAKA 1WX0A 1X96A 1IT8A 1IXPA 1SQ7A 2QUVA 4RV8A 5H1WA 2GJXB 3ISIX 1U1UA 3HGSA 2A3EA 3PAJA 3SCTA 3O06A 2KX9A 4YLWA 4BZYA 3TYDA 4H6RA 4IJRA 2HS6A 3T6CA 3WL1A 4AHQA 4ZL1A 1P7TB 4JNZA 3CU2A 4U33A 3GG7A 3MS8A 1SFTA 3PJUA 1UA7A 4XG1A 4UTWC 4PCSA 1IT0A 2OR2A 3VGGA 2DW7A 4GX9A 2O4MA 2ABBA 3ITGA 3DGRA 1VPXA 3DX5A 1UC4A 1Y0EA 4FF7A 2EG6A 4ZODA 2V5JA 1OM0A 1N2VA 3D0CA 3H7RA 1JF5A 4FPSA 5FEXA 4BWLA 4WKFA 1F3XA 3MCMA 2WZIA 4P5UA 4IIDA 3VNLA 4HMDA 1NH6A 4QR6A 1JUKA 2VEPA 4UMAA 2V5BA 1JYNA 2BLEA 4UTTC 3UJ2A 5D8ZA 5I3HA 1TV5A 1TE1A 1HJVA 3RN6A 1LOQA 1TPUA 3V1HA 1OK6A 4KQNA 1M01A 3MWCA 1JEZA 3S2LA 3U2OA 1XC6A 1LUCB 3U2EA 5I07A 3ZZ1A 1B4KA 2YCJA 1JZ5A 3UA3A 3KTXA 2RDXA 4W89A 3TQ0A 1XD1A 4B9ZA 1GNXA 1IEXA 4WJXA 2ACRA 2H9AA 5HMEA 3LRKA 2PDIA 4REQB 1SFJA 3UYIA 1VYSX 2IPJA 1JCLA 1FCQA 5M03A 3B0UX 2DIKA 2V5KA 3AU6A 1DORA 5DT7A 2CIPA 1OBAA 1UB3A 2VCBA 1GOQA 5U4NA 3BUVA 4HN8A 4RKAA 3UG8A 4XTDA 2Y7GA 3L0KA 3KP1A 4W4QA 3QSRA 3E0WA 3T42A 2Z29A 3TQKA 3QMSA 4YN5A 3IVTA 1JCTA 4MB4A 3S83A 3TMQA 3S2MA 3KHJA 2FIQA 3WLOA 4UQEA 2OT1A 4F0LA 4C6FA 1KR0A 5DCEA 3M0YA 4JCMA 3WJZA 2YL6A 1YRRA 4E5TA 2Z6IA 3ZR5A 4NVTA 2XH7A 5D2WA 2WBKA 1KFEA 1DOSA 1RK5A 3VKAA 3GBDA 4AH7A 2CXGA 3W1PA 1JIBA 1UD5A 3S9YA 3W74A 1B4EA 4LJ3A 1H09A 3TZFA 4PBGA 4HU0A 4HZMA 3FVMA 2R1KA 5D8WA 2PRLA 1SGJA 2VD8A 4NU7A 1TPWA 3NR0A 1LG1A 2AAAA 2TMDA 1K1DA 3VMOA 1U22A 1E56A 4UOJA 5FEWA 5AVHA 5DN1A 3BPWA 4XQ6A 1A5OC 4B16A 3M0JA 3WQGA 1TPC1 3VNZA 3EA1A 5CC7A 2QMKA 4GNJA 3WK2A 3H2NA 1QFEA 5FSDC 5ABTA 1XW8A 3ZM8A 4C6PA 3TSBA 4DPPA 3C0JA 3B0PA 3KOFA 1YLVA 4XD3A 4O50A 3MC5A 4GFSA 9XIMA 1HJWA 2OYLA 3K46A 3O6YX 3LPPA 2ZZ1A 2QEZA 3ALFA 4F0KA 4MMWA 4S2CA 1PXGA 4US5D 4PUWA 3O05A 1SR9A 3BSMA 1BTMA 2XIOA 5F4XA 1HL8A 4M6UA 1XINA 4W7WA 5EMLA 2JGYA 3AI0A 1PWMA 1MW0A 1B3VA 2V3EA 3HN3A 1I2PA 1QCWA 3LUTA 4HNTA 4R85A 3BC9A 3QBUA 5B7YA 4MNMA 4LC8A 2FTYA 3N2OA 1T99A 2OSWA 1XYZA 5JU6A 4Z42C 4HT3A 1OC6A 5MKGB 3W27A 3GXMA 2OFJA 4DJDA 4NNBA 3PBWA 3VZXA 2QT3A 1R9XA 3L9CA 2ISDA 1MXDA 1WYIA 4M56A 4N6EA 2VEKA 2XM1A 2VR4A 5EFDA 1SW3A 2ZX7A 3LNMA 2C15A 2G3NA 3ABXA 5A2CA 1DIEA 3UZXA 3KFTA 4AUBA 4NJKA 3UYCA 3NVDA 2DZPA 3C8NA 3URBA 1ICPA 3PG8A 1BG9A 3GO2A 1XSIA 3UQNA 1JI2A 4MJZA 1BAGA 3HA1A 3Q37A 4FNRA 2E9LA 1UUOA 2QV5A 1SMAA 4IOTA 2X40A 1CXHA 3IJ7A 4ZENA 3HPFA 2W4XA 3N2CA 1WUEA 1T6MA 1OZMA 4RDWA 1XL9A 1UKPA 2JKPA 2ZIDA 4HVXA 2DT1A 5M1TA 5LIUX 2YLAA 3B9DA 3NZGA 1QK0A 4NAFB 3KWSA 3QGKC 7TIMA 4N42A 1OX5A 3VNKA 2EO7A 3GAYA 4RW5A 5C6MA 3B05A 2E7FA 1K6AA 2WMFA 3VTRA 3W73A 1SO4A 1XLCA 1ZY9A 3BARA 4I8DA 3M16A 1ZBKA 4MFEA 2Z0IA 3BZJA 2CKSA 2D73A 1VJZA 2ZXAA 3TFXA 3WQWA 4TV5A 2FJUB 1W3TA 4NJIA 2CZEA 2WSRA 3OPSA 3DN5A 5E70A 1G4PA 3AHXA 2PDGA 3IARA 5G1YA 3XIMA 4GIEA 3KRBA 1UR2A 3VNYA 1A0DA 1IGWA 2PTZA 4R27A 2FMOA 2JALA 1XIFA 3IV8A 3HOJA 2EXOA 2WJEA 3E49A 4GZ7A 3VFLA 2IXUA 3SW6A 5JMUA 3IV3A 4FSAA 4PRWA 4XZWA 4MWAA 3PR2A 1WKYA 4MLRA 5I77A 1V0NA 4A35A 2FPYA 3IIVA 4GUFA 3PNZA 1C92A 1IGSA 4HTBA 1RXOB 3LCIA 3W23A 5AN7A 2BV9A 4OZOA 2RDWA 2J8FA 3VOGA 2D2GA 4R7WA 4A8NA 4NYYA 4AZBA 4XO7A 3EWYA 3BMVA 3F4WA 4N02A 3WUBA 4FX6M 3M41A 4I3GA 2FTWA 1DQXA 2AMGA 2HCVA 5AHFA 2VX4A 3TTQA 5B80A 3VE9A 5REQB 4HB7A 1AMYA 1M7PA 3T0TA 3M5XA 2I9UA 3TN5A 3SURA 1VCVA 4X63A 1KTNA 2PWUA 4UNKA 3C61A 1TB3A 2JQXA 1OGGA 3C6CA 3KBMA 3WN6A 1FUYA 3R12A 3V7PA 3QM3A 1MMFA 3WJYA 2DP3A 4Q6XA 4LPCA 5FKYA 5IDZA 1EWDA 4UZSA 4KKXA 3W3OA 2FZ9A 3B8VA 1NFPA 3SY8A 3W07A 4EPKA 2PDMA 1GORA 2Y61A 3B8UA 4B5NA 1J5SA 2DZTA 3ARRA 4WJ8A 4QDPA 3VD9A 4E6MA 4XKYA 4LYQA 5G1TA 3KLKA 5FIPA 3WMSA 2XWEA 4H2HA 1L6YA 1QNPA 2ZC1A 4PMDA 2VVSA 4OTKA 4BF9A 4DO4A 1XYMA 5LIKX 4J9JA 3R4IA 2VGIA 4C6QA 4LSBA 2CZVA 4PEEA 4P7LA 3RGTA 1MUMA 1T8QA 4QLLA 5BWAA 3N9RA 3PTKA 3DG3A 5IBXC 1W5OA 4DNMA 4HZ8A 1P43A 1EX1A 1REQB 2ZUMA 4TX9A 3AS1A 4YHEA 1V6UA 4X61A 3ZVIA 1PIFA 1GK8A 4GYJA 1G1YA 2CERA 4XBJA 3SUSA 3GVRA 3BLEA 2J9YA 1BVWA 3O6AA 4U2YA 5AB3A 2E4TA 3NJ3A 1FVPA 1V0LA 2I14A 3QV8A 3W83A 1G7UA 1V79A 1LT8A 5HUOA 3TE9A 1LRTA 1NM9A 4V2XA 2PWGA 2Y62A 2O0TA 3V16A 3W1LA 4GHRA 3PN8A 3AAMA 1EQCA 4H01A 3RJYA 2A85A 1H1YA 5G1MA 4I7WA 2C8NA 4IWWA 4D9PA 4IIBA 1X8CA 1U5VA 3TCEA 2PGEA 1EGMA 3WH7A 1V4YA 3DI0A 1CLVA 2UZ9A 1O68A 4N9CA 3XISA 2FQIA 1J18A 1IZKA 3VDHA 3R8HA 3B97A 1HG3A 2OKOA 2PEVA 4N4QA 5BNKA 3TUUA 4TMCA 4RDZA 2CBIA 3BSGA 3RM9A 2CESA 2VHLA 4O16A 2PDQA 4C1LA 1EOMA 2I5IA 3IVSA 4IUOA 4MDPA 2YCEA 1SZEA 3WBEA 1FWEC 3O63A 5I3IA 1HVQA 1KV8A 4HNLA 2VZUA 3AIVA 3RO8A 1EO5A 2XH0A 3LI1A 4KRZA 3G1RA 2OJPA 3FDKA 3NQ7A 2VXNA 5AC7A 2VQTA 3W2UA 3I3BA 3VKCA 2Y85A 3TYUA 2VM8A 5FJRA 3W24A 3QLDA 4O0KA 2H90A 5BOOA 3PZUA 1K02A 5C9XA 5HWNA 5CG7A 1A5MC 3QYSA 4GY0A 3PWAA 3N2MA 3MMTA 5ABFA 1JZ3A 3JZEA 1JDAA 2YCKX 3GKAA 1F3TA 4WGHA 1W5PA 1FFRA 4L6HA 3NYDA 3SQSA 3I4KA 2YBTA 1ME8A 3W7CA 3F1QA 1KV5A 4NYUA 1O4UA 2B7OA 4H8UA 1OX4B 1W1TA 3H7VA 4EPBC 4JQ1A 3AHTA 3HV9A 4O19A 1XIEA 3PVFA 4DLFA 2NQ9A 3RNDA 3SCNA 3HGRA 3POHA 4TR9A 3ZQ9A 2RFGA 1O5RA 2ZVIA 3CMFA 4Y9AA 3H4WA 1XFBA 4F8XA 4X0VA 1FP8A 1CGYA 2AKZA 3L21A 3OBKA 5D38A 1ZUAX 1W9VA 3PZOA 2TRSA 3FS2A 5AYIA 1U1JA 3S1GA 3VKDA 3LXBA 4AHPA 3GKFA 1XRTA 1F61A 4V28A 2A6LA 2BXZA 4XD4A 1AQ0A 4CD8A 3PB2A 2JBMA 3W22A 3MHFA 5AC5A 3W1QA 3VDBA 4IMCA 4QHRA 4H9MA 3AU2A 2EPHA 4BK9A 1Z9AA 4PFHA 5E0KA 2IKGA 1UWIA 5GJPA 2WCSA 4OHQA 3VGDA 1YKWA 4HCHA 4FP1A 4KFOA 2ZXQA 1VP5A 3BL3A 2RHGA 3SZ8A 3LXCA 4H9UA 4O1AA 4K2SA 2WBGA 1A5LC 3VUPA 2W91A 3G18A 1I2NA 2QQ6A 2IPFA 1BWLA 1ZFJA 1C7SA 3GS6A 5BXRA 4KWOA 2GPTA 2ZX8A 3PPCA 3RFAA 3UWYA 5BMWA 3WX7A 3QQ1A 2QDGA 3ZR4A 2O56A 1LF1A 4D6DA 1EH9A 1NWSA 1UR0A 3STFA 2DZSA 1UP0A 5AC6A 1RD6A 3QH2A 3LQGA 2INFA 5JBDA 4LVAA 4NSBA 2ISFA 3STPA 2CHRA 1JDCA 1E1CA 3N2TA 1BXBA 4GZIA 3H2AA 2VP8A 4OV4A 2W3ZA 4HU8A 5D9MA 2VR2A 5E5CA 4BHYA 5A6KA 3PPGA 3WELA 2NWSA 1M68A 5KTLA 3M07A 1LM1A 2ZRXA 3BLIA 4M51A 1PDZA 1BD0A 3PPFA 2J88A 6XIAA 2NQLA 3UA4A 3F5LA 5J5RA 3RXZA 4F48A 3TA9A 4DELA 2Q8LA 1P0KA 3H24A 3QPEA 3NIYA 4IPJA 1E6SM 2QAFA 3LPFA 3T8QA 3H22A 2V81A 1UKSA 3MKCA 3STEA 2VT0A 1IEVA 4LAKA 1WAUA 2E0PA 2I57A 2GUUA 4LAMA 4DAIA 2J4GA 1KA9F 2Z1KA 1SZNA 3CIWA 5C9RA 1D8WA 1WBJA 3WKZA 5FAJA 4C7DA 3VGHA 1KFBA 4ADSA 4C6LA 3QZAA 3VCRA 3UJSA 2PF0A 3CYJA 2G3MA 4U28A 2Q02A 5I3FA 4UWMA 1CXEA 3VKBA 1KFJA 3AIEA 1S5WA 3IJIA 1QNVA 3CL6A 2C0AA 1I60A 1OFOA 3I7SA 2J9ZA 3UJEA 3NQBA 5KZ6A 3SEPA 1W5NA 1E1EA 2PODA 1GJPA 2V2DA 1W5QA 3GVWA 4GOAA 4MJ4A 1AJ2A 1XKJA 3F5KA 1M7XA 3H53A 1OCQA 3NOEA 1PCWA 2G3JA 4XZHA 3FKRA 2YIHA 4GVFA 2WHJA 3U6WA 4A8IA 4PMJA 1FDYA 4E0CA 2VYOA 1MWOA 2GOUA 4JL2A 2PGFA 3DHFA 3NA8A 1LL4A 3VOHA 3M9YA 1X7IA 5CSYA 2V38A 4TVCA 2BVWA 2C18A 3WQCA 4CQBA 3GU9A 2HBVA 1UROA 4ZSTA 1E9ZB 4DJDD 3SUUA 1E3XA 3VU2A 1EIXA 3ES8A 5DFAA 3O15A 1JCMP 1CT5A 3E2SA 2BOFX 1F73A 5DT5A 5HBFA 1EDQA 2W9MA 5AHEA 3H2FA 1B9ZA 1OY0A 2PP1A 2W66A 1FWTA 2ZA3A 1W56A 1P6WA 3MANA 2JFEX 5C7VA 4DUOA 4S3AA 2E5BA 1YEYA 3LLFA 3VGBA 1I1WA 4QE4A 4GXPA 3QHNA 1K8CA 2VOTA 4NI8A 2E25A 1QBAA 2CITA 3AALA 3FA4A 3LZ3A 4N0RA 3UEQA 2E5DA 4S3FA 3HQNA 2YBUA 3GW3A 2E28A 2V5DA 4FOUA 1OFDA 4FF5A 1QW9A 2YZRA 1QHZA 3W7NA 4YTTA 3OEXA 2YKKA 3GY1A 4H9YA 1XGEA 6ALDA 1XKYA 1UR3M 1B3OA 1PCKA 2DVTA 1VFLA 3W29A 4CVWA 1Z41A 1TVLA 3N2BA 5CSSA 3BGJA 1HJQA 4YIWA 3N3MA 4ILSA 4UNLA 1VHNA 4GE8A 3EOUA 1XPGA 2XTKA 3KS6A 3THQA 3ELFA 4UTJA 2YXGA 3QR0A 1ZBWA 3MSGA 1B3WA 2QCDA 4IP5A 4KRUA 4QRNA 2BMBA 1NIUA 4DX3A 2Q8ZA 4LBSA 3U5YA 2CLEA 2G41A 4O11A 3ZSTA 5SWUA 3UPBA 3GR7A 3C3UA 2QIIA 1KRAC 2QYGA 3EZ4A 1RSCA 2NVAA 1EJXC 3G1VA 3THDA 2XPKA 2XG9A 5FAGA 2A3HA 1V3HA 3MBDA 3WNOA 1K4GA 2GSJA 5DLCA 4JKLA 1PE1A 3LV6A 4GJIA 4EPEC 4KCTA 3LS9A 4JNMA 1T0OA 1DJHA 3GTXA 4X22A 4LUIA 4LCQA 3S6DA 3VC5A 3B8TA 1RHCA 4FEZA 3WUFA 1TWSA 2PCQA 1UMLA 2OZ8A 4K68A 2CBJA 2NSXA 5LHFA 2IMRA 3DYPA 1JZ6A 5EBAA 3TZNA 5ECUA 5KEZA 4EIVA 5AZ0A 1O12A 1LJYA 2ZADA 1HJXA 3SFWA 4JHZA 3A3WA 2XIIA 3WBWA 3GNNA 4BS0A 1JPDX 5M3WA 5JBEA 2ACUA 4QP0A 2OTDA 4ZFCA 5E6ZA 2XVNA 4JFUA 1XPYA 4EF9A 5BOEA 4Y9OA 2A7RA 2WO5A 4IXXA 1RP8A 3LLXA 2WVTA 2Z1VA 4MSSA 1DJGA 2BZNA 3V5CA 4BKNA 2GK1B 4ZE4A 3MHGA 4A3RA 1JYXA 3URQA 2PRHA 4Z2JA 3W1AA 1LL6A 1W8SA 4TXEA 2PWVA 3MHUA 4LVGA 2WV8A 1C8XA 4O1EA 1H7PA 2XVLA 4NUWA 5LA1A 1XGZA 3D46A 1ITCA 1QOQA 3T4WA 1Q6FA 4C6KA 1TCDA 1O60A 1B3YA 3BMWA 3TA6A 4HBKA 1VENA 1G4SA 3B3DA 1E6QM 2ZOXA 1JUBA 3WNLA 1DWJM 3E74A 4Z2KA 1F07A 4Y2WA 1PSCA 4REQA 1F76A 2O9OA 3P67A 4KFPA 3TONA 4C1NA 2E6YA 1ADDA 4RNFA 2NZLA 1X39A 3WD4A 2VO5A 2H3BA 2OXNA 1E0WA 3ZOAA 5I24A 2X16A 4XIAA 2BY1A 3AXHA 1W1VA 3WQOA 1TUXA 4PFMA 4HA0A 4AZIA 3FYPA 3WZ0E 1J12A 2QJNA 3A47A 4JX6A 1YE4A 1QT1A 3VK5A 2HROA 2X41A 2NV1A 3QQWA 3L12A 1EFZA 1TV3A 5I00A 4IUGA 1W17A 4D6FA 1RPKA 1KCLA 2Z7KA 4XISA 4ZSUA 1MUCA 1BGAA 4IGSA 5KZDA 5ABGA 1EJTC 8A3HA 4MZYA 4ES4A 2EPNA 4UOQA 1D7KA 2FB2A 4W85A 4ROQA 1OABA 1XYCA 3MYOA 1VH7A 2BVYA 2E77A 4OQVA 1REQA 5L6UA 3HG2A 1LBFA 1Y5VA 3CTLA 3IANA 1QASA 4GI8A 3CK5A 3HPAA 3LNPA 4JYDA 5A3HA 3QYQA 4WGXA 3C0QA 1IT7A 3WLIA 2R9RA 3BV4A 3TNBA 3IIXA 5MHBA 1JL8A 1OHLA 5CPNA 3LCWA 5LSMA 1S2TA 3ARUA 3WY1A 3CUJA 4LANA 5EU9A 2D2JA 2CLHA 3G1HA 1FWBC 1V7YA 4C6EA 3SIMA 1KKRA 3MCOA 2EBNA 4UR7A 4O1BA 5U7SA 3T78A 4UTLA 1DXIA 4HHMA 1TWDA 3L7RA 4UTUA 5I3KA 5DMLA 4E8CA 4AC7C 1DWFM 3AXMA 3CPRA 3T7VA 4IX2A 4C6IA 3G0SA 1BKSA 4AIBA 2VCAA 4CNSA 2OELA 4GO9A 4IQDA 2NWRA 2V69A 2ZZ7A 1H0IA 4IZGA 3W7GA 1XIIA 1XD0A 3ME3A 4DLMA 1TPFA 3N12A 3UG3A 2NVCA 2XGIA 4D2JA 3R7MA 5A6JA 4GCXA 4NQ1A 3WFLA 3N3TA 5I23A 3NQDA 4BFAA 4S3DA 3KP0A 5IDIA 4KWSA 2J8GA 3GH4A 1HUVA 2PZNA 3WK1A 4CU6A 5CGMA 5H2ZA 1DL3A 4GC4A 3KCJA 2JGQA 4YYCA 5DMYA 4DBDA 2GGGA 2H8XA 1E72M 3DCPA 4LY8A 3VDAA 2YR1A 4EANA 3M0IA 4NJJA 2R6OA 2OO0A 2NT1A 3DIPA 3D6NA 1TUFA 3QY7A 2ZX9A 3EX4A 2YOCA 3OJGA 4QITA 1QNQA 3HQPA 1CIUA 1QO5A 4OT7A 3PZGA 4TX8A 1TMLA 1SU5A 2QUUA 3QZ6A 2YL8A 2VEIA 1YBQA 3WJSA 3RLUA 5GNZA 4XO6A 2Y1HA 2QCDB 2Z4GA 2WJDA 3ARXA 1QW7A 1PWLA 1XHGA 1GPFA 2ZE0A 1S46A 5AVNA 1E9IA 2B31A 2ZKMX 1XSJA 1B5TA 1MDLA 4AW7A 3MB9A 5L9FA 1Z32X 3WQ6A 2BG5A 2BBFA 3P93A 1WZKA 1R38A 4PMXA 1S2CA 4K8HA 4FALA 4W87A 5FF3A 3KS5A 2JE8A 3AYTA 4D6CA 1EYWA 2CZDA 2WSYA 3C5QA 4ALDA 3O8AA 3R43A 3NQEA 3F2CA 3A9IA 3NQ6A 4AVOA 3EMCA 4QQUA 3QOKA 4QE5A 4B91A 3FXGA 1FRBA 3RJXA 5CXPA 1RA0A 4NRSA 3N4FA 3G1DA 2YX0A 1XLLA 4KGLA 1HKIA 3MWAA 3ZT6A 2F61A 2F6XA 4PUMA 1V6VA 1PUDA 1QO2A 2D24A 2ZZ4A 3CHVA 1CECA 4NZ5A 4NXSA 4ZBCA 1SM9A 3MI2A 4QIUA 4PH6A 3NTYA 1RV8A 4CCCA 1KRCC 1ITXA 1O66A 4LOCA 3W6YA 1RUSA 1P0DA 4BQ3A 4PCPA 4PCTA 4ZTXA 2Z1SA 2WMIB 3W6MA 3WNPA 1TTIA 4A8LA 1H0GA 4M7SA 1OC5A 1AD1A 4UQ9A 2P5NA 3ARTA 3OZOA 4XSMA 4GUGA 4NZJA 3L66A 3V5FA 4RXFA 1RK6A 4MNKA 4J3VA 4F2BA 3NZ1A 1OGSA 3QHOA 2JF6A 3S42A 3QGAC 3NQVA 1Q6LA 4ORIA 1PYMA 1MQPA 2CHNA 2GZXA 3FSUA 3H7UA 3LPGA 1UKTA 1B9BA 5JBFA 4GCAA 3RX3A 4ML4A 2IKJA 4LUTA 1OD8A 2WQPA 4JN8A 4YVXA 2VGBA 3B4UA 4ZOEA 1R3TA 1MW2A 1Q8JA 4IFKB 5A95A 3OZMA 1CGUA 2VZTA 2DUZA 2YFNA 3PZQA 4MWAC 4AXKA 5A6SA 1BF2A 3SFKA 4MNJA 4NIRA 4F40A 5HQEA 4FXJA 4GK8A 4WDWA 3SGZA 1FDJA 4KGJA 1EJUC 4AWUA 3J7HA 3QR3A 1ZSXA 2W79A 2OODA 5LIYX 4GI6A 3GFXA 3PSWA 2VX5A 3IIZA 3IIPA 3FXYA 2VJXA 3DG6A 3DFSA 3L4UA 1PKYA 3WMCA 5D05A 2C6QA 2X8RA 4LUJA 3TW7A 2VMFA 4P8VA 5IRPA 4P61A 4DBWA 3UWZA 1PKNA 4GBDA 5DMNA 3M6DA 1EYEA 3MSDA 2EQDA 1TRDA 3MUY1 3UU0A 2IPGA 3ITYA 2WWCA 1MNSA 2V30A 1KLYA 3A9BA 4LFYA 2IXVA 1B1YA 1TA3B 3AWNA 2F6UA 2QJJA 1IR2A 3KTCA 2DSVA 1JAKA 5C5YA 3T07A 2ZDRA 2WMIA 4PA8A 1K9EA 2WSQA 3GVVA 2P50A 3O2LA 4G7EA 2FGZA 4PULA 3U48A 1GHSA 4DUVA 3AFBA 3GC4A 1VFOA 3VD5A 4H9VA 3CL7A 4Z2GA 1YDOA 4DN1A 2H6RA 1P48A 1H2JA 1QXLA 3DYOA 3G6MA 3GU2A 4JOMA 4IIEA 5KSWA 8XIAA 3VIMA 2XFFA 4WX2A 4HPXA 3BANA 2PGWA 2ISVA 1VRXA 3PB0A 3E0LA 2HZGA 1HO4A 4WF7A 3LN3A 1Z69A 4G9PA 4Z2LA 5EMYA 2WQDA 5E09A 4D8ZA 3KOZA 1UP3A 3CHCA 1OD0A 2AKMA 1VRDA 3VCNA 3WMBA 4RZ6A 2YCLB 3GTNA 2WKGA 5HNNA 2NLYA 2IQTA 4MUPA 1UP2A 5JQ9A 1NEYA 1R5YA 5A8QA 5HMSA