2DDZA

Protein of unknown function from pyrococcus horikoshi
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
SMELLIIKERRIDYDGSAIRSHWAYRNFGILGDSLVVFRGKCNVKVEEMVDIEDLRLRKEIKGDDMVHYILELFWHPDILLASSLQKLLIARLVELLWNYGIEASRRGDDIYVNGRKLSISIATVSPVSIKIHIGLNVKTVGVPPGVDAIGLEELGIDPTEFMERSAKALVEEIEKVRKDSLKVRWVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Unknown Protein from Pyrococcus horikoshi
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords 190aa long hypothetical protein
total genus 61
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04017 DUF366 Domain of unknown function (DUF366)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ddzA00
2Q5IA 3A7UA 4G84A 4YREA 2ZR2A 2EJGA 1EVLA 1N9WA 4WJ4A 2XGTA 4O2DA 4XEOA 2DTIA 2E65A 1YFTA 2C7IA 3L2ZA 4L87A 3V7CA 1EOVA 3A31A 4DQ2A 2ZCEA 2DJZA 2DKGA 4XU2A 2IY5A 11ASA 1EFWA 3A7AA 3HRKA 1EIYA 4XU3A 3RKWA 2QHTA 3A5ZA 1EIYB 1E1TA 1EQRA 1X2GA 2E1HA 2E41A 2EL9A 3L1AA 3WQZA 4H2SA 3UH0A 2CJBA 3EFRA 4HA8A 4EO4A 3HY1A 4CH4A 1H4QA 3TUPA 2QHVA 4YROA 3RL6A 3ERRA 2PMFA 4CS4A 1NJ8A 4YRKA 1NNHA 2I4LA 4UPAA 1G5HA 1YB3A 4Q15A 4TWAA 1HTTA 4WF2A 1ASYA 3PCOB 2ZTGA 3A7RA 2CIMA 4BW9A 4YCUA 2Q7EA 4TVYA 2ZINA 1VQZA 1YFRA 3HXUA 2E5AA 1SESA 4P73C 1E1OA 4YRLA 1WLEA 4H2WA 3V7SA 4H2VA 2EWNA 3MF2A 4TVWA 1NYRA 3A32A 4PG3A 2DTHA 4YRTA 3IALA 4CH5A 3HY0A 3LC0A 1B76A 2ZT6A 3BJUA 4RQEA 1GGMA 2CJAA 3TEGA 3W3SA 4XTUA 3HTZA 3I7FA 2RHSB 2ODRC 4ZIBA 3VQYA 1X54A 1NJ1A 3RKXA 2QHUA 5C51B 1B7YA 2ZXFA 1X01A 2DZCA 1Z7MA 5KNNA 3RUXA 1X55A 2ZIMA 2EAYA 2Q7HA 1JJCB 4YRMA 4HVCA 2Q7GA 3RIRA 2DQ3A 3HXYA 1WYDA 1H4VB 1NJ5A 4YRNA 4XEMA 1BBUA 4YDQA 4YP0A 1WPYA 3MF1A 2ZZEA 1YGBA 2RHQA 3V7RA 4RQFA 5C52B 1L0WA 4P72C 3R07A 4TVAB 1WQ7A 3HFVA 4KR2A 4XU1A 4HWOA 3PZCA 4KQEA 3HFZA 1ASZA 5ELNA 4XTVA 2DEQA 2PMEA 1ADJA 1RIQA 4XU0A 5HGQA 1C0AA 2ALYB 4P72A 4WI1A 3TEHA 4X5OA 4KR3A 4P71C 4YRSA 3V8KA 4P75C 3MEYA 2E64A 1YFSA 4ZTUB 4OP0A 4AH6A 3IG2A 3M4PA 1BBWA 4E51A 3NENA 2G4CA 1J5WA 4H2XB 3E9IA 3M4QA 3L4GA 4H2UA 1QE0A 4XTWA 3V8LA 4TTVA 4H2YA 4UP9A 3ICAA 4XTXA 5E3IA 2P5IA 3V8JA 4XTYA 3QO7A 3REUA 3LSSA 3HXZA 4CH3A 1WNLA 2I4OA 1FYFA 4YRRA 3HXWA 1KMMA 3P8VA 3HFZB 2RHQB 2ZNIA 2CJ9A 4YCVA 4P3PA 3A5YA 4YYEA 1B70B 4Q6GA 3QNEA 4P75A 4P74A 3L4GB 2ZIOA 2ZZFA 2DXUA 2ARTA 3HXXA 3IKMB 1IL2A 3VQWA 4YRJA 4RDXA 3VQXA 5K1XA 3KFUA 2AMCA 4YRQA 2DU7A 4K86A 2AMCB 2ZNJA 2XTIA 4CS3A 4H2TA 4YRFA 3RKYA 1X2HA 4P74C 3UFGA 2ARUA 3P8YA 2ALYA 1KOGA 3G1ZA 5ELOA 3OD1A 2DQ0A 2FYKA 3NELA 1G51A 2Q5HA 3FJPA 1BIAA 4P3OA 2AKWA 4H2XA 4YRIA 4HWSA 3A74A 2ZT5A 1SERA 2J3LA 1W66A 2EJ9A 4YRPA 2ZZGA 4HWTA 4J15A 4NCXA 1PYSA 1NJ2A 1ADYA 3HXVA 3BFMA 3QTCA 1B70A 4UP8A 4RMFA 2C8MA 4HWRA 3DSQA 1USYC 1WU7A 1Z7NA 3P8TA 3UGQA 12ASA 4YCWA 4P73A 3PCOA 3UGTA 3IKLA 2I4MA 4P3NA 1HXDA 4UP7A 3CMQA 3QO5A 2ODRD 1B8AA 4HWPA 3TEHB 2DVEA 3HRIA 2DDZA 3RACA 3VBBA 2ARSA 2DZ9A 1EVKA 2E10A 4K87A 3REXA 3RF1A 1SETA 3QO8A 2I4NA 2E3CA 2EJFA 2ZGWA 1ATIA 2DTOA 1E22A 5C53B 1KMNA 4TQDA 4G85A 2RHSA 1E24A 4ZTZB 3RGLA 3E9HA 4LNSA 4TVAA 1G5IA 4OLFA 2DXTA 4BWAA 1NJ6A 2AKWB 2ZT7A 1B7YB 2ZT8A 3NETA 4H02A 1HC7A 2QHSA 1H4SA 2ZR3A 5F5WA 1BIBA 2CGHA 4YPFA 3LSQA 4DPGA 5K1PA 1SRYA 2P0LA 3NEMA 1LYLA 4K88A 3EFSA 1WQWA 1H4TA 2J3MA 4TQFA 4EX5A 1PYSB 1JJCA 4XTZA 2IY5B 3VQVA 1NYQA 4CH6A 2HNIA 1X56A 4YRCA 4CS2A 2DU5A 4YRGA 4WJ3M 1USYA 4PHCA 4P71A 1QF6A
chains in the Genus database with same CATH superfamily
2Q5IA 3A7UA 4G84A 4YREA 2ZR2A 2EJGA 1EVLA 1N9WA 4WJ4A 2XGTA 4O2DA 4XEOA 2DTIA 2E65A 1YFTA 2C7IA 3L2ZA 4L87A 3V7CA 1EOVA 3A31A 4DQ2A 2ZCEA 2DJZA 2DKGA 4XU2A 2IY5A 11ASA 1EFWA 3A7AA 3HRKA 1EIYA 4XU3A 3RKWA 2QHTA 3A5ZA 1EIYB 1E1TA 1EQRA 1X2GA 2E1HA 2E41A 2EL9A 3L1AA 3WQZA 4H2SA 3UH0A 2CJBA 3EFRA 4HA8A 4EO4A 3HY1A 4CH4A 1H4QA 3TUPA 2QHVA 4YROA 3RL6A 3ERRA 2PMFA 4CS4A 1NJ8A 4YRKA 1NNHA 2I4LA 4UPAA 1G5HA 1YB3A 4Q15A 4TWAA 1HTTA 4WF2A 1ASYA 3PCOB 2ZTGA 3A7RA 2CIMA 2A8EA 4BW9A 4YCUA 2Q7EA 4TVYA 2ZINA 1VQZA 1YFRA 3HXUA 2E5AA 1SESA 4P73C 1E1OA 4LVKA 4YRLA 1WLEA 4H2WA 3V7SA 4H2VA 2EWNA 3MF2A 4TVWA 1NYRA 3A32A 4PG3A 2DTHA 4YRTA 3IALA 4CH5A 3HY0A 3LC0A 1B76A 2ZT6A 3BJUA 4RQEA 1GGMA 2CJAA 3TEGA 3W3SA 4XTUA 3HTZA 3I7FA 2RHSB 2ODRC 4ZIBA 3VQYA 1X54A 1NJ1A 3RKXA 2QHUA 5C51B 1B7YA 2ZXFA 2NS6A 1X01A 2DZCA 1Z7MA 5KNNA 3RUXA 1X55A 2ZIMA 2EAYA 2Q7HA 1JJCB 4YRMA 4HVCA 2Q7GA 3RIRA 2DQ3A 3HXYA 1WYDA 1H4VB 1NJ5A 4YRNA 4XEMA 1BBUA 4HT4A 4LVMA 4YDQA 4YP0A 1WPYA 4LVIA 3MF1A 2ZZEA 1YGBA 2RHQA 3V7RA 4RQFA 5C52B 1L0WA 4P72C 3R07A 4TVAB 1WQ7A 3HFVA 4KR2A 4XU1A 4HWOA 3PZCA 4KQEA 3HFZA 1ASZA 5ELNA 4XTVA 2DEQA 2PMEA 1ADJA 1RIQA 4XU0A 5HGQA 1C0AA 2ALYB 4P72A 4WI1A 3TEHA 4X5OA 4KR3A 4P71C 4YRSA 3V8KA 4P75C 3MEYA 2E64A 1YFSA 4ZTUB 4OP0A 4AH6A 3IG2A 3M4PA 1BBWA 4E51A 3NENA 2G4CA 1J5WA 4H2XB 3E9IA 3M4QA 3L4GA 4H2UA 1QE0A 4XTWA 3V8LA 4TTVA 4H2YA 4UP9A 3ICAA 4XTXA 5E3IA 2P5IA 3V8JA 4XTYA 3QO7A 3REUA 3LSSA 3HXZA 4CH3A 1WNLA 2I4OA 1FYFA 4YRRA 3HXWA 1KMMA 3P8VA 3HFZB 2RHQB 2ZNIA 2CJ9A 4YCVA 4P3PA 3A5YA 4YYEA 1B70B 4Q6GA 3QNEA 4P75A 4P74A 3L4GB 2ZIOA 2ZZFA 2DXUA 2ARTA 3HXXA 3IKMB 1IL2A 3VQWA 4YRJA 4RDXA 3VQXA 5K1XA 3KFUA 2AMCA 4YRQA 2DU7A 4K86A 2AMCB 2ZNJA 2XTIA 4CS3A 4H2TA 4YRFA 3RKYA 1X2HA 4P74C 3UFGA 2ARUA 3P8YA 2ALYA 1KOGA 3G1ZA 5ELOA 3OD1A 2DQ0A 2FYKA 3NELA 1G51A 2Q5HA 3FJPA 1BIAA 4P3OA 2AKWA 4H2XA 4YRIA 4HWSA 3A74A 2ZT5A 1SERA 2J3LA 1W66A 2EJ9A 4YRPA 2ZZGA 4HWTA 4J15A 4NCXA 1PYSA 3MQZA 1NJ2A 1ADYA 3HXVA 3BFMA 3QTCA 1B70A 4UP8A 4RMFA 2C8MA 4HWRA 3DSQA 1USYC 1WU7A 1Z7NA 3P8TA 3UGQA 12ASA 4YCWA 4P73A 3PCOA 3UGTA 3IKLA 2I4MA 4P3NA 1HXDA 4UP7A 3CMQA 3QO5A 2ODRD 1B8AA 4HWPA 3TEHB 2DVEA 3HRIA 2DDZA 3RACA 3VBBA 2ARSA 2DZ9A 1EVKA 2E10A 4K87A 3REXA 3RF1A 1SETA 3QO8A 2I4NA 2E3CA 2EJFA 2ZGWA 1ATIA 2DTOA 1E22A 5C53B 1KMNA 4TQDA 4G85A 2RHSA 1E24A 4ZTZB 3RGLA 3E9HA 4LNSA 4TVAA 1G5IA 4OLFA 2DXTA 4BWAA 1NJ6A 2AKWB 2ZT7A 1B7YB 2ZT8A 3NETA 4H02A 1HC7A 2QHSA 1H4SA 2ZR3A 5F5WA 1BIBA 2CGHA 4YPFA 3LSQA 4DPGA 5K1PA 1SRYA 2P0LA 3NEMA 1LYLA 4K88A 3EFSA 1WQWA 1H4TA 2J3MA 4TQFA 4EX5A 4LVJA 1PYSB 1JJCA 4XTZA 2IY5B 4LVLA 3VQVA 1NYQA 4CH6A 2HNIA 1X56A 4YRCA 4CS2A 2DU5A 4YRGA 4WJ3M 1USYA 4PHCA 4P71A 1QF6A
chains in the Genus database with same CATH topology
2Q5IA 3A7UA 4G84A 4YREA 2ZR2A 2EJGA 1EVLA 1N9WA 4WJ4A 2XGTA 4O2DA 4XEOA 2DTIA 2E65A 1YFTA 2C7IA 3L2ZA 4L87A 3V7CA 1EOVA 3A31A 4DQ2A 2ZCEA 2DJZA 2DKGA 4XU2A 2IY5A 11ASA 1EFWA 3A7AA 3HRKA 1EIYA 4XU3A 3RKWA 2QHTA 3A5ZA 1EIYB 1E1TA 1EQRA 1X2GA 2E1HA 2E41A 2EL9A 3L1AA 3WQZA 4H2SA 3UH0A 2CJBA 3EFRA 4HA8A 4EO4A 3HY1A 4CH4A 1H4QA 3TUPA 2QHVA 4YROA 3RL6A 3ERRA 2PMFA 4CS4A 1NJ8A 4YRKA 1NNHA 2I4LA 4UPAA 1G5HA 1YB3A 4Q15A 4TWAA 1HTTA 4WF2A 1ASYA 3PCOB 2ZTGA 3A7RA 2CIMA 2A8EA 4BW9A 4YCUA 2Q7EA 4TVYA 2ZINA 1VQZA 1YFRA 3HXUA 2E5AA 1SESA 4P73C 1E1OA 4LVKA 4YRLA 1WLEA 4H2WA 3V7SA 4H2VA 2EWNA 3MF2A 4TVWA 1NYRA 3A32A 4PG3A 2DTHA 4YRTA 3IALA 4CH5A 3HY0A 3LC0A 1B76A 2ZT6A 3BJUA 4RQEA 1GGMA 2CJAA 3TEGA 3W3SA 4XTUA 3HTZA 3I7FA 2RHSB 2ODRC 4ZIBA 3VQYA 1X54A 1NJ1A 3RKXA 2QHUA 5C51B 1B7YA 2ZXFA 2NS6A 1X01A 2DZCA 1Z7MA 5KNNA 3RUXA 1X55A 2ZIMA 2EAYA 2Q7HA 1JJCB 4YRMA 4HVCA 2Q7GA 3RIRA 2DQ3A 3HXYA 1WYDA 1H4VB 1NJ5A 4YRNA 4XEMA 1BBUA 4HT4A 4LVMA 4YDQA 4YP0A 1WPYA 4LVIA 3MF1A 2ZZEA 1YGBA 2RHQA 3V7RA 4RQFA 5C52B 1L0WA 4P72C 3R07A 4TVAB 1WQ7A 3HFVA 4KR2A 4XU1A 4HWOA 3PZCA 4KQEA 3HFZA 1ASZA 5ELNA 4XTVA 2DEQA 2PMEA 1ADJA 1RIQA 4XU0A 5HGQA 1C0AA 2ALYB 4P72A 4WI1A 3TEHA 4X5OA 4KR3A 4P71C 4YRSA 3V8KA 4P75C 3MEYA 2E64A 1YFSA 4ZTUB 4OP0A 4AH6A 3IG2A 3M4PA 1BBWA 4E51A 3NENA 2G4CA 1J5WA 4H2XB 3E9IA 3M4QA 3L4GA 4H2UA 1QE0A 4XTWA 3V8LA 4TTVA 4H2YA 4UP9A 3ICAA 4XTXA 5E3IA 2P5IA 3V8JA 4XTYA 3QO7A 3REUA 3LSSA 3HXZA 4CH3A 1WNLA 2I4OA 1FYFA 4YRRA 3HXWA 1KMMA 3P8VA 3HFZB 2RHQB 2ZNIA 2CJ9A 4YCVA 4P3PA 3A5YA 4YYEA 1B70B 4Q6GA 3QNEA 4P75A 4P74A 3L4GB 2ZIOA 2ZZFA 2DXUA 2ARTA 3HXXA 3IKMB 1IL2A 3VQWA 4YRJA 4RDXA 3VQXA 5K1XA 3KFUA 2AMCA 4YRQA 2DU7A 4K86A 2AMCB 2ZNJA 2XTIA 4CS3A 4H2TA 4YRFA 3RKYA 1X2HA 4P74C 3UFGA 2ARUA 3P8YA 2ALYA 1KOGA 3G1ZA 5ELOA 3OD1A 2DQ0A 2FYKA 3NELA 1G51A 2Q5HA 3FJPA 1BIAA 4P3OA 2AKWA 4H2XA 4YRIA 4HWSA 3A74A 2ZT5A 1SERA 2J3LA 1W66A 2EJ9A 4YRPA 2ZZGA 4HWTA 4J15A 4NCXA 1PYSA 3MQZA 1NJ2A 1ADYA 3HXVA 3BFMA 3QTCA 1B70A 4UP8A 4RMFA 2C8MA 4HWRA 3DSQA 1USYC 1WU7A 1Z7NA 3P8TA 3UGQA 12ASA 4YCWA 4P73A 3PCOA 3UGTA 3IKLA 2I4MA 4P3NA 1HXDA 4UP7A 3CMQA 3QO5A 2ODRD 1B8AA 4HWPA 3TEHB 2DVEA 3HRIA 2DDZA 3RACA 3VBBA 2ARSA 2DZ9A 1EVKA 2E10A 4K87A 3REXA 3RF1A 1SETA 3QO8A 2I4NA 2E3CA 2EJFA 2ZGWA 1ATIA 2DTOA 1E22A 5C53B 1KMNA 4TQDA 4G85A 2RHSA 1E24A 4ZTZB 3RGLA 3E9HA 4LNSA 4TVAA 1G5IA 4OLFA 2DXTA 4BWAA 1NJ6A 2AKWB 2ZT7A 1B7YB 2ZT8A 3NETA 4H02A 1HC7A 2QHSA 1H4SA 2ZR3A 5F5WA 1BIBA 2CGHA 4YPFA 3LSQA 4DPGA 5K1PA 1SRYA 2P0LA 3NEMA 1LYLA 4K88A 3EFSA 1WQWA 1H4TA 2J3MA 4TQFA 4EX5A 4LVJA 1PYSB 1JJCA 4XTZA 2IY5B 4LVLA 3VQVA 1NYQA 4CH6A 2HNIA 1X56A 4YRCA 4CS2A 2DU5A 4YRGA 4WJ3M 1USYA 4PHCA 4P71A 1QF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5I A;  3A7U A;  4G84 A;  4YRE A;  2ZR2 A;  2EJG A;  1EVL A;  1N9W A;  4WJ4 A;  2XGT A;  4O2D A;  4XEO A;  2DTI A;  2E65 A;  1YFT A;  2C7I A;  3L2Z A;  4L87 A;  3V7C A;  1EOV A;  3A31 A;  4DQ2 A;  2ZCE A;  2DJZ A;  2DKG A;  4XU2 A;  2IY5 A;  11AS A;  1EFW A;  3A7A A;  3HRK A;  1EIY A;  4XU3 A;  3RKW A;  2QHT A;  3A5Z A;  1EIY B;  1E1T A;  1EQR A;  1X2G A;  2E1H A;  2E41 A;  2EL9 A;  3L1A A;  3WQZ A;  4H2S A;  3UH0 A;  2CJB A;  3EFR A;  4HA8 A;  4EO4 A;  3HY1 A;  4CH4 A;  1H4Q A;  3TUP A;  2QHV A;  4YRO A;  3RL6 A;  3ERR A;  2PMF A;  4CS4 A;  1NJ8 A;  4YRK A;  1NNH A;  2I4L A;  4UPA A;  1G5H A;  1YB3 A;  4Q15 A;  4TWA A;  1HTT A;  4WF2 A;  1ASY A;  3PCO B;  2ZTG A;  3A7R A;  2CIM A;  4BW9 A;  4YCU A;  2Q7E A;  4TVY A;  2ZIN A;  1VQZ A;  1YFR A;  3HXU A;  2E5A A;  1SES A;  4P73 C;  1E1O A;  4YRL A;  1WLE A;  4H2W A;  3V7S A;  4H2V A;  2EWN A;  3MF2 A;  4TVW A;  1NYR A;  3A32 A;  4PG3 A;  2DTH A;  4YRT A;  3IAL A;  4CH5 A;  3HY0 A;  3LC0 A;  1B76 A;  2ZT6 A;  3BJU A;  4RQE A;  1GGM A;  2CJA A;  3TEG A;  3W3S A;  4XTU A;  3HTZ A;  3I7F A;  2RHS B;  2ODR C;  4ZIB A;  3VQY A;  1X54 A;  1NJ1 A;  3RKX A;  2QHU A;  5C51 B;  1B7Y A;  2ZXF A;  1X01 A;  2DZC A;  1Z7M A;  5KNN A;  3RUX A;  1X55 A;  2ZIM A;  2EAY A;  2Q7H A;  1JJC B;  4YRM A;  4HVC A;  2Q7G A;  3RIR A;  2DQ3 A;  3HXY A;  1WYD A;  1H4V B;  1NJ5 A;  4YRN A;  4XEM A;  1BBU A;  4YDQ A;  4YP0 A;  1WPY A;  3MF1 A;  2ZZE A;  1YGB A;  2RHQ A;  3V7R A;  4RQF A;  5C52 B;  1L0W A;  4P72 C;  3R07 A;  4TVA B;  1WQ7 A;  3HFV A;  4KR2 A;  4XU1 A;  4HWO A;  3PZC A;  4KQE A;  3HFZ A;  1ASZ A;  5ELN A;  4XTV A;  2DEQ A;  2PME A;  1ADJ A;  1RIQ A;  4XU0 A;  5HGQ A;  1C0A A;  2ALY B;  4P72 A;  4WI1 A;  3TEH A;  4X5O A;  4KR3 A;  4P71 C;  4YRS A;  3V8K A;  4P75 C;  3MEY A;  2E64 A;  1YFS A;  4ZTU B;  4OP0 A;  4AH6 A;  3IG2 A;  3M4P A;  1BBW A;  4E51 A;  3NEN A;  2G4C A;  1J5W A;  4H2X B;  3E9I A;  3M4Q A;  3L4G A;  4H2U A;  1QE0 A;  4XTW A;  3V8L A;  4TTV A;  4H2Y A;  4UP9 A;  3ICA A;  4XTX A;  5E3I A;  2P5I A;  3V8J A;  4XTY A;  3QO7 A;  3REU A;  3LSS A;  3HXZ A;  4CH3 A;  1WNL A;  2I4O A;  1FYF A;  4YRR A;  3HXW A;  1KMM A;  3P8V A;  3HFZ B;  2RHQ B;  2ZNI A;  2CJ9 A;  4YCV A;  4P3P A;  3A5Y A;  4YYE A;  1B70 B;  4Q6G A;  3QNE A;  4P75 A;  4P74 A;  3L4G B;  2ZIO A;  2ZZF A;  2DXU A;  2ART A;  3HXX A;  3IKM B;  1IL2 A;  3VQW A;  4YRJ A;  4RDX A;  3VQX A;  5K1X A;  3KFU A;  2AMC A;  4YRQ A;  2DU7 A;  4K86 A;  2AMC B;  2ZNJ A;  2XTI A;  4CS3 A;  4H2T A;  4YRF A;  3RKY A;  1X2H A;  4P74 C;  3UFG A;  2ARU A;  3P8Y A;  2ALY A;  1KOG A;  3G1Z A;  5ELO A;  3OD1 A;  2DQ0 A;  2FYK A;  3NEL A;  1G51 A;  2Q5H A;  3FJP A;  1BIA A;  4P3O A;  2AKW A;  4H2X A;  4YRI A;  4HWS A;  3A74 A;  2ZT5 A;  1SER A;  2J3L A;  1W66 A;  2EJ9 A;  4YRP A;  2ZZG A;  4HWT A;  4J15 A;  4NCX A;  1PYS A;  1NJ2 A;  1ADY A;  3HXV A;  3BFM A;  3QTC A;  1B70 A;  4UP8 A;  4RMF A;  2C8M A;  4HWR A;  3DSQ A;  1USY C;  1WU7 A;  1Z7N A;  3P8T A;  3UGQ A;  12AS A;  4YCW A;  4P73 A;  3PCO A;  3UGT A;  3IKL A;  2I4M A;  4P3N A;  1HXD A;  4UP7 A;  3CMQ A;  3QO5 A;  2ODR D;  1B8A A;  4HWP A;  3TEH B;  2DVE A;  3HRI A;  2DDZ A;  3RAC A;  3VBB A;  2ARS A;  2DZ9 A;  1EVK A;  2E10 A;  4K87 A;  3REX A;  3RF1 A;  1SET A;  3QO8 A;  2I4N A;  2E3C A;  2EJF A;  2ZGW A;  1ATI A;  2DTO A;  1E22 A;  5C53 B;  1KMN A;  4TQD A;  4G85 A;  2RHS A;  1E24 A;  4ZTZ B;  3RGL A;  3E9H A;  4LNS A;  4TVA A;  1G5I A;  4OLF A;  2DXT A;  4BWA A;  1NJ6 A;  2AKW B;  2ZT7 A;  1B7Y B;  2ZT8 A;  3NET A;  4H02 A;  1HC7 A;  2QHS A;  1H4S A;  2ZR3 A;  5F5W A;  1BIB A;  2CGH A;  4YPF A;  3LSQ A;  4DPG A;  5K1P A;  1SRY A;  2P0L A;  3NEM A;  1LYL A;  4K88 A;  3EFS A;  1WQW A;  1H4T A;  2J3M A;  4TQF A;  4EX5 A;  1PYS B;  1JJC A;  4XTZ A;  2IY5 B;  3VQV A;  1NYQ A;  4CH6 A;  2HNI A;  1X56 A;  4YRC A;  4CS2 A;  2DU5 A;  4YRG A;  4WJ3 M;  1USY A;  4PHC A;  4P71 A;  1QF6 A; 
#chains in the Genus database with same CATH topology
 2Q5I A;  3A7U A;  4G84 A;  4YRE A;  2ZR2 A;  2EJG A;  1EVL A;  1N9W A;  4WJ4 A;  2XGT A;  4O2D A;  4XEO A;  2DTI A;  2E65 A;  1YFT A;  2C7I A;  3L2Z A;  4L87 A;  3V7C A;  1EOV A;  3A31 A;  4DQ2 A;  2ZCE A;  2DJZ A;  2DKG A;  4XU2 A;  2IY5 A;  11AS A;  1EFW A;  3A7A A;  3HRK A;  1EIY A;  4XU3 A;  3RKW A;  2QHT A;  3A5Z A;  1EIY B;  1E1T A;  1EQR A;  1X2G A;  2E1H A;  2E41 A;  2EL9 A;  3L1A A;  3WQZ A;  4H2S A;  3UH0 A;  2CJB A;  3EFR A;  4HA8 A;  4EO4 A;  3HY1 A;  4CH4 A;  1H4Q A;  3TUP A;  2QHV A;  4YRO A;  3RL6 A;  3ERR A;  2PMF A;  4CS4 A;  1NJ8 A;  4YRK A;  1NNH A;  2I4L A;  4UPA A;  1G5H A;  1YB3 A;  4Q15 A;  4TWA A;  1HTT A;  4WF2 A;  1ASY A;  3PCO B;  2ZTG A;  3A7R A;  2CIM A;  2A8E A;  4BW9 A;  4YCU A;  2Q7E A;  4TVY A;  2ZIN A;  1VQZ A;  1YFR A;  3HXU A;  2E5A A;  1SES A;  4P73 C;  1E1O A;  4LVK A;  4YRL A;  1WLE A;  4H2W A;  3V7S A;  4H2V A;  2EWN A;  3MF2 A;  4TVW A;  1NYR A;  3A32 A;  4PG3 A;  2DTH A;  4YRT A;  3IAL A;  4CH5 A;  3HY0 A;  3LC0 A;  1B76 A;  2ZT6 A;  3BJU A;  4RQE A;  1GGM A;  2CJA A;  3TEG A;  3W3S A;  4XTU A;  3HTZ A;  3I7F A;  2RHS B;  2ODR C;  4ZIB A;  3VQY A;  1X54 A;  1NJ1 A;  3RKX A;  2QHU A;  5C51 B;  1B7Y A;  2ZXF A;  2NS6 A;  1X01 A;  2DZC A;  1Z7M A;  5KNN A;  3RUX A;  1X55 A;  2ZIM A;  2EAY A;  2Q7H A;  1JJC B;  4YRM A;  4HVC A;  2Q7G A;  3RIR A;  2DQ3 A;  3HXY A;  1WYD A;  1H4V B;  1NJ5 A;  4YRN A;  4XEM A;  1BBU A;  4HT4 A;  4LVM A;  4YDQ A;  4YP0 A;  1WPY A;  4LVI A;  3MF1 A;  2ZZE A;  1YGB A;  2RHQ A;  3V7R A;  4RQF A;  5C52 B;  1L0W A;  4P72 C;  3R07 A;  4TVA B;  1WQ7 A;  3HFV A;  4KR2 A;  4XU1 A;  4HWO A;  3PZC A;  4KQE A;  3HFZ A;  1ASZ A;  5ELN A;  4XTV A;  2DEQ A;  2PME A;  1ADJ A;  1RIQ A;  4XU0 A;  5HGQ A;  1C0A A;  2ALY B;  4P72 A;  4WI1 A;  3TEH A;  4X5O A;  4KR3 A;  4P71 C;  4YRS A;  3V8K A;  4P75 C;  3MEY A;  2E64 A;  1YFS A;  4ZTU B;  4OP0 A;  4AH6 A;  3IG2 A;  3M4P A;  1BBW A;  4E51 A;  3NEN A;  2G4C A;  1J5W A;  4H2X B;  3E9I A;  3M4Q A;  3L4G A;  4H2U A;  1QE0 A;  4XTW A;  3V8L A;  4TTV A;  4H2Y A;  4UP9 A;  3ICA A;  4XTX A;  5E3I A;  2P5I A;  3V8J A;  4XTY A;  3QO7 A;  3REU A;  3LSS A;  3HXZ A;  4CH3 A;  1WNL A;  2I4O A;  1FYF A;  4YRR A;  3HXW A;  1KMM A;  3P8V A;  3HFZ B;  2RHQ B;  2ZNI A;  2CJ9 A;  4YCV A;  4P3P A;  3A5Y A;  4YYE A;  1B70 B;  4Q6G A;  3QNE A;  4P75 A;  4P74 A;  3L4G B;  2ZIO A;  2ZZF A;  2DXU A;  2ART A;  3HXX A;  3IKM B;  1IL2 A;  3VQW A;  4YRJ A;  4RDX A;  3VQX A;  5K1X A;  3KFU A;  2AMC A;  4YRQ A;  2DU7 A;  4K86 A;  2AMC B;  2ZNJ A;  2XTI A;  4CS3 A;  4H2T A;  4YRF A;  3RKY A;  1X2H A;  4P74 C;  3UFG A;  2ARU A;  3P8Y A;  2ALY A;  1KOG A;  3G1Z A;  5ELO A;  3OD1 A;  2DQ0 A;  2FYK A;  3NEL A;  1G51 A;  2Q5H A;  3FJP A;  1BIA A;  4P3O A;  2AKW A;  4H2X A;  4YRI A;  4HWS A;  3A74 A;  2ZT5 A;  1SER A;  2J3L A;  1W66 A;  2EJ9 A;  4YRP A;  2ZZG A;  4HWT A;  4J15 A;  4NCX A;  1PYS A;  3MQZ A;  1NJ2 A;  1ADY A;  3HXV A;  3BFM A;  3QTC A;  1B70 A;  4UP8 A;  4RMF A;  2C8M A;  4HWR A;  3DSQ A;  1USY C;  1WU7 A;  1Z7N A;  3P8T A;  3UGQ A;  12AS A;  4YCW A;  4P73 A;  3PCO A;  3UGT A;  3IKL A;  2I4M A;  4P3N A;  1HXD A;  4UP7 A;  3CMQ A;  3QO5 A;  2ODR D;  1B8A A;  4HWP A;  3TEH B;  2DVE A;  3HRI A;  2DDZ A;  3RAC A;  3VBB A;  2ARS A;  2DZ9 A;  1EVK A;  2E10 A;  4K87 A;  3REX A;  3RF1 A;  1SET A;  3QO8 A;  2I4N A;  2E3C A;  2EJF A;  2ZGW A;  1ATI A;  2DTO A;  1E22 A;  5C53 B;  1KMN A;  4TQD A;  4G85 A;  2RHS A;  1E24 A;  4ZTZ B;  3RGL A;  3E9H A;  4LNS A;  4TVA A;  1G5I A;  4OLF A;  2DXT A;  4BWA A;  1NJ6 A;  2AKW B;  2ZT7 A;  1B7Y B;  2ZT8 A;  3NET A;  4H02 A;  1HC7 A;  2QHS A;  1H4S A;  2ZR3 A;  5F5W A;  1BIB A;  2CGH A;  4YPF A;  3LSQ A;  4DPG A;  5K1P A;  1SRY A;  2P0L A;  3NEM A;  1LYL A;  4K88 A;  3EFS A;  1WQW A;  1H4T A;  2J3M A;  4TQF A;  4EX5 A;  4LVJ A;  1PYS B;  1JJC A;  4XTZ A;  2IY5 B;  4LVL A;  3VQV A;  1NYQ A;  4CH6 A;  2HNI A;  1X56 A;  4YRC A;  4CS2 A;  2DU5 A;  4YRG A;  4WJ3 M;  1USY A;  4PHC A;  4P71 A;  1QF6 A; 
#chains in the Genus database with same CATH homology
 2Q5I A;  3A7U A;  4G84 A;  4YRE A;  2ZR2 A;  2EJG A;  1EVL A;  1N9W A;  4WJ4 A;  2XGT A;  4O2D A;  4XEO A;  2DTI A;  2E65 A;  1YFT A;  2C7I A;  3L2Z A;  4L87 A;  3V7C A;  1EOV A;  3A31 A;  4DQ2 A;  2ZCE A;  2DJZ A;  2DKG A;  4XU2 A;  2IY5 A;  11AS A;  1EFW A;  3A7A A;  3HRK A;  1EIY A;  4XU3 A;  3RKW A;  2QHT A;  3A5Z A;  1EIY B;  1E1T A;  1EQR A;  1X2G A;  2E1H A;  2E41 A;  2EL9 A;  3L1A A;  3WQZ A;  4H2S A;  3UH0 A;  2CJB A;  3EFR A;  4HA8 A;  4EO4 A;  3HY1 A;  4CH4 A;  1H4Q A;  3TUP A;  2QHV A;  4YRO A;  3RL6 A;  3ERR A;  2PMF A;  4CS4 A;  1NJ8 A;  4YRK A;  1NNH A;  2I4L A;  4UPA A;  1G5H A;  1YB3 A;  4Q15 A;  4TWA A;  1HTT A;  4WF2 A;  1ASY A;  3PCO B;  2ZTG A;  3A7R A;  2CIM A;  2A8E A;  4BW9 A;  4YCU A;  2Q7E A;  4TVY A;  2ZIN A;  1VQZ A;  1YFR A;  3HXU A;  2E5A A;  1SES A;  4P73 C;  1E1O A;  4LVK A;  4YRL A;  1WLE A;  4H2W A;  3V7S A;  4H2V A;  2EWN A;  3MF2 A;  4TVW A;  1NYR A;  3A32 A;  4PG3 A;  2DTH A;  4YRT A;  3IAL A;  4CH5 A;  3HY0 A;  3LC0 A;  1B76 A;  2ZT6 A;  3BJU A;  4RQE A;  1GGM A;  2CJA A;  3TEG A;  3W3S A;  4XTU A;  3HTZ A;  3I7F A;  2RHS B;  2ODR C;  4ZIB A;  3VQY A;  1X54 A;  1NJ1 A;  3RKX A;  2QHU A;  5C51 B;  1B7Y A;  2ZXF A;  2NS6 A;  1X01 A;  2DZC A;  1Z7M A;  5KNN A;  3RUX A;  1X55 A;  2ZIM A;  2EAY A;  2Q7H A;  1JJC B;  4YRM A;  4HVC A;  2Q7G A;  3RIR A;  2DQ3 A;  3HXY A;  1WYD A;  1H4V B;  1NJ5 A;  4YRN A;  4XEM A;  1BBU A;  4HT4 A;  4LVM A;  4YDQ A;  4YP0 A;  1WPY A;  4LVI A;  3MF1 A;  2ZZE A;  1YGB A;  2RHQ A;  3V7R A;  4RQF A;  5C52 B;  1L0W A;  4P72 C;  3R07 A;  4TVA B;  1WQ7 A;  3HFV A;  4KR2 A;  4XU1 A;  4HWO A;  3PZC A;  4KQE A;  3HFZ A;  1ASZ A;  5ELN A;  4XTV A;  2DEQ A;  2PME A;  1ADJ A;  1RIQ A;  4XU0 A;  5HGQ A;  1C0A A;  2ALY B;  4P72 A;  4WI1 A;  3TEH A;  4X5O A;  4KR3 A;  4P71 C;  4YRS A;  3V8K A;  4P75 C;  3MEY A;  2E64 A;  1YFS A;  4ZTU B;  4OP0 A;  4AH6 A;  3IG2 A;  3M4P A;  1BBW A;  4E51 A;  3NEN A;  2G4C A;  1J5W A;  4H2X B;  3E9I A;  3M4Q A;  3L4G A;  4H2U A;  1QE0 A;  4XTW A;  3V8L A;  4TTV A;  4H2Y A;  4UP9 A;  3ICA A;  4XTX A;  5E3I A;  2P5I A;  3V8J A;  4XTY A;  3QO7 A;  3REU A;  3LSS A;  3HXZ A;  4CH3 A;  1WNL A;  2I4O A;  1FYF A;  4YRR A;  3HXW A;  1KMM A;  3P8V A;  3HFZ B;  2RHQ B;  2ZNI A;  2CJ9 A;  4YCV A;  4P3P A;  3A5Y A;  4YYE A;  1B70 B;  4Q6G A;  3QNE A;  4P75 A;  4P74 A;  3L4G B;  2ZIO A;  2ZZF A;  2DXU A;  2ART A;  3HXX A;  3IKM B;  1IL2 A;  3VQW A;  4YRJ A;  4RDX A;  3VQX A;  5K1X A;  3KFU A;  2AMC A;  4YRQ A;  2DU7 A;  4K86 A;  2AMC B;  2ZNJ A;  2XTI A;  4CS3 A;  4H2T A;  4YRF A;  3RKY A;  1X2H A;  4P74 C;  3UFG A;  2ARU A;  3P8Y A;  2ALY A;  1KOG A;  3G1Z A;  5ELO A;  3OD1 A;  2DQ0 A;  2FYK A;  3NEL A;  1G51 A;  2Q5H A;  3FJP A;  1BIA A;  4P3O A;  2AKW A;  4H2X A;  4YRI A;  4HWS A;  3A74 A;  2ZT5 A;  1SER A;  2J3L A;  1W66 A;  2EJ9 A;  4YRP A;  2ZZG A;  4HWT A;  4J15 A;  4NCX A;  1PYS A;  3MQZ A;  1NJ2 A;  1ADY A;  3HXV A;  3BFM A;  3QTC A;  1B70 A;  4UP8 A;  4RMF A;  2C8M A;  4HWR A;  3DSQ A;  1USY C;  1WU7 A;  1Z7N A;  3P8T A;  3UGQ A;  12AS A;  4YCW A;  4P73 A;  3PCO A;  3UGT A;  3IKL A;  2I4M A;  4P3N A;  1HXD A;  4UP7 A;  3CMQ A;  3QO5 A;  2ODR D;  1B8A A;  4HWP A;  3TEH B;  2DVE A;  3HRI A;  2DDZ A;  3RAC A;  3VBB A;  2ARS A;  2DZ9 A;  1EVK A;  2E10 A;  4K87 A;  3REX A;  3RF1 A;  1SET A;  3QO8 A;  2I4N A;  2E3C A;  2EJF A;  2ZGW A;  1ATI A;  2DTO A;  1E22 A;  5C53 B;  1KMN A;  4TQD A;  4G85 A;  2RHS A;  1E24 A;  4ZTZ B;  3RGL A;  3E9H A;  4LNS A;  4TVA A;  1G5I A;  4OLF A;  2DXT A;  4BWA A;  1NJ6 A;  2AKW B;  2ZT7 A;  1B7Y B;  2ZT8 A;  3NET A;  4H02 A;  1HC7 A;  2QHS A;  1H4S A;  2ZR3 A;  5F5W A;  1BIB A;  2CGH A;  4YPF A;  3LSQ A;  4DPG A;  5K1P A;  1SRY A;  2P0L A;  3NEM A;  1LYL A;  4K88 A;  3EFS A;  1WQW A;  1H4T A;  2J3M A;  4TQF A;  4EX5 A;  4LVJ A;  1PYS B;  1JJC A;  4XTZ A;  2IY5 B;  4LVL A;  3VQV A;  1NYQ A;  4CH6 A;  2HNI A;  1X56 A;  4YRC A;  4CS2 A;  2DU5 A;  4YRG A;  4WJ3 M;  1USY A;  4PHC A;  4P71 A;  1QF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...