2DDZA

Protein of unknown function from pyrococcus horikoshi
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
SMELLIIKERRIDYDGSAIRSHWAYRNFGILGDSLVVFRGKCNVKVEEMVDIEDLRLRKEIKGDDMVHYILELFWHPDILLASSLQKLLIARLVELLWNYGIEASRRGDDIYVNGRKLSISIATVSPVSIKIHIGLNVKTVGVPPGVDAIGLEELGIDPTEFMERSAKALVEEIEKVRKDSLKVRWVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Unknown Protein from Pyrococcus horikoshi
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords 190aa long hypothetical protein
total genus 61
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04017 DUF366 Domain of unknown function (DUF366)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ddzA00
4P73C 1G5IA 1NJ6A 3V8JA 4CH3A 1JJCB 3V8LA 2DZCA 2ZR2A 2CJBA 3HFVA 4XU2A 1ASZA 2ALYB 3UGQA 2Q7HA 3REUA 1EIYA 4RQEA 1ADYA 3HXYA 5K1PA 1YFTA 3L4GB 4YRJA 4E51A 5ELNA 1BBUA 4YCUA 2DDZA 2RHSA 1NJ8A 4CS3A 4P75C 2QHTA 4H02A 4HVCA 3RF1A 2CJAA 1HXDA 1YFRA 4CS2A 4YRRA 3M4QA 4YRFA 2IY5B 1B70B 4YRMA 2Q5HA 12ASA 4WF2A 4P75A 2ZCEA 3NETA 4YDQA 3DSQA 3BJUA 2DVEA 1ATIA 1USYC 2DU7A 3IKMB 4P3OA 5E3IA 3ERRA 4KR2A 1EOVA 3M4PA 3G1ZA 3TEHA 1ASYA 4P71C 1Z7NA 2ALYA 1NJ5A 2ZT8A 3MF1A 2EJ9A 3RACA 4RQFA 5ELOA 3HXZA 3MEYA 2HNIA 4TVAB 3VBBA 2J3MA 2ZTGA 2E64A 4PHCA 2I4MA 4HWTA 2EWNA 3VQVA 2ZIMA 2ZT7A 3UGTA 3HTZA 3IALA 2ZZEA 4XU0A 4P74C 1FYFA 1RIQA 1LYLA 4TQFA 3FJPA 1HTTA 3L4GA 2DTOA 2CJ9A 4DQ2A 2AMCB 4G84A 4HA8A 4XEMA 4O2DA 3V7CA 2DXUA 1USYA 1NJ1A 2Q5IA 3HXUA 1PYSB 2DQ0A 1B76A 4TWAA 1EFWA 3TUPA 3EFSA 4KQEA 4WI1A 4XEOA 3A7RA 3HY1A 3A7AA 4XTUA 4YYEA 3HFZA 2E1HA 4UP8A 4ZTUB 2ARSA 2ZNIA 1B7YB 1YGBA 2ODRC 4XTYA 3A5ZA 4YRLA 3I7FA 2AKWB 4EX5A 1KMNA 3E9HA 4YRCA 2ZT6A 1H4TA 2CIMA 4YRPA 1H4SA 4XU1A 4H2TA 4YRTA 4ZTZB 2E5AA 5K1XA 3RKXA 4XTVA 1EVKA 3L2ZA 3NEMA 3UH0A 4UP7A 3HXWA 1H4QA 1EIYB 4H2XA 1KMMA 2J3LA 2DZ9A 2I4NA 4H2YA 4AH6A 3QO5A 3V7SA 2RHQA 4YP0A 4RDXA 3CMQA 3PCOB 3W3SA 4HWOA 4XTXA 4YCVA 3PZCA 2P5IA 1HC7A 3A31A 4RMFA 1BBWA 4P3NA 5F5WA 4G85A 3BFMA 3LSQA 5KNNA 1X55A 2E41A 4CH5A 4YROA 2QHVA 1WLEA 1B70A 4OLFA 1BIBA 3HY0A 3R07A 2E65A 2E10A 2RHQB 4H2SA 3RIRA 2C7IA 5C52B 1WQWA 1YFSA 2QHSA 3PCOA 1E1OA 4P74A 3A7UA 2ZZFA 1C0AA 1YB3A 2EJFA 4HWPA 3P8YA 2ZR3A 4CS4A 1NYQA 2DU5A 3TEGA 3LSSA 4WJ3M 4P72C 4WJ4A 1H4VB 1JJCA 1N9WA 3IKLA 4YCWA 2G4CA 2EJGA 3MF2A 4LNSA 3VQXA 3QNEA 3L1AA 1VQZA 4P72A 4H2VA 4TVWA 2DQ3A 1G51A 3HXXA 4P3PA 4J15A 1X54A 2E3CA 1PYSA 1SRYA 3V8KA 2DTHA 1EQRA 4YRQA 3NELA 1G5HA 5HGQA 4L87A 4XTWA 3V7RA 3RUXA 4K86A 4XU3A 4PG3A 1NYRA 2P0LA 4YRIA 3HRIA 3P8TA 4TQDA 1GGMA 2DXTA 4DPGA 4P73A 4YRNA 3VQWA 2EAYA 3EFRA 2CGHA 4HWSA 3E9IA 2ZZGA 3QO7A 1J5WA 2AKWA 1QF6A 3HRKA 3WQZA 3RKWA 3HXVA 1SETA 2I4LA 2PMEA 4UPAA 4X5OA 4KR3A 3RGLA 4TVAA 1E24A 4BW9A 1X2HA 4K87A 4EO4A 4YPFA 4CH4A 1Z7MA 3QTCA 4H2XB 4ZIBA 4YRGA 2DEQA 1NJ2A 4NCXA 3OD1A 4TTVA 4HWRA 2XTIA 1E22A 2DTIA 1WPYA 3A32A 4YRKA 1L0WA 3TEHB 1EVLA 2I4OA 4OP0A 4BWAA 2AMCA 2QHUA 1WNLA 1ADJA 3ICAA 4XTZA 4YREA 1WYDA 2Q7EA 2ARTA 1WQ7A 2ZINA 4K88A 1QE0A 2ARUA 2Q7GA 2FYKA 4H2WA 1IL2A 4P71A 4YRSA 2XGTA 3HFZB 3A74A 1W66A 2RHSB 1B8AA 2EL9A 3RKYA 1NNHA 1BIAA 4CH6A 2C8MA 2ZGWA 2ZIOA 5C53B 2DJZA 1SESA 1SERA 3A5YA 4H2UA 3RL6A 1X01A 5C51B 1KOGA 3P8VA 2PMFA 3IG2A 1X56A 3QO8A 1E1TA 2DKGA 2ZXFA 1B7YA 3NENA 1X2GA 2ZT5A 4Q15A 4TVYA 4Q6GA 3VQYA 2ODRD 4UP9A 3KFUA 3LC0A 2ZNJA 2IY5A 11ASA 3UFGA 3REXA 1WU7A
chains in the Genus database with same CATH superfamily
4P73C 1G5IA 1NJ6A 3V8JA 4CH3A 1JJCB 3V8LA 2DZCA 2ZR2A 2CJBA 3HFVA 4LVKA 4XU2A 1ASZA 2ALYB 3UGQA 2Q7HA 3REUA 1EIYA 4RQEA 1ADYA 3HXYA 5K1PA 1YFTA 3MQZA 3L4GB 4YRJA 4E51A 5ELNA 1BBUA 4YCUA 2DDZA 2RHSA 1NJ8A 4CS3A 4P75C 2QHTA 4H02A 4HVCA 3RF1A 2CJAA 1HXDA 1YFRA 4CS2A 4LVIA 4YRRA 3M4QA 4YRFA 2IY5B 1B70B 4YRMA 2Q5HA 12ASA 4WF2A 4P75A 2ZCEA 3NETA 4YDQA 3DSQA 3BJUA 2DVEA 4LVJA 1ATIA 1USYC 2DU7A 3IKMB 4P3OA 5E3IA 3ERRA 4KR2A 1EOVA 3M4PA 3G1ZA 3TEHA 1ASYA 4P71C 1Z7NA 2ALYA 1NJ5A 2ZT8A 3MF1A 2EJ9A 3RACA 4RQFA 5ELOA 3HXZA 3MEYA 2HNIA 4TVAB 3VBBA 2J3MA 2ZTGA 2E64A 4PHCA 2I4MA 4HWTA 2EWNA 3VQVA 2ZIMA 2ZT7A 3UGTA 3HTZA 3IALA 2ZZEA 4XU0A 4P74C 1FYFA 1RIQA 1LYLA 4TQFA 3FJPA 1HTTA 3L4GA 2DTOA 2CJ9A 4DQ2A 4LVMA 2AMCB 4G84A 4HA8A 4XEMA 4O2DA 3V7CA 2DXUA 1USYA 1NJ1A 2Q5IA 3HXUA 1PYSB 2DQ0A 1B76A 4TWAA 1EFWA 3TUPA 3EFSA 4KQEA 4WI1A 4XEOA 3A7RA 3HY1A 3A7AA 4XTUA 4YYEA 3HFZA 2E1HA 4UP8A 4ZTUB 2ARSA 2ZNIA 1B7YB 1YGBA 2ODRC 4XTYA 3A5ZA 4YRLA 3I7FA 2AKWB 4EX5A 1KMNA 3E9HA 4YRCA 2ZT6A 2A8EA 1H4TA 2CIMA 4YRPA 1H4SA 4XU1A 4H2TA 4YRTA 4ZTZB 2E5AA 5K1XA 3RKXA 4XTVA 1EVKA 3L2ZA 3NEMA 3UH0A 4UP7A 3HXWA 1H4QA 1EIYB 4H2XA 1KMMA 2J3LA 2DZ9A 2I4NA 4H2YA 4AH6A 3QO5A 3V7SA 2RHQA 4YP0A 4RDXA 3CMQA 3PCOB 3W3SA 4HWOA 4XTXA 4YCVA 3PZCA 2P5IA 1HC7A 3A31A 4RMFA 1BBWA 4P3NA 5F5WA 4G85A 3BFMA 3LSQA 5KNNA 1X55A 2E41A 4CH5A 4YROA 2QHVA 1WLEA 1B70A 4OLFA 1BIBA 3HY0A 3R07A 2E65A 2E10A 2RHQB 4H2SA 3RIRA 2C7IA 5C52B 1WQWA 1YFSA 2QHSA 3PCOA 1E1OA 4P74A 3A7UA 2ZZFA 1C0AA 1YB3A 2EJFA 4HWPA 3P8YA 2ZR3A 4CS4A 1NYQA 2DU5A 3TEGA 3LSSA 4WJ3M 4P72C 4WJ4A 1H4VB 1JJCA 1N9WA 3IKLA 4YCWA 2G4CA 2EJGA 3MF2A 4LNSA 3VQXA 3QNEA 3L1AA 1VQZA 4P72A 4H2VA 4TVWA 2DQ3A 1G51A 3HXXA 4P3PA 4J15A 1X54A 2E3CA 1PYSA 1SRYA 3V8KA 2DTHA 1EQRA 4YRQA 3NELA 1G5HA 5HGQA 4L87A 4XTWA 3V7RA 3RUXA 4K86A 4XU3A 4PG3A 1NYRA 2P0LA 4YRIA 3HRIA 3P8TA 4TQDA 1GGMA 2DXTA 4DPGA 4P73A 4YRNA 3VQWA 2EAYA 3EFRA 2CGHA 4HWSA 4HT4A 3E9IA 2ZZGA 3QO7A 1J5WA 2AKWA 1QF6A 3HRKA 3WQZA 3RKWA 3HXVA 1SETA 2I4LA 2PMEA 4UPAA 4X5OA 4KR3A 3RGLA 4TVAA 1E24A 4BW9A 1X2HA 4K87A 4EO4A 4YPFA 4CH4A 1Z7MA 3QTCA 4H2XB 4LVLA 4ZIBA 4YRGA 2DEQA 1NJ2A 4NCXA 3OD1A 4TTVA 4HWRA 2XTIA 1E22A 2DTIA 1WPYA 3A32A 4YRKA 1L0WA 3TEHB 1EVLA 2I4OA 4OP0A 4BWAA 2AMCA 2QHUA 1WNLA 1ADJA 3ICAA 4XTZA 4YREA 1WYDA 2Q7EA 2ARTA 1WQ7A 2ZINA 4K88A 1QE0A 2ARUA 2Q7GA 2FYKA 4H2WA 1IL2A 4P71A 4YRSA 2XGTA 3HFZB 3A74A 1W66A 2RHSB 1B8AA 2EL9A 3RKYA 1NNHA 1BIAA 4CH6A 2C8MA 2ZGWA 2ZIOA 5C53B 2DJZA 1SESA 2NS6A 1SERA 3A5YA 4H2UA 3RL6A 1X01A 5C51B 1KOGA 3P8VA 2PMFA 3IG2A 1X56A 3QO8A 1E1TA 2DKGA 2ZXFA 1B7YA 3NENA 1X2GA 2ZT5A 4Q15A 4TVYA 4Q6GA 3VQYA 2ODRD 4UP9A 3KFUA 3LC0A 2ZNJA 2IY5A 11ASA 3UFGA 3REXA 1WU7A
chains in the Genus database with same CATH topology
4P73C 1G5IA 1NJ6A 3V8JA 4CH3A 1JJCB 3V8LA 2DZCA 2ZR2A 2CJBA 3HFVA 4LVKA 4XU2A 1ASZA 2ALYB 3UGQA 2Q7HA 3REUA 1EIYA 4RQEA 1ADYA 3HXYA 5K1PA 1YFTA 3MQZA 3L4GB 4YRJA 4E51A 5ELNA 1BBUA 4YCUA 2DDZA 2RHSA 1NJ8A 4CS3A 4P75C 2QHTA 4H02A 4HVCA 3RF1A 2CJAA 1HXDA 1YFRA 4CS2A 4LVIA 4YRRA 3M4QA 4YRFA 2IY5B 1B70B 4YRMA 2Q5HA 12ASA 4WF2A 4P75A 2ZCEA 3NETA 4YDQA 3DSQA 3BJUA 2DVEA 4LVJA 1ATIA 1USYC 2DU7A 3IKMB 4P3OA 5E3IA 3ERRA 4KR2A 1EOVA 3M4PA 3G1ZA 3TEHA 1ASYA 4P71C 1Z7NA 2ALYA 1NJ5A 2ZT8A 3MF1A 2EJ9A 3RACA 4RQFA 5ELOA 3HXZA 3MEYA 2HNIA 4TVAB 3VBBA 2J3MA 2ZTGA 2E64A 4PHCA 2I4MA 4HWTA 2EWNA 3VQVA 2ZIMA 2ZT7A 3UGTA 3HTZA 3IALA 2ZZEA 4XU0A 4P74C 1FYFA 1RIQA 1LYLA 4TQFA 3FJPA 1HTTA 3L4GA 2DTOA 2CJ9A 4DQ2A 4LVMA 2AMCB 4G84A 4HA8A 4XEMA 4O2DA 3V7CA 2DXUA 1USYA 1NJ1A 2Q5IA 3HXUA 1PYSB 2DQ0A 1B76A 4TWAA 1EFWA 3TUPA 3EFSA 4KQEA 4WI1A 4XEOA 3A7RA 3HY1A 3A7AA 4XTUA 4YYEA 3HFZA 2E1HA 4UP8A 4ZTUB 2ARSA 2ZNIA 1B7YB 1YGBA 2ODRC 4XTYA 3A5ZA 4YRLA 3I7FA 2AKWB 4EX5A 1KMNA 3E9HA 4YRCA 2ZT6A 2A8EA 1H4TA 2CIMA 4YRPA 1H4SA 4XU1A 4H2TA 4YRTA 4ZTZB 2E5AA 5K1XA 3RKXA 4XTVA 1EVKA 3L2ZA 3NEMA 3UH0A 4UP7A 3HXWA 1H4QA 1EIYB 4H2XA 1KMMA 2J3LA 2DZ9A 2I4NA 4H2YA 4AH6A 3QO5A 3V7SA 2RHQA 4YP0A 4RDXA 3CMQA 3PCOB 3W3SA 4HWOA 4XTXA 4YCVA 3PZCA 2P5IA 1HC7A 3A31A 4RMFA 1BBWA 4P3NA 5F5WA 4G85A 3BFMA 3LSQA 5KNNA 1X55A 2E41A 4CH5A 4YROA 2QHVA 1WLEA 1B70A 4OLFA 1BIBA 3HY0A 3R07A 2E65A 2E10A 2RHQB 4H2SA 3RIRA 2C7IA 5C52B 1WQWA 1YFSA 2QHSA 3PCOA 1E1OA 4P74A 3A7UA 2ZZFA 1C0AA 1YB3A 2EJFA 4HWPA 3P8YA 2ZR3A 4CS4A 1NYQA 2DU5A 3TEGA 3LSSA 4WJ3M 4P72C 4WJ4A 1H4VB 1JJCA 1N9WA 3IKLA 4YCWA 2G4CA 2EJGA 3MF2A 4LNSA 3VQXA 3QNEA 3L1AA 1VQZA 4P72A 4H2VA 4TVWA 2DQ3A 1G51A 3HXXA 4P3PA 4J15A 1X54A 2E3CA 1PYSA 1SRYA 3V8KA 2DTHA 1EQRA 4YRQA 3NELA 1G5HA 5HGQA 4L87A 4XTWA 3V7RA 3RUXA 4K86A 4XU3A 4PG3A 1NYRA 2P0LA 4YRIA 3HRIA 3P8TA 4TQDA 1GGMA 2DXTA 4DPGA 4P73A 4YRNA 3VQWA 2EAYA 3EFRA 2CGHA 4HWSA 4HT4A 3E9IA 2ZZGA 3QO7A 1J5WA 2AKWA 1QF6A 3HRKA 3WQZA 3RKWA 3HXVA 1SETA 2I4LA 2PMEA 4UPAA 4X5OA 4KR3A 3RGLA 4TVAA 1E24A 4BW9A 1X2HA 4K87A 4EO4A 4YPFA 4CH4A 1Z7MA 3QTCA 4H2XB 4LVLA 4ZIBA 4YRGA 2DEQA 1NJ2A 4NCXA 3OD1A 4TTVA 4HWRA 2XTIA 1E22A 2DTIA 1WPYA 3A32A 4YRKA 1L0WA 3TEHB 1EVLA 2I4OA 4OP0A 4BWAA 2AMCA 2QHUA 1WNLA 1ADJA 3ICAA 4XTZA 4YREA 1WYDA 2Q7EA 2ARTA 1WQ7A 2ZINA 4K88A 1QE0A 2ARUA 2Q7GA 2FYKA 4H2WA 1IL2A 4P71A 4YRSA 2XGTA 3HFZB 3A74A 1W66A 2RHSB 1B8AA 2EL9A 3RKYA 1NNHA 1BIAA 4CH6A 2C8MA 2ZGWA 2ZIOA 5C53B 2DJZA 1SESA 2NS6A 1SERA 3A5YA 4H2UA 3RL6A 1X01A 5C51B 1KOGA 3P8VA 2PMFA 3IG2A 1X56A 3QO8A 1E1TA 2DKGA 2ZXFA 1B7YA 3NENA 1X2GA 2ZT5A 4Q15A 4TVYA 4Q6GA 3VQYA 2ODRD 4UP9A 3KFUA 3LC0A 2ZNJA 2IY5A 11ASA 3UFGA 3REXA 1WU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P73 C;  1G5I A;  1NJ6 A;  3V8J A;  4CH3 A;  1JJC B;  3V8L A;  2DZC A;  2ZR2 A;  2CJB A;  3HFV A;  4XU2 A;  1ASZ A;  2ALY B;  3UGQ A;  2Q7H A;  3REU A;  1EIY A;  4RQE A;  1ADY A;  3HXY A;  5K1P A;  1YFT A;  3L4G B;  4YRJ A;  4E51 A;  5ELN A;  1BBU A;  4YCU A;  2DDZ A;  2RHS A;  1NJ8 A;  4CS3 A;  4P75 C;  2QHT A;  4H02 A;  4HVC A;  3RF1 A;  2CJA A;  1HXD A;  1YFR A;  4CS2 A;  4YRR A;  3M4Q A;  4YRF A;  2IY5 B;  1B70 B;  4YRM A;  2Q5H A;  12AS A;  4WF2 A;  4P75 A;  2ZCE A;  3NET A;  4YDQ A;  3DSQ A;  3BJU A;  2DVE A;  1ATI A;  1USY C;  2DU7 A;  3IKM B;  4P3O A;  5E3I A;  3ERR A;  4KR2 A;  1EOV A;  3M4P A;  3G1Z A;  3TEH A;  1ASY A;  4P71 C;  1Z7N A;  2ALY A;  1NJ5 A;  2ZT8 A;  3MF1 A;  2EJ9 A;  3RAC A;  4RQF A;  5ELO A;  3HXZ A;  3MEY A;  2HNI A;  4TVA B;  3VBB A;  2J3M A;  2ZTG A;  2E64 A;  4PHC A;  2I4M A;  4HWT A;  2EWN A;  3VQV A;  2ZIM A;  2ZT7 A;  3UGT A;  3HTZ A;  3IAL A;  2ZZE A;  4XU0 A;  4P74 C;  1FYF A;  1RIQ A;  1LYL A;  4TQF A;  3FJP A;  1HTT A;  3L4G A;  2DTO A;  2CJ9 A;  4DQ2 A;  2AMC B;  4G84 A;  4HA8 A;  4XEM A;  4O2D A;  3V7C A;  2DXU A;  1USY A;  1NJ1 A;  2Q5I A;  3HXU A;  1PYS B;  2DQ0 A;  1B76 A;  4TWA A;  1EFW A;  3TUP A;  3EFS A;  4KQE A;  4WI1 A;  4XEO A;  3A7R A;  3HY1 A;  3A7A A;  4XTU A;  4YYE A;  3HFZ A;  2E1H A;  4UP8 A;  4ZTU B;  2ARS A;  2ZNI A;  1B7Y B;  1YGB A;  2ODR C;  4XTY A;  3A5Z A;  4YRL A;  3I7F A;  2AKW B;  4EX5 A;  1KMN A;  3E9H A;  4YRC A;  2ZT6 A;  1H4T A;  2CIM A;  4YRP A;  1H4S A;  4XU1 A;  4H2T A;  4YRT A;  4ZTZ B;  2E5A A;  5K1X A;  3RKX A;  4XTV A;  1EVK A;  3L2Z A;  3NEM A;  3UH0 A;  4UP7 A;  3HXW A;  1H4Q A;  1EIY B;  4H2X A;  1KMM A;  2J3L A;  2DZ9 A;  2I4N A;  4H2Y A;  4AH6 A;  3QO5 A;  3V7S A;  2RHQ A;  4YP0 A;  4RDX A;  3CMQ A;  3PCO B;  3W3S A;  4HWO A;  4XTX A;  4YCV A;  3PZC A;  2P5I A;  1HC7 A;  3A31 A;  4RMF A;  1BBW A;  4P3N A;  5F5W A;  4G85 A;  3BFM A;  3LSQ A;  5KNN A;  1X55 A;  2E41 A;  4CH5 A;  4YRO A;  2QHV A;  1WLE A;  1B70 A;  4OLF A;  1BIB A;  3HY0 A;  3R07 A;  2E65 A;  2E10 A;  2RHQ B;  4H2S A;  3RIR A;  2C7I A;  5C52 B;  1WQW A;  1YFS A;  2QHS A;  3PCO A;  1E1O A;  4P74 A;  3A7U A;  2ZZF A;  1C0A A;  1YB3 A;  2EJF A;  4HWP A;  3P8Y A;  2ZR3 A;  4CS4 A;  1NYQ A;  2DU5 A;  3TEG A;  3LSS A;  4WJ3 M;  4P72 C;  4WJ4 A;  1H4V B;  1JJC A;  1N9W A;  3IKL A;  4YCW A;  2G4C A;  2EJG A;  3MF2 A;  4LNS A;  3VQX A;  3QNE A;  3L1A A;  1VQZ A;  4P72 A;  4H2V A;  4TVW A;  2DQ3 A;  1G51 A;  3HXX A;  4P3P A;  4J15 A;  1X54 A;  2E3C A;  1PYS A;  1SRY A;  3V8K A;  2DTH A;  1EQR A;  4YRQ A;  3NEL A;  1G5H A;  5HGQ A;  4L87 A;  4XTW A;  3V7R A;  3RUX A;  4K86 A;  4XU3 A;  4PG3 A;  1NYR A;  2P0L A;  4YRI A;  3HRI A;  3P8T A;  4TQD A;  1GGM A;  2DXT A;  4DPG A;  4P73 A;  4YRN A;  3VQW A;  2EAY A;  3EFR A;  2CGH A;  4HWS A;  3E9I A;  2ZZG A;  3QO7 A;  1J5W A;  2AKW A;  1QF6 A;  3HRK A;  3WQZ A;  3RKW A;  3HXV A;  1SET A;  2I4L A;  2PME A;  4UPA A;  4X5O A;  4KR3 A;  3RGL A;  4TVA A;  1E24 A;  4BW9 A;  1X2H A;  4K87 A;  4EO4 A;  4YPF A;  4CH4 A;  1Z7M A;  3QTC A;  4H2X B;  4ZIB A;  4YRG A;  2DEQ A;  1NJ2 A;  4NCX A;  3OD1 A;  4TTV A;  4HWR A;  2XTI A;  1E22 A;  2DTI A;  1WPY A;  3A32 A;  4YRK A;  1L0W A;  3TEH B;  1EVL A;  2I4O A;  4OP0 A;  4BWA A;  2AMC A;  2QHU A;  1WNL A;  1ADJ A;  3ICA A;  4XTZ A;  4YRE A;  1WYD A;  2Q7E A;  2ART A;  1WQ7 A;  2ZIN A;  4K88 A;  1QE0 A;  2ARU A;  2Q7G A;  2FYK A;  4H2W A;  1IL2 A;  4P71 A;  4YRS A;  2XGT A;  3HFZ B;  3A74 A;  1W66 A;  2RHS B;  1B8A A;  2EL9 A;  3RKY A;  1NNH A;  1BIA A;  4CH6 A;  2C8M A;  2ZGW A;  2ZIO A;  5C53 B;  2DJZ A;  1SES A;  1SER A;  3A5Y A;  4H2U A;  3RL6 A;  1X01 A;  5C51 B;  1KOG A;  3P8V A;  2PMF A;  3IG2 A;  1X56 A;  3QO8 A;  1E1T A;  2DKG A;  2ZXF A;  1B7Y A;  3NEN A;  1X2G A;  2ZT5 A;  4Q15 A;  4TVY A;  4Q6G A;  3VQY A;  2ODR D;  4UP9 A;  3KFU A;  3LC0 A;  2ZNJ A;  2IY5 A;  11AS A;  3UFG A;  3REX A;  1WU7 A; 
#chains in the Genus database with same CATH topology
 4P73 C;  1G5I A;  1NJ6 A;  3V8J A;  4CH3 A;  1JJC B;  3V8L A;  2DZC A;  2ZR2 A;  2CJB A;  3HFV A;  4LVK A;  4XU2 A;  1ASZ A;  2ALY B;  3UGQ A;  2Q7H A;  3REU A;  1EIY A;  4RQE A;  1ADY A;  3HXY A;  5K1P A;  1YFT A;  3MQZ A;  3L4G B;  4YRJ A;  4E51 A;  5ELN A;  1BBU A;  4YCU A;  2DDZ A;  2RHS A;  1NJ8 A;  4CS3 A;  4P75 C;  2QHT A;  4H02 A;  4HVC A;  3RF1 A;  2CJA A;  1HXD A;  1YFR A;  4CS2 A;  4LVI A;  4YRR A;  3M4Q A;  4YRF A;  2IY5 B;  1B70 B;  4YRM A;  2Q5H A;  12AS A;  4WF2 A;  4P75 A;  2ZCE A;  3NET A;  4YDQ A;  3DSQ A;  3BJU A;  2DVE A;  4LVJ A;  1ATI A;  1USY C;  2DU7 A;  3IKM B;  4P3O A;  5E3I A;  3ERR A;  4KR2 A;  1EOV A;  3M4P A;  3G1Z A;  3TEH A;  1ASY A;  4P71 C;  1Z7N A;  2ALY A;  1NJ5 A;  2ZT8 A;  3MF1 A;  2EJ9 A;  3RAC A;  4RQF A;  5ELO A;  3HXZ A;  3MEY A;  2HNI A;  4TVA B;  3VBB A;  2J3M A;  2ZTG A;  2E64 A;  4PHC A;  2I4M A;  4HWT A;  2EWN A;  3VQV A;  2ZIM A;  2ZT7 A;  3UGT A;  3HTZ A;  3IAL A;  2ZZE A;  4XU0 A;  4P74 C;  1FYF A;  1RIQ A;  1LYL A;  4TQF A;  3FJP A;  1HTT A;  3L4G A;  2DTO A;  2CJ9 A;  4DQ2 A;  4LVM A;  2AMC B;  4G84 A;  4HA8 A;  4XEM A;  4O2D A;  3V7C A;  2DXU A;  1USY A;  1NJ1 A;  2Q5I A;  3HXU A;  1PYS B;  2DQ0 A;  1B76 A;  4TWA A;  1EFW A;  3TUP A;  3EFS A;  4KQE A;  4WI1 A;  4XEO A;  3A7R A;  3HY1 A;  3A7A A;  4XTU A;  4YYE A;  3HFZ A;  2E1H A;  4UP8 A;  4ZTU B;  2ARS A;  2ZNI A;  1B7Y B;  1YGB A;  2ODR C;  4XTY A;  3A5Z A;  4YRL A;  3I7F A;  2AKW B;  4EX5 A;  1KMN A;  3E9H A;  4YRC A;  2ZT6 A;  2A8E A;  1H4T A;  2CIM A;  4YRP A;  1H4S A;  4XU1 A;  4H2T A;  4YRT A;  4ZTZ B;  2E5A A;  5K1X A;  3RKX A;  4XTV A;  1EVK A;  3L2Z A;  3NEM A;  3UH0 A;  4UP7 A;  3HXW A;  1H4Q A;  1EIY B;  4H2X A;  1KMM A;  2J3L A;  2DZ9 A;  2I4N A;  4H2Y A;  4AH6 A;  3QO5 A;  3V7S A;  2RHQ A;  4YP0 A;  4RDX A;  3CMQ A;  3PCO B;  3W3S A;  4HWO A;  4XTX A;  4YCV A;  3PZC A;  2P5I A;  1HC7 A;  3A31 A;  4RMF A;  1BBW A;  4P3N A;  5F5W A;  4G85 A;  3BFM A;  3LSQ A;  5KNN A;  1X55 A;  2E41 A;  4CH5 A;  4YRO A;  2QHV A;  1WLE A;  1B70 A;  4OLF A;  1BIB A;  3HY0 A;  3R07 A;  2E65 A;  2E10 A;  2RHQ B;  4H2S A;  3RIR A;  2C7I A;  5C52 B;  1WQW A;  1YFS A;  2QHS A;  3PCO A;  1E1O A;  4P74 A;  3A7U A;  2ZZF A;  1C0A A;  1YB3 A;  2EJF A;  4HWP A;  3P8Y A;  2ZR3 A;  4CS4 A;  1NYQ A;  2DU5 A;  3TEG A;  3LSS A;  4WJ3 M;  4P72 C;  4WJ4 A;  1H4V B;  1JJC A;  1N9W A;  3IKL A;  4YCW A;  2G4C A;  2EJG A;  3MF2 A;  4LNS A;  3VQX A;  3QNE A;  3L1A A;  1VQZ A;  4P72 A;  4H2V A;  4TVW A;  2DQ3 A;  1G51 A;  3HXX A;  4P3P A;  4J15 A;  1X54 A;  2E3C A;  1PYS A;  1SRY A;  3V8K A;  2DTH A;  1EQR A;  4YRQ A;  3NEL A;  1G5H A;  5HGQ A;  4L87 A;  4XTW A;  3V7R A;  3RUX A;  4K86 A;  4XU3 A;  4PG3 A;  1NYR A;  2P0L A;  4YRI A;  3HRI A;  3P8T A;  4TQD A;  1GGM A;  2DXT A;  4DPG A;  4P73 A;  4YRN A;  3VQW A;  2EAY A;  3EFR A;  2CGH A;  4HWS A;  4HT4 A;  3E9I A;  2ZZG A;  3QO7 A;  1J5W A;  2AKW A;  1QF6 A;  3HRK A;  3WQZ A;  3RKW A;  3HXV A;  1SET A;  2I4L A;  2PME A;  4UPA A;  4X5O A;  4KR3 A;  3RGL A;  4TVA A;  1E24 A;  4BW9 A;  1X2H A;  4K87 A;  4EO4 A;  4YPF A;  4CH4 A;  1Z7M A;  3QTC A;  4H2X B;  4LVL A;  4ZIB A;  4YRG A;  2DEQ A;  1NJ2 A;  4NCX A;  3OD1 A;  4TTV A;  4HWR A;  2XTI A;  1E22 A;  2DTI A;  1WPY A;  3A32 A;  4YRK A;  1L0W A;  3TEH B;  1EVL A;  2I4O A;  4OP0 A;  4BWA A;  2AMC A;  2QHU A;  1WNL A;  1ADJ A;  3ICA A;  4XTZ A;  4YRE A;  1WYD A;  2Q7E A;  2ART A;  1WQ7 A;  2ZIN A;  4K88 A;  1QE0 A;  2ARU A;  2Q7G A;  2FYK A;  4H2W A;  1IL2 A;  4P71 A;  4YRS A;  2XGT A;  3HFZ B;  3A74 A;  1W66 A;  2RHS B;  1B8A A;  2EL9 A;  3RKY A;  1NNH A;  1BIA A;  4CH6 A;  2C8M A;  2ZGW A;  2ZIO A;  5C53 B;  2DJZ A;  1SES A;  2NS6 A;  1SER A;  3A5Y A;  4H2U A;  3RL6 A;  1X01 A;  5C51 B;  1KOG A;  3P8V A;  2PMF A;  3IG2 A;  1X56 A;  3QO8 A;  1E1T A;  2DKG A;  2ZXF A;  1B7Y A;  3NEN A;  1X2G A;  2ZT5 A;  4Q15 A;  4TVY A;  4Q6G A;  3VQY A;  2ODR D;  4UP9 A;  3KFU A;  3LC0 A;  2ZNJ A;  2IY5 A;  11AS A;  3UFG A;  3REX A;  1WU7 A; 
#chains in the Genus database with same CATH homology
 4P73 C;  1G5I A;  1NJ6 A;  3V8J A;  4CH3 A;  1JJC B;  3V8L A;  2DZC A;  2ZR2 A;  2CJB A;  3HFV A;  4LVK A;  4XU2 A;  1ASZ A;  2ALY B;  3UGQ A;  2Q7H A;  3REU A;  1EIY A;  4RQE A;  1ADY A;  3HXY A;  5K1P A;  1YFT A;  3MQZ A;  3L4G B;  4YRJ A;  4E51 A;  5ELN A;  1BBU A;  4YCU A;  2DDZ A;  2RHS A;  1NJ8 A;  4CS3 A;  4P75 C;  2QHT A;  4H02 A;  4HVC A;  3RF1 A;  2CJA A;  1HXD A;  1YFR A;  4CS2 A;  4LVI A;  4YRR A;  3M4Q A;  4YRF A;  2IY5 B;  1B70 B;  4YRM A;  2Q5H A;  12AS A;  4WF2 A;  4P75 A;  2ZCE A;  3NET A;  4YDQ A;  3DSQ A;  3BJU A;  2DVE A;  4LVJ A;  1ATI A;  1USY C;  2DU7 A;  3IKM B;  4P3O A;  5E3I A;  3ERR A;  4KR2 A;  1EOV A;  3M4P A;  3G1Z A;  3TEH A;  1ASY A;  4P71 C;  1Z7N A;  2ALY A;  1NJ5 A;  2ZT8 A;  3MF1 A;  2EJ9 A;  3RAC A;  4RQF A;  5ELO A;  3HXZ A;  3MEY A;  2HNI A;  4TVA B;  3VBB A;  2J3M A;  2ZTG A;  2E64 A;  4PHC A;  2I4M A;  4HWT A;  2EWN A;  3VQV A;  2ZIM A;  2ZT7 A;  3UGT A;  3HTZ A;  3IAL A;  2ZZE A;  4XU0 A;  4P74 C;  1FYF A;  1RIQ A;  1LYL A;  4TQF A;  3FJP A;  1HTT A;  3L4G A;  2DTO A;  2CJ9 A;  4DQ2 A;  4LVM A;  2AMC B;  4G84 A;  4HA8 A;  4XEM A;  4O2D A;  3V7C A;  2DXU A;  1USY A;  1NJ1 A;  2Q5I A;  3HXU A;  1PYS B;  2DQ0 A;  1B76 A;  4TWA A;  1EFW A;  3TUP A;  3EFS A;  4KQE A;  4WI1 A;  4XEO A;  3A7R A;  3HY1 A;  3A7A A;  4XTU A;  4YYE A;  3HFZ A;  2E1H A;  4UP8 A;  4ZTU B;  2ARS A;  2ZNI A;  1B7Y B;  1YGB A;  2ODR C;  4XTY A;  3A5Z A;  4YRL A;  3I7F A;  2AKW B;  4EX5 A;  1KMN A;  3E9H A;  4YRC A;  2ZT6 A;  2A8E A;  1H4T A;  2CIM A;  4YRP A;  1H4S A;  4XU1 A;  4H2T A;  4YRT A;  4ZTZ B;  2E5A A;  5K1X A;  3RKX A;  4XTV A;  1EVK A;  3L2Z A;  3NEM A;  3UH0 A;  4UP7 A;  3HXW A;  1H4Q A;  1EIY B;  4H2X A;  1KMM A;  2J3L A;  2DZ9 A;  2I4N A;  4H2Y A;  4AH6 A;  3QO5 A;  3V7S A;  2RHQ A;  4YP0 A;  4RDX A;  3CMQ A;  3PCO B;  3W3S A;  4HWO A;  4XTX A;  4YCV A;  3PZC A;  2P5I A;  1HC7 A;  3A31 A;  4RMF A;  1BBW A;  4P3N A;  5F5W A;  4G85 A;  3BFM A;  3LSQ A;  5KNN A;  1X55 A;  2E41 A;  4CH5 A;  4YRO A;  2QHV A;  1WLE A;  1B70 A;  4OLF A;  1BIB A;  3HY0 A;  3R07 A;  2E65 A;  2E10 A;  2RHQ B;  4H2S A;  3RIR A;  2C7I A;  5C52 B;  1WQW A;  1YFS A;  2QHS A;  3PCO A;  1E1O A;  4P74 A;  3A7U A;  2ZZF A;  1C0A A;  1YB3 A;  2EJF A;  4HWP A;  3P8Y A;  2ZR3 A;  4CS4 A;  1NYQ A;  2DU5 A;  3TEG A;  3LSS A;  4WJ3 M;  4P72 C;  4WJ4 A;  1H4V B;  1JJC A;  1N9W A;  3IKL A;  4YCW A;  2G4C A;  2EJG A;  3MF2 A;  4LNS A;  3VQX A;  3QNE A;  3L1A A;  1VQZ A;  4P72 A;  4H2V A;  4TVW A;  2DQ3 A;  1G51 A;  3HXX A;  4P3P A;  4J15 A;  1X54 A;  2E3C A;  1PYS A;  1SRY A;  3V8K A;  2DTH A;  1EQR A;  4YRQ A;  3NEL A;  1G5H A;  5HGQ A;  4L87 A;  4XTW A;  3V7R A;  3RUX A;  4K86 A;  4XU3 A;  4PG3 A;  1NYR A;  2P0L A;  4YRI A;  3HRI A;  3P8T A;  4TQD A;  1GGM A;  2DXT A;  4DPG A;  4P73 A;  4YRN A;  3VQW A;  2EAY A;  3EFR A;  2CGH A;  4HWS A;  4HT4 A;  3E9I A;  2ZZG A;  3QO7 A;  1J5W A;  2AKW A;  1QF6 A;  3HRK A;  3WQZ A;  3RKW A;  3HXV A;  1SET A;  2I4L A;  2PME A;  4UPA A;  4X5O A;  4KR3 A;  3RGL A;  4TVA A;  1E24 A;  4BW9 A;  1X2H A;  4K87 A;  4EO4 A;  4YPF A;  4CH4 A;  1Z7M A;  3QTC A;  4H2X B;  4LVL A;  4ZIB A;  4YRG A;  2DEQ A;  1NJ2 A;  4NCX A;  3OD1 A;  4TTV A;  4HWR A;  2XTI A;  1E22 A;  2DTI A;  1WPY A;  3A32 A;  4YRK A;  1L0W A;  3TEH B;  1EVL A;  2I4O A;  4OP0 A;  4BWA A;  2AMC A;  2QHU A;  1WNL A;  1ADJ A;  3ICA A;  4XTZ A;  4YRE A;  1WYD A;  2Q7E A;  2ART A;  1WQ7 A;  2ZIN A;  4K88 A;  1QE0 A;  2ARU A;  2Q7G A;  2FYK A;  4H2W A;  1IL2 A;  4P71 A;  4YRS A;  2XGT A;  3HFZ B;  3A74 A;  1W66 A;  2RHS B;  1B8A A;  2EL9 A;  3RKY A;  1NNH A;  1BIA A;  4CH6 A;  2C8M A;  2ZGW A;  2ZIO A;  5C53 B;  2DJZ A;  1SES A;  2NS6 A;  1SER A;  3A5Y A;  4H2U A;  3RL6 A;  1X01 A;  5C51 B;  1KOG A;  3P8V A;  2PMF A;  3IG2 A;  1X56 A;  3QO8 A;  1E1T A;  2DKG A;  2ZXF A;  1B7Y A;  3NEN A;  1X2G A;  2ZT5 A;  4Q15 A;  4TVY A;  4Q6G A;  3VQY A;  2ODR D;  4UP9 A;  3KFU A;  3LC0 A;  2ZNJ A;  2IY5 A;  11AS A;  3UFG A;  3REX A;  1WU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...