2DDZA

Protein of unknown function from pyrococcus horikoshi
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
b'SMELLIIKERRIDYDGSAIRSHWAYRNFGILGDSLVVFRGKCNVKVEEMVDIEDLRLRKEIKGDDMVHYILELFWHPDILLASSLQKLLIARLVELLWNYGIEASRRGDDIYVNGRKLSISIATVSPVSIKIHIGLNVKTVGVPPGVDAIGLEELGIDPTEFMERSAKALVEEIEKVRKDSLKVRWVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 190aa long hypothetical protein
publication title X-ray structure of Unknown Protein from Pyrococcus horikoshi
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 61
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04017 DUF366 Domain of unknown function (DUF366)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ddzA00
1B7YA 4KR2A 2ZTGA 2DU7A 1JJCA 3A7UA 3MF1A 3NETA 2EWNA 4P72C 3I7FA 3P8YA 3QO8A 3REXA 3HXUA 2PMEA 2ZXFA 2E3CA 1HC7A 1H4TA 4YYEA 1HXDA 5F5WA 4H2YA 4YROA 4YRTA 3L2ZA 4YRIA 2DXUA 4YDQA 2CJBA 1E22A 1X56A 4P74C 1ATIA 3IG2A 3REUA 2ZR2A 1J5WA 1BIAA 4H2UA 4YRCA 4OLFA 2EJ9A 1WYDA 2E1HA 3OD1A 3A32A 4DQ2A 4YRKA 2EAYA 4YP0A 5C52B 4HWRA 4AH6A 4HVCA 1IL2A 3UH0A 2ZCEA 4YRQA 4XEMA 4CH6A 1WU7A 4PHCA 1QF6A 1BBWA 4YRSA 2DXTA 1YGBA 1E24A 4TVAB 2XTIA 1B8AA 2RHSB 1PYSB 1BIBA 1GGMA 3TEGA 3TUPA 2ZNJA 2FYKA 4EO4A 4HWTA 4P3OA 2ZZGA 3RKYA 1WNLA 3CMQA 4ZTUB 5KNNA 1E1OA 1SERA 1H4VB 4DPGA 4TWAA 3UFGA 1ASZA 3RIRA 2ZIMA 2ZT6A 4TVAA 1W66A 1LYLA 4UP9A 2RHSA 1Z7MA 4WJ3M 2IY5B 4UP7A 1EIYB 4CH5A 1SETA 3VQVA 2ZT8A 2DQ3A 4XTXA 2QHSA 1NNHA 4P3NA 4P71A 2ARSA 2DZ9A 4YREA 3QTCA 1USYA 2RHQA 4NCXA 4X5OA 4Q15A 2IY5A 2C7IA 4J15A 4YRJA 4YCUA 3V8JA 4P3PA 3UGQA 4YRGA 3HY0A 4WF2A 3HFVA 3RKXA 4KQEA 2DKGA 2P5IA 3G1ZA 4RQFA 2ODRD 3HXXA 2ALYB 1RIQA 1G5HA 3PZCA 4XEOA 3FJPA 3VQWA 1HTTA 1ADYA 2AKWB 3P8TA 3LSQA 1NYRA 4UP8A 4UPAA 1X01A 4K88A 3EFSA 2PMFA 1X55A 5K1PA 4HWOA 4H2VA 3W3SA 4XTUA 4CS2A 2ZR3A 1NJ5A 3A7RA 4ZTZB 3NEMA 1YFTA 4TQFA 3R07A 2E65A 4XU0A 1YFSA 2QHVA 4XTZA 4RDXA 4CS3A 2ZIOA 3ERRA 1EFWA 2ARTA 3A7AA 3HXZA 3L1AA 2Q7HA 4YCWA 1WQ7A 1L0WA 3LSSA 3V8LA 4HWPA 1X2HA 1ADJA 1ASYA 4XU1A 3M4PA 2E41A 3BFMA 2J3MA 2ZGWA 4Q6GA 3NENA 4K87A 2EJGA 4O2DA 4RMFA 1N9WA 1QE0A 2ZZEA 4XU3A 2DZCA 3MEYA 4BWAA 3QO7A 2E5AA 1NJ6A 2CJAA 4H2SA 3HXYA 1Z7NA 4P71C 2DEQA 1PYSA 1USYC 3L4GB 2DJZA 4EX5A 1BBUA 5E3IA 1NJ1A 2C8MA 2I4NA 1KMMA 2EL9A 4YRLA 2QHUA 4P75A 3M4QA 2J3LA 4G84A 1EQRA 3VQYA 12ASA 3HFZB 1SESA 2DDZA 4PG3A 3HRKA 2DU5A 1EIYA 1B70B 2CGHA 3E9HA 3TEHB 4G85A 3HY1A 2DTHA 2ZZFA 1YB3A 4P73A 1VQZA 5K1XA 4YRRA 4E51A 4H02A 2HNIA 4TVYA 4YRFA 1EVLA 4YRPA 1B70A 3VQXA 1WLEA 3RF1A 3BJUA 4L87A 5C53B 3E9IA 1KMNA 3RGLA 1G5IA 1NJ8A 4H2WA 2ALYA 4CH3A 4TQDA 3HRIA 3V7SA 3HXWA 2AKWA 2I4MA 5ELOA 2QHTA 2ZT5A 1KOGA 3NELA 1X54A 4YRMA 2DVEA 2ARUA 3ICAA 4CH4A 2EJFA 4H2XB 4CS4A 5ELNA 4XTYA 3LC0A 4P72A 1WPYA 5HGQA 4TVWA 1NJ2A 2ZINA 1EVKA 2P0LA 4HWSA 3EFRA 2AMCB 4LNSA 4WJ4A 1C0AA 4RQEA 4H2TA 4TTVA 2ZT7A 2CIMA 1NYQA 4H2XA 2E10A 11ASA 4P74A 3IKMB 1FYFA 1EOVA 2Q5IA 4YRNA 3V8KA 3V7RA 2Q7GA 3PCOB 3A5YA 2AMCA 3V7CA 4P75C 1YFRA 2ZNIA 3MF2A 4WI1A 2XGTA 3A5ZA 3P8VA 4OP0A 2I4LA 4XTWA 2Q7EA 3HXVA 1E1TA 2DTIA 2G4CA 3PCOA 1H4SA 4P73C 4ZIBA 3UGTA 1H4QA 2I4OA 5C51B 3RUXA 4HA8A 3L4GA 4YCVA 2DTOA 2RHQB 3A31A 1X2GA 4XTVA 3VBBA 3QNEA 3QO5A 4XU2A 3RACA 2DQ0A 3DSQA 3HTZA 1B7YB 3A74A 3IKLA 1JJCB 4K86A 3RL6A 3HFZA 3IALA 2ODRC 3WQZA 2E64A 1WQWA 4BW9A 4KR3A 1B76A 1G51A 1SRYA 3RKWA 4YPFA 3TEHA 2Q5HA 2CJ9A 3KFUA
chains in the Genus database with same CATH superfamily
1B7YA 4KR2A 2ZTGA 2DU7A 4LVLA 1JJCA 3A7UA 3MF1A 3NETA 2EWNA 4P72C 3I7FA 3P8YA 3QO8A 3REXA 3HXUA 2PMEA 2ZXFA 2E3CA 1HC7A 1H4TA 4YYEA 1HXDA 5F5WA 4H2YA 4YROA 4YRTA 3L2ZA 4YRIA 2DXUA 4YDQA 2CJBA 1E22A 1X56A 4P74C 1ATIA 3IG2A 3REUA 2ZR2A 1J5WA 1BIAA 4H2UA 4YRCA 4OLFA 2EJ9A 1WYDA 2E1HA 3OD1A 3A32A 4DQ2A 4YRKA 2EAYA 4YP0A 2A8EA 5C52B 4HWRA 4AH6A 4HVCA 1IL2A 3UH0A 2ZCEA 4YRQA 4XEMA 4CH6A 1WU7A 4PHCA 1QF6A 1BBWA 4YRSA 2DXTA 1YGBA 1E24A 4TVAB 2XTIA 1B8AA 2RHSB 1PYSB 4LVIA 1BIBA 1GGMA 3TEGA 3TUPA 2ZNJA 2FYKA 4EO4A 4HWTA 4P3OA 2ZZGA 3RKYA 1WNLA 3CMQA 4ZTUB 5KNNA 1E1OA 1SERA 1H4VB 4DPGA 4TWAA 3UFGA 1ASZA 3RIRA 2ZIMA 3MQZA 2ZT6A 4TVAA 1W66A 1LYLA 4UP9A 2RHSA 1Z7MA 4WJ3M 2IY5B 4UP7A 1EIYB 4CH5A 1SETA 2NS6A 3VQVA 2ZT8A 2DQ3A 4XTXA 2QHSA 1NNHA 4P3NA 4P71A 2ARSA 2DZ9A 4YREA 3QTCA 1USYA 2RHQA 4NCXA 4X5OA 4Q15A 2IY5A 2C7IA 4J15A 4YRJA 4YCUA 3V8JA 4P3PA 3UGQA 4YRGA 3HY0A 4WF2A 3HFVA 3RKXA 4KQEA 2DKGA 2P5IA 3G1ZA 4RQFA 2ODRD 3HXXA 2ALYB 1RIQA 1G5HA 3PZCA 4XEOA 3FJPA 3VQWA 1HTTA 1ADYA 2AKWB 3P8TA 3LSQA 1NYRA 4UP8A 4UPAA 1X01A 4K88A 3EFSA 2PMFA 1X55A 5K1PA 4HWOA 4H2VA 3W3SA 4XTUA 4CS2A 2ZR3A 1NJ5A 3A7RA 4ZTZB 3NEMA 1YFTA 4TQFA 3R07A 2E65A 4XU0A 1YFSA 2QHVA 4XTZA 4RDXA 4CS3A 2ZIOA 3ERRA 1EFWA 2ARTA 3A7AA 3HXZA 3L1AA 2Q7HA 4YCWA 1WQ7A 1L0WA 3LSSA 3V8LA 4HWPA 1X2HA 1ADJA 1ASYA 4XU1A 3M4PA 2E41A 3BFMA 2J3MA 2ZGWA 4Q6GA 3NENA 4K87A 2EJGA 4O2DA 4RMFA 1N9WA 1QE0A 2ZZEA 4XU3A 2DZCA 3MEYA 4BWAA 3QO7A 2E5AA 1NJ6A 2CJAA 4H2SA 3HXYA 1Z7NA 4P71C 2DEQA 1PYSA 1USYC 3L4GB 2DJZA 4EX5A 1BBUA 5E3IA 1NJ1A 2C8MA 2I4NA 1KMMA 2EL9A 4YRLA 2QHUA 4P75A 3M4QA 2J3LA 4G84A 1EQRA 3VQYA 12ASA 3HFZB 1SESA 2DDZA 4PG3A 3HRKA 2DU5A 1EIYA 1B70B 2CGHA 3E9HA 3TEHB 4G85A 3HY1A 2DTHA 2ZZFA 1YB3A 4P73A 1VQZA 5K1XA 4YRRA 4E51A 4H02A 2HNIA 4TVYA 4YRFA 1EVLA 4YRPA 1B70A 3VQXA 1WLEA 3RF1A 3BJUA 4L87A 5C53B 3E9IA 1KMNA 3RGLA 1G5IA 1NJ8A 4H2WA 2ALYA 4CH3A 4TQDA 3HRIA 3V7SA 3HXWA 2AKWA 2I4MA 5ELOA 4HT4A 2QHTA 2ZT5A 1KOGA 4LVJA 3NELA 1X54A 4YRMA 2DVEA 2ARUA 3ICAA 4CH4A 2EJFA 4H2XB 4CS4A 5ELNA 4XTYA 3LC0A 4P72A 1WPYA 5HGQA 4TVWA 1NJ2A 2ZINA 1EVKA 2P0LA 4HWSA 3EFRA 2AMCB 4LNSA 4WJ4A 1C0AA 4RQEA 4H2TA 4TTVA 2ZT7A 2CIMA 1NYQA 4H2XA 2E10A 11ASA 4P74A 3IKMB 1FYFA 1EOVA 2Q5IA 4YRNA 3V8KA 3V7RA 2Q7GA 3PCOB 3A5YA 2AMCA 4LVMA 3V7CA 4P75C 1YFRA 2ZNIA 3MF2A 4WI1A 2XGTA 3A5ZA 3P8VA 4OP0A 2I4LA 4XTWA 2Q7EA 3HXVA 1E1TA 2DTIA 2G4CA 3PCOA 1H4SA 4P73C 4ZIBA 3UGTA 1H4QA 2I4OA 5C51B 3RUXA 4HA8A 3L4GA 4YCVA 2DTOA 2RHQB 4LVKA 3A31A 1X2GA 4XTVA 3VBBA 3QNEA 3QO5A 4XU2A 3RACA 2DQ0A 3DSQA 3HTZA 1B7YB 3A74A 3IKLA 1JJCB 4K86A 3RL6A 3HFZA 3IALA 2ODRC 3WQZA 2E64A 1WQWA 4BW9A 4KR3A 1B76A 1G51A 1SRYA 3RKWA 4YPFA 3TEHA 2Q5HA 2CJ9A 3KFUA
chains in the Genus database with same CATH topology
1B7YA 4KR2A 2ZTGA 2DU7A 4LVLA 1JJCA 3A7UA 3MF1A 3NETA 2EWNA 4P72C 3I7FA 3P8YA 3QO8A 3REXA 3HXUA 2PMEA 2ZXFA 2E3CA 1HC7A 1H4TA 4YYEA 1HXDA 5F5WA 4H2YA 4YROA 4YRTA 3L2ZA 4YRIA 2DXUA 4YDQA 2CJBA 1E22A 1X56A 4P74C 1ATIA 3IG2A 3REUA 2ZR2A 1J5WA 1BIAA 4H2UA 4YRCA 4OLFA 2EJ9A 1WYDA 2E1HA 3OD1A 3A32A 4DQ2A 4YRKA 2EAYA 4YP0A 2A8EA 5C52B 4HWRA 4AH6A 4HVCA 1IL2A 3UH0A 2ZCEA 4YRQA 4XEMA 4CH6A 1WU7A 4PHCA 1QF6A 1BBWA 4YRSA 2DXTA 1YGBA 1E24A 4TVAB 2XTIA 1B8AA 2RHSB 1PYSB 4LVIA 1BIBA 1GGMA 3TEGA 3TUPA 2ZNJA 2FYKA 4EO4A 4HWTA 4P3OA 2ZZGA 3RKYA 1WNLA 3CMQA 4ZTUB 5KNNA 1E1OA 1SERA 1H4VB 4DPGA 4TWAA 3UFGA 1ASZA 3RIRA 2ZIMA 3MQZA 2ZT6A 4TVAA 1W66A 1LYLA 4UP9A 2RHSA 1Z7MA 4WJ3M 2IY5B 4UP7A 1EIYB 4CH5A 1SETA 2NS6A 3VQVA 2ZT8A 2DQ3A 4XTXA 2QHSA 1NNHA 4P3NA 4P71A 2ARSA 2DZ9A 4YREA 3QTCA 1USYA 2RHQA 4NCXA 4X5OA 4Q15A 2IY5A 2C7IA 4J15A 4YRJA 4YCUA 3V8JA 4P3PA 3UGQA 4YRGA 3HY0A 4WF2A 3HFVA 3RKXA 4KQEA 2DKGA 2P5IA 3G1ZA 4RQFA 2ODRD 3HXXA 2ALYB 1RIQA 1G5HA 3PZCA 4XEOA 3FJPA 3VQWA 1HTTA 1ADYA 2AKWB 3P8TA 3LSQA 1NYRA 4UP8A 4UPAA 1X01A 4K88A 3EFSA 2PMFA 1X55A 5K1PA 4HWOA 4H2VA 3W3SA 4XTUA 4CS2A 2ZR3A 1NJ5A 3A7RA 4ZTZB 3NEMA 1YFTA 4TQFA 3R07A 2E65A 4XU0A 1YFSA 2QHVA 4XTZA 4RDXA 4CS3A 2ZIOA 3ERRA 1EFWA 2ARTA 3A7AA 3HXZA 3L1AA 2Q7HA 4YCWA 1WQ7A 1L0WA 3LSSA 3V8LA 4HWPA 1X2HA 1ADJA 1ASYA 4XU1A 3M4PA 2E41A 3BFMA 2J3MA 2ZGWA 4Q6GA 3NENA 4K87A 2EJGA 4O2DA 4RMFA 1N9WA 1QE0A 2ZZEA 4XU3A 2DZCA 3MEYA 4BWAA 3QO7A 2E5AA 1NJ6A 2CJAA 4H2SA 3HXYA 1Z7NA 4P71C 2DEQA 1PYSA 1USYC 3L4GB 2DJZA 4EX5A 1BBUA 5E3IA 1NJ1A 2C8MA 2I4NA 1KMMA 2EL9A 4YRLA 2QHUA 4P75A 3M4QA 2J3LA 4G84A 1EQRA 3VQYA 12ASA 3HFZB 1SESA 2DDZA 4PG3A 3HRKA 2DU5A 1EIYA 1B70B 2CGHA 3E9HA 3TEHB 4G85A 3HY1A 2DTHA 2ZZFA 1YB3A 4P73A 1VQZA 5K1XA 4YRRA 4E51A 4H02A 2HNIA 4TVYA 4YRFA 1EVLA 4YRPA 1B70A 3VQXA 1WLEA 3RF1A 3BJUA 4L87A 5C53B 3E9IA 1KMNA 3RGLA 1G5IA 1NJ8A 4H2WA 2ALYA 4CH3A 4TQDA 3HRIA 3V7SA 3HXWA 2AKWA 2I4MA 5ELOA 4HT4A 2QHTA 2ZT5A 1KOGA 4LVJA 3NELA 1X54A 4YRMA 2DVEA 2ARUA 3ICAA 4CH4A 2EJFA 4H2XB 4CS4A 5ELNA 4XTYA 3LC0A 4P72A 1WPYA 5HGQA 4TVWA 1NJ2A 2ZINA 1EVKA 2P0LA 4HWSA 3EFRA 2AMCB 4LNSA 4WJ4A 1C0AA 4RQEA 4H2TA 4TTVA 2ZT7A 2CIMA 1NYQA 4H2XA 2E10A 11ASA 4P74A 3IKMB 1FYFA 1EOVA 2Q5IA 4YRNA 3V8KA 3V7RA 2Q7GA 3PCOB 3A5YA 2AMCA 4LVMA 3V7CA 4P75C 1YFRA 2ZNIA 3MF2A 4WI1A 2XGTA 3A5ZA 3P8VA 4OP0A 2I4LA 4XTWA 2Q7EA 3HXVA 1E1TA 2DTIA 2G4CA 3PCOA 1H4SA 4P73C 4ZIBA 3UGTA 1H4QA 2I4OA 5C51B 3RUXA 4HA8A 3L4GA 4YCVA 2DTOA 2RHQB 4LVKA 3A31A 1X2GA 4XTVA 3VBBA 3QNEA 3QO5A 4XU2A 3RACA 2DQ0A 3DSQA 3HTZA 1B7YB 3A74A 3IKLA 1JJCB 4K86A 3RL6A 3HFZA 3IALA 2ODRC 3WQZA 2E64A 1WQWA 4BW9A 4KR3A 1B76A 1G51A 1SRYA 3RKWA 4YPFA 3TEHA 2Q5HA 2CJ9A 3KFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7Y A;  4KR2 A;  2ZTG A;  2DU7 A;  1JJC A;  3A7U A;  3MF1 A;  3NET A;  2EWN A;  4P72 C;  3I7F A;  3P8Y A;  3QO8 A;  3REX A;  3HXU A;  2PME A;  2ZXF A;  2E3C A;  1HC7 A;  1H4T A;  4YYE A;  1HXD A;  5F5W A;  4H2Y A;  4YRO A;  4YRT A;  3L2Z A;  4YRI A;  2DXU A;  4YDQ A;  2CJB A;  1E22 A;  1X56 A;  4P74 C;  1ATI A;  3IG2 A;  3REU A;  2ZR2 A;  1J5W A;  1BIA A;  4H2U A;  4YRC A;  4OLF A;  2EJ9 A;  1WYD A;  2E1H A;  3OD1 A;  3A32 A;  4DQ2 A;  4YRK A;  2EAY A;  4YP0 A;  5C52 B;  4HWR A;  4AH6 A;  4HVC A;  1IL2 A;  3UH0 A;  2ZCE A;  4YRQ A;  4XEM A;  4CH6 A;  1WU7 A;  4PHC A;  1QF6 A;  1BBW A;  4YRS A;  2DXT A;  1YGB A;  1E24 A;  4TVA B;  2XTI A;  1B8A A;  2RHS B;  1PYS B;  1BIB A;  1GGM A;  3TEG A;  3TUP A;  2ZNJ A;  2FYK A;  4EO4 A;  4HWT A;  4P3O A;  2ZZG A;  3RKY A;  1WNL A;  3CMQ A;  4ZTU B;  5KNN A;  1E1O A;  1SER A;  1H4V B;  4DPG A;  4TWA A;  3UFG A;  1ASZ A;  3RIR A;  2ZIM A;  2ZT6 A;  4TVA A;  1W66 A;  1LYL A;  4UP9 A;  2RHS A;  1Z7M A;  4WJ3 M;  2IY5 B;  4UP7 A;  1EIY B;  4CH5 A;  1SET A;  3VQV A;  2ZT8 A;  2DQ3 A;  4XTX A;  2QHS A;  1NNH A;  4P3N A;  4P71 A;  2ARS A;  2DZ9 A;  4YRE A;  3QTC A;  1USY A;  2RHQ A;  4NCX A;  4X5O A;  4Q15 A;  2IY5 A;  2C7I A;  4J15 A;  4YRJ A;  4YCU A;  3V8J A;  4P3P A;  3UGQ A;  4YRG A;  3HY0 A;  4WF2 A;  3HFV A;  3RKX A;  4KQE A;  2DKG A;  2P5I A;  3G1Z A;  4RQF A;  2ODR D;  3HXX A;  2ALY B;  1RIQ A;  1G5H A;  3PZC A;  4XEO A;  3FJP A;  3VQW A;  1HTT A;  1ADY A;  2AKW B;  3P8T A;  3LSQ A;  1NYR A;  4UP8 A;  4UPA A;  1X01 A;  4K88 A;  3EFS A;  2PMF A;  1X55 A;  5K1P A;  4HWO A;  4H2V A;  3W3S A;  4XTU A;  4CS2 A;  2ZR3 A;  1NJ5 A;  3A7R A;  4ZTZ B;  3NEM A;  1YFT A;  4TQF A;  3R07 A;  2E65 A;  4XU0 A;  1YFS A;  2QHV A;  4XTZ A;  4RDX A;  4CS3 A;  2ZIO A;  3ERR A;  1EFW A;  2ART A;  3A7A A;  3HXZ A;  3L1A A;  2Q7H A;  4YCW A;  1WQ7 A;  1L0W A;  3LSS A;  3V8L A;  4HWP A;  1X2H A;  1ADJ A;  1ASY A;  4XU1 A;  3M4P A;  2E41 A;  3BFM A;  2J3M A;  2ZGW A;  4Q6G A;  3NEN A;  4K87 A;  2EJG A;  4O2D A;  4RMF A;  1N9W A;  1QE0 A;  2ZZE A;  4XU3 A;  2DZC A;  3MEY A;  4BWA A;  3QO7 A;  2E5A A;  1NJ6 A;  2CJA A;  4H2S A;  3HXY A;  1Z7N A;  4P71 C;  2DEQ A;  1PYS A;  1USY C;  3L4G B;  2DJZ A;  4EX5 A;  1BBU A;  5E3I A;  1NJ1 A;  2C8M A;  2I4N A;  1KMM A;  2EL9 A;  4YRL A;  2QHU A;  4P75 A;  3M4Q A;  2J3L A;  4G84 A;  1EQR A;  3VQY A;  12AS A;  3HFZ B;  1SES A;  2DDZ A;  4PG3 A;  3HRK A;  2DU5 A;  1EIY A;  1B70 B;  2CGH A;  3E9H A;  3TEH B;  4G85 A;  3HY1 A;  2DTH A;  2ZZF A;  1YB3 A;  4P73 A;  1VQZ A;  5K1X A;  4YRR A;  4E51 A;  4H02 A;  2HNI A;  4TVY A;  4YRF A;  1EVL A;  4YRP A;  1B70 A;  3VQX A;  1WLE A;  3RF1 A;  3BJU A;  4L87 A;  5C53 B;  3E9I A;  1KMN A;  3RGL A;  1G5I A;  1NJ8 A;  4H2W A;  2ALY A;  4CH3 A;  4TQD A;  3HRI A;  3V7S A;  3HXW A;  2AKW A;  2I4M A;  5ELO A;  2QHT A;  2ZT5 A;  1KOG A;  3NEL A;  1X54 A;  4YRM A;  2DVE A;  2ARU A;  3ICA A;  4CH4 A;  2EJF A;  4H2X B;  4CS4 A;  5ELN A;  4XTY A;  3LC0 A;  4P72 A;  1WPY A;  5HGQ A;  4TVW A;  1NJ2 A;  2ZIN A;  1EVK A;  2P0L A;  4HWS A;  3EFR A;  2AMC B;  4LNS A;  4WJ4 A;  1C0A A;  4RQE A;  4H2T A;  4TTV A;  2ZT7 A;  2CIM A;  1NYQ A;  4H2X A;  2E10 A;  11AS A;  4P74 A;  3IKM B;  1FYF A;  1EOV A;  2Q5I A;  4YRN A;  3V8K A;  3V7R A;  2Q7G A;  3PCO B;  3A5Y A;  2AMC A;  3V7C A;  4P75 C;  1YFR A;  2ZNI A;  3MF2 A;  4WI1 A;  2XGT A;  3A5Z A;  3P8V A;  4OP0 A;  2I4L A;  4XTW A;  2Q7E A;  3HXV A;  1E1T A;  2DTI A;  2G4C A;  3PCO A;  1H4S A;  4P73 C;  4ZIB A;  3UGT A;  1H4Q A;  2I4O A;  5C51 B;  3RUX A;  4HA8 A;  3L4G A;  4YCV A;  2DTO A;  2RHQ B;  3A31 A;  1X2G A;  4XTV A;  3VBB A;  3QNE A;  3QO5 A;  4XU2 A;  3RAC A;  2DQ0 A;  3DSQ A;  3HTZ A;  1B7Y B;  3A74 A;  3IKL A;  1JJC B;  4K86 A;  3RL6 A;  3HFZ A;  3IAL A;  2ODR C;  3WQZ A;  2E64 A;  1WQW A;  4BW9 A;  4KR3 A;  1B76 A;  1G51 A;  1SRY A;  3RKW A;  4YPF A;  3TEH A;  2Q5H A;  2CJ9 A;  3KFU A; 
#chains in the Genus database with same CATH topology
 1B7Y A;  4KR2 A;  2ZTG A;  2DU7 A;  4LVL A;  1JJC A;  3A7U A;  3MF1 A;  3NET A;  2EWN A;  4P72 C;  3I7F A;  3P8Y A;  3QO8 A;  3REX A;  3HXU A;  2PME A;  2ZXF A;  2E3C A;  1HC7 A;  1H4T A;  4YYE A;  1HXD A;  5F5W A;  4H2Y A;  4YRO A;  4YRT A;  3L2Z A;  4YRI A;  2DXU A;  4YDQ A;  2CJB A;  1E22 A;  1X56 A;  4P74 C;  1ATI A;  3IG2 A;  3REU A;  2ZR2 A;  1J5W A;  1BIA A;  4H2U A;  4YRC A;  4OLF A;  2EJ9 A;  1WYD A;  2E1H A;  3OD1 A;  3A32 A;  4DQ2 A;  4YRK A;  2EAY A;  4YP0 A;  2A8E A;  5C52 B;  4HWR A;  4AH6 A;  4HVC A;  1IL2 A;  3UH0 A;  2ZCE A;  4YRQ A;  4XEM A;  4CH6 A;  1WU7 A;  4PHC A;  1QF6 A;  1BBW A;  4YRS A;  2DXT A;  1YGB A;  1E24 A;  4TVA B;  2XTI A;  1B8A A;  2RHS B;  1PYS B;  4LVI A;  1BIB A;  1GGM A;  3TEG A;  3TUP A;  2ZNJ A;  2FYK A;  4EO4 A;  4HWT A;  4P3O A;  2ZZG A;  3RKY A;  1WNL A;  3CMQ A;  4ZTU B;  5KNN A;  1E1O A;  1SER A;  1H4V B;  4DPG A;  4TWA A;  3UFG A;  1ASZ A;  3RIR A;  2ZIM A;  3MQZ A;  2ZT6 A;  4TVA A;  1W66 A;  1LYL A;  4UP9 A;  2RHS A;  1Z7M A;  4WJ3 M;  2IY5 B;  4UP7 A;  1EIY B;  4CH5 A;  1SET A;  2NS6 A;  3VQV A;  2ZT8 A;  2DQ3 A;  4XTX A;  2QHS A;  1NNH A;  4P3N A;  4P71 A;  2ARS A;  2DZ9 A;  4YRE A;  3QTC A;  1USY A;  2RHQ A;  4NCX A;  4X5O A;  4Q15 A;  2IY5 A;  2C7I A;  4J15 A;  4YRJ A;  4YCU A;  3V8J A;  4P3P A;  3UGQ A;  4YRG A;  3HY0 A;  4WF2 A;  3HFV A;  3RKX A;  4KQE A;  2DKG A;  2P5I A;  3G1Z A;  4RQF A;  2ODR D;  3HXX A;  2ALY B;  1RIQ A;  1G5H A;  3PZC A;  4XEO A;  3FJP A;  3VQW A;  1HTT A;  1ADY A;  2AKW B;  3P8T A;  3LSQ A;  1NYR A;  4UP8 A;  4UPA A;  1X01 A;  4K88 A;  3EFS A;  2PMF A;  1X55 A;  5K1P A;  4HWO A;  4H2V A;  3W3S A;  4XTU A;  4CS2 A;  2ZR3 A;  1NJ5 A;  3A7R A;  4ZTZ B;  3NEM A;  1YFT A;  4TQF A;  3R07 A;  2E65 A;  4XU0 A;  1YFS A;  2QHV A;  4XTZ A;  4RDX A;  4CS3 A;  2ZIO A;  3ERR A;  1EFW A;  2ART A;  3A7A A;  3HXZ A;  3L1A A;  2Q7H A;  4YCW A;  1WQ7 A;  1L0W A;  3LSS A;  3V8L A;  4HWP A;  1X2H A;  1ADJ A;  1ASY A;  4XU1 A;  3M4P A;  2E41 A;  3BFM A;  2J3M A;  2ZGW A;  4Q6G A;  3NEN A;  4K87 A;  2EJG A;  4O2D A;  4RMF A;  1N9W A;  1QE0 A;  2ZZE A;  4XU3 A;  2DZC A;  3MEY A;  4BWA A;  3QO7 A;  2E5A A;  1NJ6 A;  2CJA A;  4H2S A;  3HXY A;  1Z7N A;  4P71 C;  2DEQ A;  1PYS A;  1USY C;  3L4G B;  2DJZ A;  4EX5 A;  1BBU A;  5E3I A;  1NJ1 A;  2C8M A;  2I4N A;  1KMM A;  2EL9 A;  4YRL A;  2QHU A;  4P75 A;  3M4Q A;  2J3L A;  4G84 A;  1EQR A;  3VQY A;  12AS A;  3HFZ B;  1SES A;  2DDZ A;  4PG3 A;  3HRK A;  2DU5 A;  1EIY A;  1B70 B;  2CGH A;  3E9H A;  3TEH B;  4G85 A;  3HY1 A;  2DTH A;  2ZZF A;  1YB3 A;  4P73 A;  1VQZ A;  5K1X A;  4YRR A;  4E51 A;  4H02 A;  2HNI A;  4TVY A;  4YRF A;  1EVL A;  4YRP A;  1B70 A;  3VQX A;  1WLE A;  3RF1 A;  3BJU A;  4L87 A;  5C53 B;  3E9I A;  1KMN A;  3RGL A;  1G5I A;  1NJ8 A;  4H2W A;  2ALY A;  4CH3 A;  4TQD A;  3HRI A;  3V7S A;  3HXW A;  2AKW A;  2I4M A;  5ELO A;  4HT4 A;  2QHT A;  2ZT5 A;  1KOG A;  4LVJ A;  3NEL A;  1X54 A;  4YRM A;  2DVE A;  2ARU A;  3ICA A;  4CH4 A;  2EJF A;  4H2X B;  4CS4 A;  5ELN A;  4XTY A;  3LC0 A;  4P72 A;  1WPY A;  5HGQ A;  4TVW A;  1NJ2 A;  2ZIN A;  1EVK A;  2P0L A;  4HWS A;  3EFR A;  2AMC B;  4LNS A;  4WJ4 A;  1C0A A;  4RQE A;  4H2T A;  4TTV A;  2ZT7 A;  2CIM A;  1NYQ A;  4H2X A;  2E10 A;  11AS A;  4P74 A;  3IKM B;  1FYF A;  1EOV A;  2Q5I A;  4YRN A;  3V8K A;  3V7R A;  2Q7G A;  3PCO B;  3A5Y A;  2AMC A;  4LVM A;  3V7C A;  4P75 C;  1YFR A;  2ZNI A;  3MF2 A;  4WI1 A;  2XGT A;  3A5Z A;  3P8V A;  4OP0 A;  2I4L A;  4XTW A;  2Q7E A;  3HXV A;  1E1T A;  2DTI A;  2G4C A;  3PCO A;  1H4S A;  4P73 C;  4ZIB A;  3UGT A;  1H4Q A;  2I4O A;  5C51 B;  3RUX A;  4HA8 A;  3L4G A;  4YCV A;  2DTO A;  2RHQ B;  4LVK A;  3A31 A;  1X2G A;  4XTV A;  3VBB A;  3QNE A;  3QO5 A;  4XU2 A;  3RAC A;  2DQ0 A;  3DSQ A;  3HTZ A;  1B7Y B;  3A74 A;  3IKL A;  1JJC B;  4K86 A;  3RL6 A;  3HFZ A;  3IAL A;  2ODR C;  3WQZ A;  2E64 A;  1WQW A;  4BW9 A;  4KR3 A;  1B76 A;  1G51 A;  1SRY A;  3RKW A;  4YPF A;  3TEH A;  2Q5H A;  2CJ9 A;  3KFU A; 
#chains in the Genus database with same CATH homology
 1B7Y A;  4KR2 A;  2ZTG A;  2DU7 A;  4LVL A;  1JJC A;  3A7U A;  3MF1 A;  3NET A;  2EWN A;  4P72 C;  3I7F A;  3P8Y A;  3QO8 A;  3REX A;  3HXU A;  2PME A;  2ZXF A;  2E3C A;  1HC7 A;  1H4T A;  4YYE A;  1HXD A;  5F5W A;  4H2Y A;  4YRO A;  4YRT A;  3L2Z A;  4YRI A;  2DXU A;  4YDQ A;  2CJB A;  1E22 A;  1X56 A;  4P74 C;  1ATI A;  3IG2 A;  3REU A;  2ZR2 A;  1J5W A;  1BIA A;  4H2U A;  4YRC A;  4OLF A;  2EJ9 A;  1WYD A;  2E1H A;  3OD1 A;  3A32 A;  4DQ2 A;  4YRK A;  2EAY A;  4YP0 A;  2A8E A;  5C52 B;  4HWR A;  4AH6 A;  4HVC A;  1IL2 A;  3UH0 A;  2ZCE A;  4YRQ A;  4XEM A;  4CH6 A;  1WU7 A;  4PHC A;  1QF6 A;  1BBW A;  4YRS A;  2DXT A;  1YGB A;  1E24 A;  4TVA B;  2XTI A;  1B8A A;  2RHS B;  1PYS B;  4LVI A;  1BIB A;  1GGM A;  3TEG A;  3TUP A;  2ZNJ A;  2FYK A;  4EO4 A;  4HWT A;  4P3O A;  2ZZG A;  3RKY A;  1WNL A;  3CMQ A;  4ZTU B;  5KNN A;  1E1O A;  1SER A;  1H4V B;  4DPG A;  4TWA A;  3UFG A;  1ASZ A;  3RIR A;  2ZIM A;  3MQZ A;  2ZT6 A;  4TVA A;  1W66 A;  1LYL A;  4UP9 A;  2RHS A;  1Z7M A;  4WJ3 M;  2IY5 B;  4UP7 A;  1EIY B;  4CH5 A;  1SET A;  2NS6 A;  3VQV A;  2ZT8 A;  2DQ3 A;  4XTX A;  2QHS A;  1NNH A;  4P3N A;  4P71 A;  2ARS A;  2DZ9 A;  4YRE A;  3QTC A;  1USY A;  2RHQ A;  4NCX A;  4X5O A;  4Q15 A;  2IY5 A;  2C7I A;  4J15 A;  4YRJ A;  4YCU A;  3V8J A;  4P3P A;  3UGQ A;  4YRG A;  3HY0 A;  4WF2 A;  3HFV A;  3RKX A;  4KQE A;  2DKG A;  2P5I A;  3G1Z A;  4RQF A;  2ODR D;  3HXX A;  2ALY B;  1RIQ A;  1G5H A;  3PZC A;  4XEO A;  3FJP A;  3VQW A;  1HTT A;  1ADY A;  2AKW B;  3P8T A;  3LSQ A;  1NYR A;  4UP8 A;  4UPA A;  1X01 A;  4K88 A;  3EFS A;  2PMF A;  1X55 A;  5K1P A;  4HWO A;  4H2V A;  3W3S A;  4XTU A;  4CS2 A;  2ZR3 A;  1NJ5 A;  3A7R A;  4ZTZ B;  3NEM A;  1YFT A;  4TQF A;  3R07 A;  2E65 A;  4XU0 A;  1YFS A;  2QHV A;  4XTZ A;  4RDX A;  4CS3 A;  2ZIO A;  3ERR A;  1EFW A;  2ART A;  3A7A A;  3HXZ A;  3L1A A;  2Q7H A;  4YCW A;  1WQ7 A;  1L0W A;  3LSS A;  3V8L A;  4HWP A;  1X2H A;  1ADJ A;  1ASY A;  4XU1 A;  3M4P A;  2E41 A;  3BFM A;  2J3M A;  2ZGW A;  4Q6G A;  3NEN A;  4K87 A;  2EJG A;  4O2D A;  4RMF A;  1N9W A;  1QE0 A;  2ZZE A;  4XU3 A;  2DZC A;  3MEY A;  4BWA A;  3QO7 A;  2E5A A;  1NJ6 A;  2CJA A;  4H2S A;  3HXY A;  1Z7N A;  4P71 C;  2DEQ A;  1PYS A;  1USY C;  3L4G B;  2DJZ A;  4EX5 A;  1BBU A;  5E3I A;  1NJ1 A;  2C8M A;  2I4N A;  1KMM A;  2EL9 A;  4YRL A;  2QHU A;  4P75 A;  3M4Q A;  2J3L A;  4G84 A;  1EQR A;  3VQY A;  12AS A;  3HFZ B;  1SES A;  2DDZ A;  4PG3 A;  3HRK A;  2DU5 A;  1EIY A;  1B70 B;  2CGH A;  3E9H A;  3TEH B;  4G85 A;  3HY1 A;  2DTH A;  2ZZF A;  1YB3 A;  4P73 A;  1VQZ A;  5K1X A;  4YRR A;  4E51 A;  4H02 A;  2HNI A;  4TVY A;  4YRF A;  1EVL A;  4YRP A;  1B70 A;  3VQX A;  1WLE A;  3RF1 A;  3BJU A;  4L87 A;  5C53 B;  3E9I A;  1KMN A;  3RGL A;  1G5I A;  1NJ8 A;  4H2W A;  2ALY A;  4CH3 A;  4TQD A;  3HRI A;  3V7S A;  3HXW A;  2AKW A;  2I4M A;  5ELO A;  4HT4 A;  2QHT A;  2ZT5 A;  1KOG A;  4LVJ A;  3NEL A;  1X54 A;  4YRM A;  2DVE A;  2ARU A;  3ICA A;  4CH4 A;  2EJF A;  4H2X B;  4CS4 A;  5ELN A;  4XTY A;  3LC0 A;  4P72 A;  1WPY A;  5HGQ A;  4TVW A;  1NJ2 A;  2ZIN A;  1EVK A;  2P0L A;  4HWS A;  3EFR A;  2AMC B;  4LNS A;  4WJ4 A;  1C0A A;  4RQE A;  4H2T A;  4TTV A;  2ZT7 A;  2CIM A;  1NYQ A;  4H2X A;  2E10 A;  11AS A;  4P74 A;  3IKM B;  1FYF A;  1EOV A;  2Q5I A;  4YRN A;  3V8K A;  3V7R A;  2Q7G A;  3PCO B;  3A5Y A;  2AMC A;  4LVM A;  3V7C A;  4P75 C;  1YFR A;  2ZNI A;  3MF2 A;  4WI1 A;  2XGT A;  3A5Z A;  3P8V A;  4OP0 A;  2I4L A;  4XTW A;  2Q7E A;  3HXV A;  1E1T A;  2DTI A;  2G4C A;  3PCO A;  1H4S A;  4P73 C;  4ZIB A;  3UGT A;  1H4Q A;  2I4O A;  5C51 B;  3RUX A;  4HA8 A;  3L4G A;  4YCV A;  2DTO A;  2RHQ B;  4LVK A;  3A31 A;  1X2G A;  4XTV A;  3VBB A;  3QNE A;  3QO5 A;  4XU2 A;  3RAC A;  2DQ0 A;  3DSQ A;  3HTZ A;  1B7Y B;  3A74 A;  3IKL A;  1JJC B;  4K86 A;  3RL6 A;  3HFZ A;  3IAL A;  2ODR C;  3WQZ A;  2E64 A;  1WQW A;  4BW9 A;  4KR3 A;  1B76 A;  1G51 A;  1SRY A;  3RKW A;  4YPF A;  3TEH A;  2Q5H A;  2CJ9 A;  3KFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...