2DDZA

Protein of unknown function from pyrococcus horikoshi
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
SMELLIIKERRIDYDGSAIRSHWAYRNFGILGDSLVVFRGKCNVKVEEMVDIEDLRLRKEIKGDDMVHYILELFWHPDILLASSLQKLLIARLVELLWNYGIEASRRGDDIYVNGRKLSISIATVSPVSIKIHIGLNVKTVGVPPGVDAIGLEELGIDPTEFMERSAKALVEEIEKVRKDSLKVRWVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 190aa long hypothetical protein
publication title X-ray structure of Unknown Protein from Pyrococcus horikoshi
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 61
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04017 DUF366 Domain of unknown function (DUF366)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ddzA00
12ASA 2ZIOA 4G84A 3I7FA 1EVLA 4KQEA 3UGTA 1YFRA 4P3NA 4XTZA 2ARSA 3BFMA 1USYA 4UP7A 1H4VB 1E1TA 4YRGA 2E3CA 4XU0A 4YRPA 2ZT5A 4OP0A 4YRSA 3LSSA 1SETA 4XTVA 2IY5B 4XTUA 4WI1A 3HXYA 3NELA 1WPYA 1HC7A 4TQFA 1G51A 2ZZEA 3W3SA 3A7RA 3A7UA 1QF6A 4J15A 2PMFA 4K86A 1ADJA 1NJ6A 3HTZA 1X56A 2ZZFA 3V8KA 4P75C 2ARUA 4E51A 4TVYA 4EX5A 4P73C 2Q5IA 1EQRA 3QNEA 1GGMA 1SERA 4HWTA 3KFUA 2E64A 3A5ZA 3PCOB 1YB3A 3IKMB 3DSQA 1C0AA 2ZIMA 3TEHB 1KOGA 2ALYA 4YRIA 3E9HA 1B76A 1NJ2A 1BIBA 3RIRA 2PMEA 4YROA 2ZINA 1BBWA 1BIAA 4YCVA 4HWOA 4RMFA 4K87A 3EFSA 3LSQA 3NEMA 2XGTA 3RUXA 3BJUA 5F5WA 4P71A 5C53B 1RIQA 4XU1A 1B7YA 4YRLA 1J5WA 2RHQA 4H2WA 2P5IA 4H02A 2ODRD 4YREA 2ZT6A 4WJ4A 1YFSA 1JJCB 4TVWA 5HGQA 4P74A 3QO8A 3L1AA 3HXZA 1EVKA 4G85A 2J3LA 1G5HA 4P72A 1B70A 2G4CA 4UPAA 1B8AA 2E5AA 2AMCB 3RL6A 1HTTA 1USYC 1H4TA 3HY1A 1LYLA 3EFRA 1PYSB 3TEGA 4HVCA 1EIYB 4TWAA 1W66A 3UGQA 1NJ1A 2RHSB 1L0WA 1E24A 4HWPA 2DDZA 3L4GB 3UH0A 1SRYA 4WF2A 3LC0A 2Q7GA 1SESA 2E41A 1X01A 3RACA 4YRCA 3PZCA 1KMMA 1N9WA 4DPGA 4YRMA 2DTHA 4YRRA 4YRTA 2IY5A 4RDXA 3RKYA 1WU7A 3CMQA 1YFTA 1NNHA 2CJ9A 1X2GA 3E9IA 2E10A 4H2YA 3UFGA 2AKWB 4XTXA 4TVAB 2ZTGA 1WYDA 2DQ3A 3P8YA 2CJAA 1X55A 1NJ5A 4WJ3M 2DXUA 3HXUA 3HFZB 3NENA 4UP9A 3NETA 4XEOA 4AH6A 4HWSA 3HFVA 1WQ7A 3V8LA 4XEMA 4CH6A 1EFWA 4YRQA 3WQZA 2CIMA 2E1HA 1ADYA 4H2VA 2ZT7A 1G5IA 5C52B 3A7AA 4H2UA 1FYFA 4TTVA 3PCOA 2QHVA 1ATIA 5ELNA 4BW9A 3HRKA 3M4QA 3TEHA 4ZTUB 2DJZA 5K1PA 3R07A 1ASYA 2J3MA 2E65A 2C7IA 3TUPA 3V7SA 2ARTA 2ZNIA 1KMNA 4H2XB 4PHCA 4ZIBA 4P71C 1WLEA 2EL9A 4XU2A 3VQVA 2DZCA 2DQ0A 2EJFA 4YDQA 2Q7HA 2DZ9A 3ERRA 3MF2A 3V7RA 2ZZGA 4CS4A 3HXXA 3P8TA 3G1ZA 4P74C 5ELOA 2C8MA 3HXWA 1QE0A 2ZR2A 3HY0A 4OLFA 3IKLA 3HRIA 2DU5A 4P72C 1NJ8A 2ZXFA 2DEQA 4CH3A 4UP8A 2I4NA 4K88A 4X5OA 4YRJA 4CS3A 3IALA 4EO4A 1JJCA 2DU7A 2P0LA 2CJBA 1Z7MA 2ZT8A 4CH4A 3RKXA 1E22A 4YCWA 3QO7A 3A74A 4H2SA 2QHTA 2FYKA 2CGHA 2AMCA 4Q15A 1WQWA 3M4PA 3VBBA 1H4SA 3ICAA 3OD1A 4YRKA 3FJPA 3VQWA 1X54A 1PYSA 3RF1A 1EIYA 3MEYA 4XTWA 4CH5A 3QO5A 3V8JA 4RQEA 4P3OA 2RHSA 2DTIA 4ZTZB 1VQZA 4YRNA 2ZGWA 3L4GA 3P8VA 4LNSA 5KNNA 5K1XA 1Z7NA 2ZNJA 1BBUA 3A31A 2DKGA 2ALYB 4CS2A 2ODRC 3RGLA 4XTYA 2EAYA 4P75A 3VQXA 2Q7EA 4YPFA 4P73A 4YCUA 4KR2A 1ASZA 2QHUA 1E1OA 4YP0A 2AKWA 4TVAA 3A5YA 4Q6GA 3A32A 1H4QA 4L87A 4P3PA 1YGBA 3HFZA 3QTCA 2EJGA 3HXVA 2I4OA 5E3IA 3REXA 1X2HA 3RKWA 4KR3A 1B7YB 4O2DA 2RHQB 4DQ2A 2Q5HA 2I4LA 1IL2A 2EJ9A 3IG2A 2DTOA 2HNIA 4H2TA 1NYQA 4YRFA 1WNLA 4YYEA 11ASA 2I4MA 2ZCEA 5C51B 4H2XA 4RQFA 4NCXA 4HA8A 3V7CA 3MF1A 4HWRA 1B70B 4XU3A 1EOVA 3VQYA 3L2ZA 2DVEA 1NYRA 4PG3A 2DXTA 2EWNA 4BWAA 2ZR3A 3REUA 1HXDA 2QHSA 2XTIA 4TQDA
chains in the Genus database with same CATH superfamily
12ASA 2ZIOA 4G84A 3I7FA 1EVLA 4KQEA 3UGTA 1YFRA 4P3NA 4XTZA 2ARSA 3BFMA 1USYA 4UP7A 1H4VB 1E1TA 4YRGA 2E3CA 4XU0A 4LVIA 4YRPA 2ZT5A 4OP0A 4YRSA 3LSSA 1SETA 4XTVA 2IY5B 4XTUA 4WI1A 3HXYA 3NELA 1WPYA 1HC7A 4TQFA 1G51A 2ZZEA 3W3SA 3A7RA 3A7UA 1QF6A 4J15A 2PMFA 4K86A 1ADJA 1NJ6A 3HTZA 1X56A 2ZZFA 3V8KA 4P75C 2ARUA 4E51A 4TVYA 4EX5A 4P73C 2Q5IA 1EQRA 3QNEA 1GGMA 1SERA 4HWTA 3KFUA 2E64A 3A5ZA 3PCOB 1YB3A 3IKMB 3DSQA 1C0AA 2ZIMA 3TEHB 1KOGA 2ALYA 4YRIA 3E9HA 1B76A 1NJ2A 1BIBA 3RIRA 2PMEA 4YROA 2ZINA 1BBWA 1BIAA 4YCVA 4HWOA 4RMFA 4K87A 3EFSA 3LSQA 3NEMA 2XGTA 3RUXA 3BJUA 5F5WA 4P71A 5C53B 1RIQA 4XU1A 1B7YA 4YRLA 1J5WA 2RHQA 4H2WA 2P5IA 4H02A 2ODRD 4YREA 2ZT6A 4WJ4A 1YFSA 1JJCB 4TVWA 5HGQA 4P74A 3QO8A 3L1AA 3HXZA 1EVKA 4G85A 2J3LA 1G5HA 4P72A 1B70A 2G4CA 4UPAA 1B8AA 2E5AA 2AMCB 3RL6A 1HTTA 4HT4A 1USYC 2NS6A 1H4TA 3HY1A 1LYLA 3EFRA 1PYSB 3TEGA 4HVCA 1EIYB 4TWAA 1W66A 3UGQA 1NJ1A 2RHSB 1L0WA 1E24A 4HWPA 2DDZA 3L4GB 3UH0A 1SRYA 4WF2A 3LC0A 2Q7GA 1SESA 2E41A 1X01A 3RACA 4YRCA 3PZCA 1KMMA 1N9WA 4DPGA 4YRMA 2DTHA 4YRRA 4YRTA 2IY5A 4RDXA 3RKYA 1WU7A 3CMQA 1YFTA 1NNHA 2CJ9A 1X2GA 3E9IA 4LVJA 2E10A 4H2YA 3UFGA 2AKWB 4XTXA 4TVAB 2ZTGA 1WYDA 2DQ3A 3P8YA 2CJAA 2A8EA 1X55A 1NJ5A 4WJ3M 2DXUA 3HXUA 3HFZB 3NENA 4UP9A 3NETA 4XEOA 4AH6A 4HWSA 3HFVA 1WQ7A 3V8LA 4XEMA 4CH6A 1EFWA 4YRQA 3WQZA 2CIMA 2E1HA 1ADYA 4H2VA 2ZT7A 1G5IA 5C52B 3A7AA 4H2UA 1FYFA 4TTVA 3PCOA 2QHVA 1ATIA 5ELNA 4BW9A 3HRKA 3M4QA 3TEHA 4ZTUB 2DJZA 5K1PA 3R07A 1ASYA 2J3MA 2E65A 2C7IA 3TUPA 3V7SA 2ARTA 2ZNIA 1KMNA 4H2XB 4PHCA 4ZIBA 4P71C 1WLEA 2EL9A 4XU2A 3VQVA 2DZCA 2DQ0A 2EJFA 4YDQA 2Q7HA 2DZ9A 3ERRA 3MF2A 3V7RA 2ZZGA 4CS4A 3HXXA 3P8TA 3G1ZA 4P74C 5ELOA 2C8MA 3HXWA 1QE0A 2ZR2A 3HY0A 4OLFA 3IKLA 3HRIA 2DU5A 4P72C 1NJ8A 4LVKA 2ZXFA 2DEQA 4CH3A 4UP8A 2I4NA 4K88A 4X5OA 4YRJA 4CS3A 3IALA 4EO4A 1JJCA 2DU7A 2P0LA 2CJBA 1Z7MA 2ZT8A 4CH4A 3RKXA 1E22A 4YCWA 3QO7A 3A74A 4H2SA 2QHTA 2FYKA 2CGHA 2AMCA 4Q15A 1WQWA 3M4PA 3VBBA 1H4SA 3ICAA 3OD1A 4YRKA 3FJPA 3VQWA 1X54A 1PYSA 3RF1A 1EIYA 3MEYA 4XTWA 4CH5A 3QO5A 3V8JA 4RQEA 4P3OA 2RHSA 2DTIA 4ZTZB 1VQZA 4YRNA 2ZGWA 3L4GA 3P8VA 4LNSA 5KNNA 5K1XA 1Z7NA 2ZNJA 1BBUA 3A31A 2DKGA 2ALYB 4CS2A 2ODRC 3RGLA 4XTYA 2EAYA 4P75A 3VQXA 2Q7EA 4YPFA 4P73A 4YCUA 4KR2A 1ASZA 2QHUA 4LVMA 1E1OA 4YP0A 2AKWA 4TVAA 3A5YA 4Q6GA 3A32A 1H4QA 4L87A 4P3PA 1YGBA 3HFZA 3QTCA 2EJGA 3HXVA 2I4OA 5E3IA 3REXA 1X2HA 3RKWA 4KR3A 1B7YB 4O2DA 2RHQB 4DQ2A 2Q5HA 2I4LA 1IL2A 2EJ9A 3IG2A 4LVLA 2DTOA 2HNIA 4H2TA 1NYQA 4YRFA 1WNLA 4YYEA 11ASA 2I4MA 2ZCEA 5C51B 4H2XA 4RQFA 4NCXA 4HA8A 3V7CA 3MQZA 3MF1A 4HWRA 1B70B 4XU3A 1EOVA 3VQYA 3L2ZA 2DVEA 1NYRA 4PG3A 2DXTA 2EWNA 4BWAA 2ZR3A 3REUA 1HXDA 2QHSA 2XTIA 4TQDA
chains in the Genus database with same CATH topology
12ASA 2ZIOA 4G84A 3I7FA 1EVLA 4KQEA 3UGTA 1YFRA 4P3NA 4XTZA 2ARSA 3BFMA 1USYA 4UP7A 1H4VB 1E1TA 4YRGA 2E3CA 4XU0A 4LVIA 4YRPA 2ZT5A 4OP0A 4YRSA 3LSSA 1SETA 4XTVA 2IY5B 4XTUA 4WI1A 3HXYA 3NELA 1WPYA 1HC7A 4TQFA 1G51A 2ZZEA 3W3SA 3A7RA 3A7UA 1QF6A 4J15A 2PMFA 4K86A 1ADJA 1NJ6A 3HTZA 1X56A 2ZZFA 3V8KA 4P75C 2ARUA 4E51A 4TVYA 4EX5A 4P73C 2Q5IA 1EQRA 3QNEA 1GGMA 1SERA 4HWTA 3KFUA 2E64A 3A5ZA 3PCOB 1YB3A 3IKMB 3DSQA 1C0AA 2ZIMA 3TEHB 1KOGA 2ALYA 4YRIA 3E9HA 1B76A 1NJ2A 1BIBA 3RIRA 2PMEA 4YROA 2ZINA 1BBWA 1BIAA 4YCVA 4HWOA 4RMFA 4K87A 3EFSA 3LSQA 3NEMA 2XGTA 3RUXA 3BJUA 5F5WA 4P71A 5C53B 1RIQA 4XU1A 1B7YA 4YRLA 1J5WA 2RHQA 4H2WA 2P5IA 4H02A 2ODRD 4YREA 2ZT6A 4WJ4A 1YFSA 1JJCB 4TVWA 5HGQA 4P74A 3QO8A 3L1AA 3HXZA 1EVKA 4G85A 2J3LA 1G5HA 4P72A 1B70A 2G4CA 4UPAA 1B8AA 2E5AA 2AMCB 3RL6A 1HTTA 4HT4A 1USYC 2NS6A 1H4TA 3HY1A 1LYLA 3EFRA 1PYSB 3TEGA 4HVCA 1EIYB 4TWAA 1W66A 3UGQA 1NJ1A 2RHSB 1L0WA 1E24A 4HWPA 2DDZA 3L4GB 3UH0A 1SRYA 4WF2A 3LC0A 2Q7GA 1SESA 2E41A 1X01A 3RACA 4YRCA 3PZCA 1KMMA 1N9WA 4DPGA 4YRMA 2DTHA 4YRRA 4YRTA 2IY5A 4RDXA 3RKYA 1WU7A 3CMQA 1YFTA 1NNHA 2CJ9A 1X2GA 3E9IA 4LVJA 2E10A 4H2YA 3UFGA 2AKWB 4XTXA 4TVAB 2ZTGA 1WYDA 2DQ3A 3P8YA 2CJAA 2A8EA 1X55A 1NJ5A 4WJ3M 2DXUA 3HXUA 3HFZB 3NENA 4UP9A 3NETA 4XEOA 4AH6A 4HWSA 3HFVA 1WQ7A 3V8LA 4XEMA 4CH6A 1EFWA 4YRQA 3WQZA 2CIMA 2E1HA 1ADYA 4H2VA 2ZT7A 1G5IA 5C52B 3A7AA 4H2UA 1FYFA 4TTVA 3PCOA 2QHVA 1ATIA 5ELNA 4BW9A 3HRKA 3M4QA 3TEHA 4ZTUB 2DJZA 5K1PA 3R07A 1ASYA 2J3MA 2E65A 2C7IA 3TUPA 3V7SA 2ARTA 2ZNIA 1KMNA 4H2XB 4PHCA 4ZIBA 4P71C 1WLEA 2EL9A 4XU2A 3VQVA 2DZCA 2DQ0A 2EJFA 4YDQA 2Q7HA 2DZ9A 3ERRA 3MF2A 3V7RA 2ZZGA 4CS4A 3HXXA 3P8TA 3G1ZA 4P74C 5ELOA 2C8MA 3HXWA 1QE0A 2ZR2A 3HY0A 4OLFA 3IKLA 3HRIA 2DU5A 4P72C 1NJ8A 4LVKA 2ZXFA 2DEQA 4CH3A 4UP8A 2I4NA 4K88A 4X5OA 4YRJA 4CS3A 3IALA 4EO4A 1JJCA 2DU7A 2P0LA 2CJBA 1Z7MA 2ZT8A 4CH4A 3RKXA 1E22A 4YCWA 3QO7A 3A74A 4H2SA 2QHTA 2FYKA 2CGHA 2AMCA 4Q15A 1WQWA 3M4PA 3VBBA 1H4SA 3ICAA 3OD1A 4YRKA 3FJPA 3VQWA 1X54A 1PYSA 3RF1A 1EIYA 3MEYA 4XTWA 4CH5A 3QO5A 3V8JA 4RQEA 4P3OA 2RHSA 2DTIA 4ZTZB 1VQZA 4YRNA 2ZGWA 3L4GA 3P8VA 4LNSA 5KNNA 5K1XA 1Z7NA 2ZNJA 1BBUA 3A31A 2DKGA 2ALYB 4CS2A 2ODRC 3RGLA 4XTYA 2EAYA 4P75A 3VQXA 2Q7EA 4YPFA 4P73A 4YCUA 4KR2A 1ASZA 2QHUA 4LVMA 1E1OA 4YP0A 2AKWA 4TVAA 3A5YA 4Q6GA 3A32A 1H4QA 4L87A 4P3PA 1YGBA 3HFZA 3QTCA 2EJGA 3HXVA 2I4OA 5E3IA 3REXA 1X2HA 3RKWA 4KR3A 1B7YB 4O2DA 2RHQB 4DQ2A 2Q5HA 2I4LA 1IL2A 2EJ9A 3IG2A 4LVLA 2DTOA 2HNIA 4H2TA 1NYQA 4YRFA 1WNLA 4YYEA 11ASA 2I4MA 2ZCEA 5C51B 4H2XA 4RQFA 4NCXA 4HA8A 3V7CA 3MQZA 3MF1A 4HWRA 1B70B 4XU3A 1EOVA 3VQYA 3L2ZA 2DVEA 1NYRA 4PG3A 2DXTA 2EWNA 4BWAA 2ZR3A 3REUA 1HXDA 2QHSA 2XTIA 4TQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 12AS A;  2ZIO A;  4G84 A;  3I7F A;  1EVL A;  4KQE A;  3UGT A;  1YFR A;  4P3N A;  4XTZ A;  2ARS A;  3BFM A;  1USY A;  4UP7 A;  1H4V B;  1E1T A;  4YRG A;  2E3C A;  4XU0 A;  4YRP A;  2ZT5 A;  4OP0 A;  4YRS A;  3LSS A;  1SET A;  4XTV A;  2IY5 B;  4XTU A;  4WI1 A;  3HXY A;  3NEL A;  1WPY A;  1HC7 A;  4TQF A;  1G51 A;  2ZZE A;  3W3S A;  3A7R A;  3A7U A;  1QF6 A;  4J15 A;  2PMF A;  4K86 A;  1ADJ A;  1NJ6 A;  3HTZ A;  1X56 A;  2ZZF A;  3V8K A;  4P75 C;  2ARU A;  4E51 A;  4TVY A;  4EX5 A;  4P73 C;  2Q5I A;  1EQR A;  3QNE A;  1GGM A;  1SER A;  4HWT A;  3KFU A;  2E64 A;  3A5Z A;  3PCO B;  1YB3 A;  3IKM B;  3DSQ A;  1C0A A;  2ZIM A;  3TEH B;  1KOG A;  2ALY A;  4YRI A;  3E9H A;  1B76 A;  1NJ2 A;  1BIB A;  3RIR A;  2PME A;  4YRO A;  2ZIN A;  1BBW A;  1BIA A;  4YCV A;  4HWO A;  4RMF A;  4K87 A;  3EFS A;  3LSQ A;  3NEM A;  2XGT A;  3RUX A;  3BJU A;  5F5W A;  4P71 A;  5C53 B;  1RIQ A;  4XU1 A;  1B7Y A;  4YRL A;  1J5W A;  2RHQ A;  4H2W A;  2P5I A;  4H02 A;  2ODR D;  4YRE A;  2ZT6 A;  4WJ4 A;  1YFS A;  1JJC B;  4TVW A;  5HGQ A;  4P74 A;  3QO8 A;  3L1A A;  3HXZ A;  1EVK A;  4G85 A;  2J3L A;  1G5H A;  4P72 A;  1B70 A;  2G4C A;  4UPA A;  1B8A A;  2E5A A;  2AMC B;  3RL6 A;  1HTT A;  1USY C;  1H4T A;  3HY1 A;  1LYL A;  3EFR A;  1PYS B;  3TEG A;  4HVC A;  1EIY B;  4TWA A;  1W66 A;  3UGQ A;  1NJ1 A;  2RHS B;  1L0W A;  1E24 A;  4HWP A;  2DDZ A;  3L4G B;  3UH0 A;  1SRY A;  4WF2 A;  3LC0 A;  2Q7G A;  1SES A;  2E41 A;  1X01 A;  3RAC A;  4YRC A;  3PZC A;  1KMM A;  1N9W A;  4DPG A;  4YRM A;  2DTH A;  4YRR A;  4YRT A;  2IY5 A;  4RDX A;  3RKY A;  1WU7 A;  3CMQ A;  1YFT A;  1NNH A;  2CJ9 A;  1X2G A;  3E9I A;  2E10 A;  4H2Y A;  3UFG A;  2AKW B;  4XTX A;  4TVA B;  2ZTG A;  1WYD A;  2DQ3 A;  3P8Y A;  2CJA A;  1X55 A;  1NJ5 A;  4WJ3 M;  2DXU A;  3HXU A;  3HFZ B;  3NEN A;  4UP9 A;  3NET A;  4XEO A;  4AH6 A;  4HWS A;  3HFV A;  1WQ7 A;  3V8L A;  4XEM A;  4CH6 A;  1EFW A;  4YRQ A;  3WQZ A;  2CIM A;  2E1H A;  1ADY A;  4H2V A;  2ZT7 A;  1G5I A;  5C52 B;  3A7A A;  4H2U A;  1FYF A;  4TTV A;  3PCO A;  2QHV A;  1ATI A;  5ELN A;  4BW9 A;  3HRK A;  3M4Q A;  3TEH A;  4ZTU B;  2DJZ A;  5K1P A;  3R07 A;  1ASY A;  2J3M A;  2E65 A;  2C7I A;  3TUP A;  3V7S A;  2ART A;  2ZNI A;  1KMN A;  4H2X B;  4PHC A;  4ZIB A;  4P71 C;  1WLE A;  2EL9 A;  4XU2 A;  3VQV A;  2DZC A;  2DQ0 A;  2EJF A;  4YDQ A;  2Q7H A;  2DZ9 A;  3ERR A;  3MF2 A;  3V7R A;  2ZZG A;  4CS4 A;  3HXX A;  3P8T A;  3G1Z A;  4P74 C;  5ELO A;  2C8M A;  3HXW A;  1QE0 A;  2ZR2 A;  3HY0 A;  4OLF A;  3IKL A;  3HRI A;  2DU5 A;  4P72 C;  1NJ8 A;  2ZXF A;  2DEQ A;  4CH3 A;  4UP8 A;  2I4N A;  4K88 A;  4X5O A;  4YRJ A;  4CS3 A;  3IAL A;  4EO4 A;  1JJC A;  2DU7 A;  2P0L A;  2CJB A;  1Z7M A;  2ZT8 A;  4CH4 A;  3RKX A;  1E22 A;  4YCW A;  3QO7 A;  3A74 A;  4H2S A;  2QHT A;  2FYK A;  2CGH A;  2AMC A;  4Q15 A;  1WQW A;  3M4P A;  3VBB A;  1H4S A;  3ICA A;  3OD1 A;  4YRK A;  3FJP A;  3VQW A;  1X54 A;  1PYS A;  3RF1 A;  1EIY A;  3MEY A;  4XTW A;  4CH5 A;  3QO5 A;  3V8J A;  4RQE A;  4P3O A;  2RHS A;  2DTI A;  4ZTZ B;  1VQZ A;  4YRN A;  2ZGW A;  3L4G A;  3P8V A;  4LNS A;  5KNN A;  5K1X A;  1Z7N A;  2ZNJ A;  1BBU A;  3A31 A;  2DKG A;  2ALY B;  4CS2 A;  2ODR C;  3RGL A;  4XTY A;  2EAY A;  4P75 A;  3VQX A;  2Q7E A;  4YPF A;  4P73 A;  4YCU A;  4KR2 A;  1ASZ A;  2QHU A;  1E1O A;  4YP0 A;  2AKW A;  4TVA A;  3A5Y A;  4Q6G A;  3A32 A;  1H4Q A;  4L87 A;  4P3P A;  1YGB A;  3HFZ A;  3QTC A;  2EJG A;  3HXV A;  2I4O A;  5E3I A;  3REX A;  1X2H A;  3RKW A;  4KR3 A;  1B7Y B;  4O2D A;  2RHQ B;  4DQ2 A;  2Q5H A;  2I4L A;  1IL2 A;  2EJ9 A;  3IG2 A;  2DTO A;  2HNI A;  4H2T A;  1NYQ A;  4YRF A;  1WNL A;  4YYE A;  11AS A;  2I4M A;  2ZCE A;  5C51 B;  4H2X A;  4RQF A;  4NCX A;  4HA8 A;  3V7C A;  3MF1 A;  4HWR A;  1B70 B;  4XU3 A;  1EOV A;  3VQY A;  3L2Z A;  2DVE A;  1NYR A;  4PG3 A;  2DXT A;  2EWN A;  4BWA A;  2ZR3 A;  3REU A;  1HXD A;  2QHS A;  2XTI A;  4TQD A; 
#chains in the Genus database with same CATH topology
 12AS A;  2ZIO A;  4G84 A;  3I7F A;  1EVL A;  4KQE A;  3UGT A;  1YFR A;  4P3N A;  4XTZ A;  2ARS A;  3BFM A;  1USY A;  4UP7 A;  1H4V B;  1E1T A;  4YRG A;  2E3C A;  4XU0 A;  4LVI A;  4YRP A;  2ZT5 A;  4OP0 A;  4YRS A;  3LSS A;  1SET A;  4XTV A;  2IY5 B;  4XTU A;  4WI1 A;  3HXY A;  3NEL A;  1WPY A;  1HC7 A;  4TQF A;  1G51 A;  2ZZE A;  3W3S A;  3A7R A;  3A7U A;  1QF6 A;  4J15 A;  2PMF A;  4K86 A;  1ADJ A;  1NJ6 A;  3HTZ A;  1X56 A;  2ZZF A;  3V8K A;  4P75 C;  2ARU A;  4E51 A;  4TVY A;  4EX5 A;  4P73 C;  2Q5I A;  1EQR A;  3QNE A;  1GGM A;  1SER A;  4HWT A;  3KFU A;  2E64 A;  3A5Z A;  3PCO B;  1YB3 A;  3IKM B;  3DSQ A;  1C0A A;  2ZIM A;  3TEH B;  1KOG A;  2ALY A;  4YRI A;  3E9H A;  1B76 A;  1NJ2 A;  1BIB A;  3RIR A;  2PME A;  4YRO A;  2ZIN A;  1BBW A;  1BIA A;  4YCV A;  4HWO A;  4RMF A;  4K87 A;  3EFS A;  3LSQ A;  3NEM A;  2XGT A;  3RUX A;  3BJU A;  5F5W A;  4P71 A;  5C53 B;  1RIQ A;  4XU1 A;  1B7Y A;  4YRL A;  1J5W A;  2RHQ A;  4H2W A;  2P5I A;  4H02 A;  2ODR D;  4YRE A;  2ZT6 A;  4WJ4 A;  1YFS A;  1JJC B;  4TVW A;  5HGQ A;  4P74 A;  3QO8 A;  3L1A A;  3HXZ A;  1EVK A;  4G85 A;  2J3L A;  1G5H A;  4P72 A;  1B70 A;  2G4C A;  4UPA A;  1B8A A;  2E5A A;  2AMC B;  3RL6 A;  1HTT A;  4HT4 A;  1USY C;  2NS6 A;  1H4T A;  3HY1 A;  1LYL A;  3EFR A;  1PYS B;  3TEG A;  4HVC A;  1EIY B;  4TWA A;  1W66 A;  3UGQ A;  1NJ1 A;  2RHS B;  1L0W A;  1E24 A;  4HWP A;  2DDZ A;  3L4G B;  3UH0 A;  1SRY A;  4WF2 A;  3LC0 A;  2Q7G A;  1SES A;  2E41 A;  1X01 A;  3RAC A;  4YRC A;  3PZC A;  1KMM A;  1N9W A;  4DPG A;  4YRM A;  2DTH A;  4YRR A;  4YRT A;  2IY5 A;  4RDX A;  3RKY A;  1WU7 A;  3CMQ A;  1YFT A;  1NNH A;  2CJ9 A;  1X2G A;  3E9I A;  4LVJ A;  2E10 A;  4H2Y A;  3UFG A;  2AKW B;  4XTX A;  4TVA B;  2ZTG A;  1WYD A;  2DQ3 A;  3P8Y A;  2CJA A;  2A8E A;  1X55 A;  1NJ5 A;  4WJ3 M;  2DXU A;  3HXU A;  3HFZ B;  3NEN A;  4UP9 A;  3NET A;  4XEO A;  4AH6 A;  4HWS A;  3HFV A;  1WQ7 A;  3V8L A;  4XEM A;  4CH6 A;  1EFW A;  4YRQ A;  3WQZ A;  2CIM A;  2E1H A;  1ADY A;  4H2V A;  2ZT7 A;  1G5I A;  5C52 B;  3A7A A;  4H2U A;  1FYF A;  4TTV A;  3PCO A;  2QHV A;  1ATI A;  5ELN A;  4BW9 A;  3HRK A;  3M4Q A;  3TEH A;  4ZTU B;  2DJZ A;  5K1P A;  3R07 A;  1ASY A;  2J3M A;  2E65 A;  2C7I A;  3TUP A;  3V7S A;  2ART A;  2ZNI A;  1KMN A;  4H2X B;  4PHC A;  4ZIB A;  4P71 C;  1WLE A;  2EL9 A;  4XU2 A;  3VQV A;  2DZC A;  2DQ0 A;  2EJF A;  4YDQ A;  2Q7H A;  2DZ9 A;  3ERR A;  3MF2 A;  3V7R A;  2ZZG A;  4CS4 A;  3HXX A;  3P8T A;  3G1Z A;  4P74 C;  5ELO A;  2C8M A;  3HXW A;  1QE0 A;  2ZR2 A;  3HY0 A;  4OLF A;  3IKL A;  3HRI A;  2DU5 A;  4P72 C;  1NJ8 A;  4LVK A;  2ZXF A;  2DEQ A;  4CH3 A;  4UP8 A;  2I4N A;  4K88 A;  4X5O A;  4YRJ A;  4CS3 A;  3IAL A;  4EO4 A;  1JJC A;  2DU7 A;  2P0L A;  2CJB A;  1Z7M A;  2ZT8 A;  4CH4 A;  3RKX A;  1E22 A;  4YCW A;  3QO7 A;  3A74 A;  4H2S A;  2QHT A;  2FYK A;  2CGH A;  2AMC A;  4Q15 A;  1WQW A;  3M4P A;  3VBB A;  1H4S A;  3ICA A;  3OD1 A;  4YRK A;  3FJP A;  3VQW A;  1X54 A;  1PYS A;  3RF1 A;  1EIY A;  3MEY A;  4XTW A;  4CH5 A;  3QO5 A;  3V8J A;  4RQE A;  4P3O A;  2RHS A;  2DTI A;  4ZTZ B;  1VQZ A;  4YRN A;  2ZGW A;  3L4G A;  3P8V A;  4LNS A;  5KNN A;  5K1X A;  1Z7N A;  2ZNJ A;  1BBU A;  3A31 A;  2DKG A;  2ALY B;  4CS2 A;  2ODR C;  3RGL A;  4XTY A;  2EAY A;  4P75 A;  3VQX A;  2Q7E A;  4YPF A;  4P73 A;  4YCU A;  4KR2 A;  1ASZ A;  2QHU A;  4LVM A;  1E1O A;  4YP0 A;  2AKW A;  4TVA A;  3A5Y A;  4Q6G A;  3A32 A;  1H4Q A;  4L87 A;  4P3P A;  1YGB A;  3HFZ A;  3QTC A;  2EJG A;  3HXV A;  2I4O A;  5E3I A;  3REX A;  1X2H A;  3RKW A;  4KR3 A;  1B7Y B;  4O2D A;  2RHQ B;  4DQ2 A;  2Q5H A;  2I4L A;  1IL2 A;  2EJ9 A;  3IG2 A;  4LVL A;  2DTO A;  2HNI A;  4H2T A;  1NYQ A;  4YRF A;  1WNL A;  4YYE A;  11AS A;  2I4M A;  2ZCE A;  5C51 B;  4H2X A;  4RQF A;  4NCX A;  4HA8 A;  3V7C A;  3MQZ A;  3MF1 A;  4HWR A;  1B70 B;  4XU3 A;  1EOV A;  3VQY A;  3L2Z A;  2DVE A;  1NYR A;  4PG3 A;  2DXT A;  2EWN A;  4BWA A;  2ZR3 A;  3REU A;  1HXD A;  2QHS A;  2XTI A;  4TQD A; 
#chains in the Genus database with same CATH homology
 12AS A;  2ZIO A;  4G84 A;  3I7F A;  1EVL A;  4KQE A;  3UGT A;  1YFR A;  4P3N A;  4XTZ A;  2ARS A;  3BFM A;  1USY A;  4UP7 A;  1H4V B;  1E1T A;  4YRG A;  2E3C A;  4XU0 A;  4LVI A;  4YRP A;  2ZT5 A;  4OP0 A;  4YRS A;  3LSS A;  1SET A;  4XTV A;  2IY5 B;  4XTU A;  4WI1 A;  3HXY A;  3NEL A;  1WPY A;  1HC7 A;  4TQF A;  1G51 A;  2ZZE A;  3W3S A;  3A7R A;  3A7U A;  1QF6 A;  4J15 A;  2PMF A;  4K86 A;  1ADJ A;  1NJ6 A;  3HTZ A;  1X56 A;  2ZZF A;  3V8K A;  4P75 C;  2ARU A;  4E51 A;  4TVY A;  4EX5 A;  4P73 C;  2Q5I A;  1EQR A;  3QNE A;  1GGM A;  1SER A;  4HWT A;  3KFU A;  2E64 A;  3A5Z A;  3PCO B;  1YB3 A;  3IKM B;  3DSQ A;  1C0A A;  2ZIM A;  3TEH B;  1KOG A;  2ALY A;  4YRI A;  3E9H A;  1B76 A;  1NJ2 A;  1BIB A;  3RIR A;  2PME A;  4YRO A;  2ZIN A;  1BBW A;  1BIA A;  4YCV A;  4HWO A;  4RMF A;  4K87 A;  3EFS A;  3LSQ A;  3NEM A;  2XGT A;  3RUX A;  3BJU A;  5F5W A;  4P71 A;  5C53 B;  1RIQ A;  4XU1 A;  1B7Y A;  4YRL A;  1J5W A;  2RHQ A;  4H2W A;  2P5I A;  4H02 A;  2ODR D;  4YRE A;  2ZT6 A;  4WJ4 A;  1YFS A;  1JJC B;  4TVW A;  5HGQ A;  4P74 A;  3QO8 A;  3L1A A;  3HXZ A;  1EVK A;  4G85 A;  2J3L A;  1G5H A;  4P72 A;  1B70 A;  2G4C A;  4UPA A;  1B8A A;  2E5A A;  2AMC B;  3RL6 A;  1HTT A;  4HT4 A;  1USY C;  2NS6 A;  1H4T A;  3HY1 A;  1LYL A;  3EFR A;  1PYS B;  3TEG A;  4HVC A;  1EIY B;  4TWA A;  1W66 A;  3UGQ A;  1NJ1 A;  2RHS B;  1L0W A;  1E24 A;  4HWP A;  2DDZ A;  3L4G B;  3UH0 A;  1SRY A;  4WF2 A;  3LC0 A;  2Q7G A;  1SES A;  2E41 A;  1X01 A;  3RAC A;  4YRC A;  3PZC A;  1KMM A;  1N9W A;  4DPG A;  4YRM A;  2DTH A;  4YRR A;  4YRT A;  2IY5 A;  4RDX A;  3RKY A;  1WU7 A;  3CMQ A;  1YFT A;  1NNH A;  2CJ9 A;  1X2G A;  3E9I A;  4LVJ A;  2E10 A;  4H2Y A;  3UFG A;  2AKW B;  4XTX A;  4TVA B;  2ZTG A;  1WYD A;  2DQ3 A;  3P8Y A;  2CJA A;  2A8E A;  1X55 A;  1NJ5 A;  4WJ3 M;  2DXU A;  3HXU A;  3HFZ B;  3NEN A;  4UP9 A;  3NET A;  4XEO A;  4AH6 A;  4HWS A;  3HFV A;  1WQ7 A;  3V8L A;  4XEM A;  4CH6 A;  1EFW A;  4YRQ A;  3WQZ A;  2CIM A;  2E1H A;  1ADY A;  4H2V A;  2ZT7 A;  1G5I A;  5C52 B;  3A7A A;  4H2U A;  1FYF A;  4TTV A;  3PCO A;  2QHV A;  1ATI A;  5ELN A;  4BW9 A;  3HRK A;  3M4Q A;  3TEH A;  4ZTU B;  2DJZ A;  5K1P A;  3R07 A;  1ASY A;  2J3M A;  2E65 A;  2C7I A;  3TUP A;  3V7S A;  2ART A;  2ZNI A;  1KMN A;  4H2X B;  4PHC A;  4ZIB A;  4P71 C;  1WLE A;  2EL9 A;  4XU2 A;  3VQV A;  2DZC A;  2DQ0 A;  2EJF A;  4YDQ A;  2Q7H A;  2DZ9 A;  3ERR A;  3MF2 A;  3V7R A;  2ZZG A;  4CS4 A;  3HXX A;  3P8T A;  3G1Z A;  4P74 C;  5ELO A;  2C8M A;  3HXW A;  1QE0 A;  2ZR2 A;  3HY0 A;  4OLF A;  3IKL A;  3HRI A;  2DU5 A;  4P72 C;  1NJ8 A;  4LVK A;  2ZXF A;  2DEQ A;  4CH3 A;  4UP8 A;  2I4N A;  4K88 A;  4X5O A;  4YRJ A;  4CS3 A;  3IAL A;  4EO4 A;  1JJC A;  2DU7 A;  2P0L A;  2CJB A;  1Z7M A;  2ZT8 A;  4CH4 A;  3RKX A;  1E22 A;  4YCW A;  3QO7 A;  3A74 A;  4H2S A;  2QHT A;  2FYK A;  2CGH A;  2AMC A;  4Q15 A;  1WQW A;  3M4P A;  3VBB A;  1H4S A;  3ICA A;  3OD1 A;  4YRK A;  3FJP A;  3VQW A;  1X54 A;  1PYS A;  3RF1 A;  1EIY A;  3MEY A;  4XTW A;  4CH5 A;  3QO5 A;  3V8J A;  4RQE A;  4P3O A;  2RHS A;  2DTI A;  4ZTZ B;  1VQZ A;  4YRN A;  2ZGW A;  3L4G A;  3P8V A;  4LNS A;  5KNN A;  5K1X A;  1Z7N A;  2ZNJ A;  1BBU A;  3A31 A;  2DKG A;  2ALY B;  4CS2 A;  2ODR C;  3RGL A;  4XTY A;  2EAY A;  4P75 A;  3VQX A;  2Q7E A;  4YPF A;  4P73 A;  4YCU A;  4KR2 A;  1ASZ A;  2QHU A;  4LVM A;  1E1O A;  4YP0 A;  2AKW A;  4TVA A;  3A5Y A;  4Q6G A;  3A32 A;  1H4Q A;  4L87 A;  4P3P A;  1YGB A;  3HFZ A;  3QTC A;  2EJG A;  3HXV A;  2I4O A;  5E3I A;  3REX A;  1X2H A;  3RKW A;  4KR3 A;  1B7Y B;  4O2D A;  2RHQ B;  4DQ2 A;  2Q5H A;  2I4L A;  1IL2 A;  2EJ9 A;  3IG2 A;  4LVL A;  2DTO A;  2HNI A;  4H2T A;  1NYQ A;  4YRF A;  1WNL A;  4YYE A;  11AS A;  2I4M A;  2ZCE A;  5C51 B;  4H2X A;  4RQF A;  4NCX A;  4HA8 A;  3V7C A;  3MQZ A;  3MF1 A;  4HWR A;  1B70 B;  4XU3 A;  1EOV A;  3VQY A;  3L2Z A;  2DVE A;  1NYR A;  4PG3 A;  2DXT A;  2EWN A;  4BWA A;  2ZR3 A;  3REU A;  1HXD A;  2QHS A;  2XTI A;  4TQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...