2DEOA

1510-n membrane protease specific for a stomatin homolog from pyrococcus horikoshii
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
217
structure length
199
Chain Sequence
AKNIVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDTPGGRADAMMNIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAMAPGTSIGACRTNYFIAYIKSLAQESGRNATIAEEFITKDLSLTPEEALKYGVIEVVARDINELLKKSNGMKTKIPVNGRYVTLNFTNVEVRYLAPSFKDKLISYITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Structure of a Novel Membrane Protease Specific for a Stomatin Homolog from the Hyperthermophilic Archaeon Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords 441aa long hypothetical nfeD protein
total genus 61
structure length 199
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2deoA00
1Q52A 3T88A 3I47A 1O8UA 3H0JA 4F47A 3IAVA 1XX4A 2CE3A 4JYJA 3ZWCA 1XNYA 2ZQRA 5FIFA 3M6MA 2PG8A 4JCTA 5DU6A 4U19A 4JWVA 1WZ8A 4ASIA 3P2LA 3G64A 1RJNA 1XO6A 2VREA 4QFEA 3KTKA 3H02A 4L8KA 2Q2XA 1K39A 2F6QA 2ZL0A 4U0HA 2VSUC 5INGA 5JBXA 4JSBA 3P85A 3V5IA 1EF9A 4JCRA 3NJDA 2J5IA 4JFCA 3SWXA 2FZSA 3L3SA 1Q51A 5C9GA 3VIVA 5G1SA 4G2RA 4HC8A 1ON9A 2UZFA 3QXZA 3MFMA 3QKAA 3MOYA 3KTJA 1RJMA 4I42A 4OMRA 4MOUA 4OG1A 3TVUA 4Q0GA 5DUFA 1OD4A 1Y7OA 3TT6A 2ZL2A 3HRXA 5INIA 4EMPA 4K29A 3H0QA 2VSSA 4FN7A 2PBPA 4ZDDA 3GKBA 4IZDA 2F9YA 4RYFA 2FW2A 4U0GH 4B3IA 3PZKA 4ELSA 5KDRB 3QYRA 2F9IB 5DKPA 2ZL4A 1W2XA 4FZWA 4Q1IA 3TZ3A 1N6DA 1FC7A 4WCZA 3QWDA 4DI1A 2X58A 5DTWA 3MYBA 3PE8A 1HNUA 3R9QA 4IZBA 5FUSA 5INFA 4IZCA 1DUBA 1WDMA 2VSUA 2J5II 4MXIA 3ZW8A 5E0NX 1EF8A 1FC6A 5KJPA 3T8BA 5DU4A 3GMAA 1YG6A 3P5MA 3U9TB 5JBWA 1JXZA 2F6IA 3TRRA 5CTBA 3GLMA 2ZL3A 3BF0A 1FCFA 4JJTA 1YG8A 2VSUF 3R6HA 4WZ8B 2X24A 3U9RB 3FDUA 3OT6A 5E0SA 1HNOA 3ZW9A 5IKLB 1SG4A 4JOTA 1UIYA 3HE2A 2WTBA 1MJ3A 3M6NA 4U1AA 5KDRA 4FNDA 1VRGA 5C90A 3ST9A 4K3WA 4KPKA 1K32A 3H0UA 4QIIA 5G1RA 3U9SB 2VX2A 1PJHA 2J5GA 2VSUE 1TYFA 3FF6A 1UYSA 3ISAA 4JCSA 3TVWA 3QREA 3GF7A 2J5GD 3TT7A 2VSSF 2A81A 4ELXA 2J5SA 3T89A 3N6RB 2EJ5A 3STAA 3DJAA 4KNPA 1J7XA 2A7SA 4I4ZA 2NP9A 4MI2A 4RCNA 5DZKH 1TG6A 3ZWAA 4HNKA 2Q34A 1HZDA 1WDKA 3Q0JA 3DORA 2IEXA 2QQ3A 3TLFA 3IBBA 2J5IB 3H0SA 3KTGA 3T8AA 3RSIA 1N6EA 3T3WA 1ON3A 3HP0A 4B3JA 1OD2A 3K8XA 3QMJA 4FNBA 4U0GA 3JU1A 5DU8A 4GHNA 5DTPA 4ELWA 2FBMA 4I52A 4K2NA 2DUBA 4B3HA 3TDCA 5DL1A 4YLHA 2ZQQA 4KWBA 5DUCA 5DZKA 1N6FA 4RYFH 4U18A 4EMMA 3WG5A 4NEKA 3QXIA 1FC9A 2D3TA 4FN8A 3SLLA 3Q1TA 2GTRA 2F9YB 1UYTA 4NNQA 2CBYA 2BZRA 4QIJA 3RSTA 2DEOA 4ZU2A 3OC7A 5G1QA 3MT6A 5MGBA 3NJBA 3LKEA 3PEAA 3H81A 4ZDFA 4FB8A 1WDLA 4EMLA 3Q0GA 3V5EA 3HINA 1XNWA 4OLQA 1EY3A 2VSSE 3R9TA 3LAOA 4ZDBA 1UYRA 3K50A 1UYVA 3TV5A 3IB9A 4Z0MA 1NZYA 2F9IA 3KTHA 4JYLA 1NZYB 2A7KA 2Q35A 4ZDEA 3BPPA 1PIXA 1DCIA 3Q7HA 4L6WA 2PPYA 1XNVA 2C8TA 3OMEA 2HW5A 3KTIA 5CTCA 3BEZA 4ZDCA 3ZWBA 3R9SA 4FZWC 4LK5A 2W3PA 3KQFA 4JCQA 4GM2A 3GF3A 4WYOB 3QK8A 3RRVA 1SZOA 1X0UA 4FJWD 5E0SH 3HLN1 3R0OA 4JVTA 3PGQA 4KD6A
chains in the Genus database with same CATH superfamily
1Q52A 3T88A 3I47A 1O8UA 3H0JA 4F47A 3IAVA 1XX4A 2CE3A 4JYJA 3ZWCA 1XNYA 2ZQRA 5FIFA 3M6MA 2PG8A 4JCTA 5DU6A 4U19A 4JWVA 1WZ8A 4HDTA 4ASIA 3P2LA 3G64A 1RJNA 1XO6A 2VREA 4QFEA 3KTKA 3H02A 4L8KA 2Q2XA 1K39A 2F6QA 2ZL0A 4U0HA 2VSUC 5INGA 5JBXA 4JSBA 3P85A 3V5IA 1EF9A 4JCRA 3NJDA 2J5IA 4JFCA 3SWXA 2FZSA 3L3SA 1Q51A 5C9GA 4J2UA 3VIVA 5G1SA 4G2RA 4HC8A 1ON9A 2UZFA 3QXZA 3MFMA 3QKAA 3MOYA 3KTJA 1RJMA 4I42A 5HUQA 4OMRA 4MOUA 4OG1A 3TVUA 4Q0GA 5DUFA 1OD4A 1Y7OA 3TT6A 2ZL2A 3HRXA 5INIA 4EMPA 4K29A 3H0QA 2VSSA 4FN7A 2PBPA 4ZDDA 3GKBA 4IZDA 2F9YA 4RYFA 2FW2A 4U0GH 4B3IA 3PZKA 4ELSA 5KDRB 3QYRA 2F9IB 5DKPA 2ZL4A 1W2XA 4FZWA 4Q1IA 4NARA 3TZ3A 1N6DA 1FC7A 4WCZA 3QWDA 4DI1A 2X58A 5DTWA 3MYBA 3PE8A 1HNUA 3R9QA 4IZBA 5FUSA 5INFA 4IZCA 1DUBA 1WDMA 2VSUA 2J5II 4MXIA 3ZW8A 5E0NX 1EF8A 1FC6A 3T8BA 5DU4A 5KJPA 3GMAA 1YG6A 3P5MA 3U9TB 5JBWA 1JXZA 2F6IA 3TRRA 5CTBA 3GLMA 2ZL3A 3BF0A 1FCFA 4JJTA 1YG8A 2VSUF 3R6HA 4WZ8B 2X24A 3U9RB 3FDUA 3OT6A 5E0SA 1HNOA 3ZW9A 5IKLB 1SG4A 2YJGA 4JOTA 1UIYA 3HE2A 2WTBA 1MJ3A 3M6NA 4U1AA 5KDRA 4FNDA 1VRGA 5C90A 3ST9A 4K3WA 4KPKA 1K32A 3H0UA 4QIIA 5G1RA 3U9SB 2VX2A 1PJHA 2J5GA 2VSUE 1TYFA 3FF6A 1UYSA 3ISAA 4JCSA 3TVWA 3QREA 3GF7A 2J5GD 3TT7A 2VSSF 2A81A 4ELXA 2J5SA 3T89A 3N6RB 2EJ5A 3STAA 3DJAA 4KNPA 1J7XA 2A7SA 4I4ZA 2NP9A 4MI2A 4RCNA 5DZKH 1TG6A 3ZWAA 4HNKA 2Q34A 1HZDA 1WDKA 3Q0JA 3DORA 2IEXA 2QQ3A 3TLFA 3IBBA 2J5IB 3H0SA 3BPTA 3KTGA 3T8AA 3RSIA 1N6EA 3T3WA 1ON3A 3HP0A 4B3JA 1OD2A 3K8XA 3QMJA 4FNBA 4U0GA 3JU1A 5DU8A 4GHNA 5DTPA 4ELWA 2FBMA 4I52A 4K2NA 2DUBA 4B3HA 3TDCA 5DL1A 4YLHA 2ZQQA 4KWBA 5DUCA 5DZKA 1N6FA 4RYFH 4U18A 4EMMA 3WG5A 4NEKA 3QXIA 1FC9A 2D3TA 4FN8A 3SLLA 3Q1TA 2GTRA 2F9YB 1UYTA 4NNQA 2CBYA 2BZRA 4QIJA 3RSTA 2DEOA 4ZU2A 3OC7A 5G1QA 3MT6A 5MGBA 3NJBA 3LKEA 3PEAA 3H81A 4ZDFA 4FB8A 1WDLA 4EMLA 3Q0GA 3V5EA 3HINA 1XNWA 4OLQA 1EY3A 2VSSE 3R9TA 3LAOA 4ZDBA 1UYRA 3K50A 1UYVA 3TV5A 3IB9A 4Z0MA 1NZYA 2F9IA 3KTHA 4JYLA 1NZYB 2A7KA 2Q35A 4ZDEA 3BPPA 1PIXA 1DCIA 3Q7HA 4L6WA 2PPYA 1XNVA 2C8TA 3OMEA 2HW5A 3KTIA 5CTCA 3BEZA 4ZDCA 3ZWBA 3R9SA 4FZWC 4LK5A 2W3PA 3KQFA 4JCQA 4GM2A 3GF3A 4WYOB 3QK8A 3RRVA 1SZOA 1X0UA 4FJWD 5E0SH 3HLN1 3R0OA 4JVTA 3PGQA 4KD6A
chains in the Genus database with same CATH topology
1Q52A 3T88A 3I47A 1O8UA 3H0JA 4F47A 3IAVA 1XX4A 2CE3A 4JYJA 3ZWCA 1XNYA 2ZQRA 5FIFA 3M6MA 2PG8A 4JCTA 5DU6A 4U19A 4JWVA 1WZ8A 4HDTA 4ASIA 3P2LA 3G64A 1RJNA 1XO6A 2VREA 4QFEA 3KTKA 3H02A 4L8KA 2Q2XA 1K39A 2F6QA 2ZL0A 4U0HA 2VSUC 5INGA 5JBXA 4JSBA 3P85A 3V5IA 1EF9A 4JCRA 3NJDA 2J5IA 4JFCA 3SWXA 2FZSA 3L3SA 1Q51A 5C9GA 4J2UA 3VIVA 5G1SA 4G2RA 4HC8A 1ON9A 2UZFA 3QXZA 3MFMA 3QKAA 3MOYA 3KTJA 1RJMA 4I42A 5HUQA 4OMRA 4MOUA 4OG1A 3TVUA 4Q0GA 5DUFA 1OD4A 1Y7OA 3TT6A 2ZL2A 3HRXA 5INIA 4EMPA 4K29A 3H0QA 2VSSA 4FN7A 2PBPA 4ZDDA 3GKBA 4IZDA 2F9YA 4RYFA 2FW2A 4U0GH 4B3IA 3PZKA 4ELSA 5KDRB 3QYRA 2F9IB 5DKPA 2ZL4A 1W2XA 4FZWA 4Q1IA 4NARA 3TZ3A 1N6DA 1FC7A 4WCZA 3QWDA 4DI1A 2X58A 5DTWA 3MYBA 3PE8A 1HNUA 3R9QA 4IZBA 5FUSA 5INFA 4IZCA 1DUBA 1WDMA 2VSUA 2J5II 4MXIA 3ZW8A 5E0NX 1EF8A 1FC6A 3T8BA 5DU4A 5KJPA 3GMAA 1YG6A 3P5MA 3U9TB 5JBWA 1JXZA 2F6IA 3TRRA 5CTBA 3GLMA 2ZL3A 3BF0A 1FCFA 4JJTA 1YG8A 2VSUF 3R6HA 4WZ8B 2X24A 3U9RB 3FDUA 3OT6A 5E0SA 1HNOA 3ZW9A 5IKLB 1SG4A 2YJGA 4JOTA 1UIYA 3HE2A 2WTBA 1MJ3A 3M6NA 4U1AA 5KDRA 4FNDA 1VRGA 5C90A 3ST9A 4K3WA 4KPKA 1K32A 3H0UA 4QIIA 5G1RA 3U9SB 2VX2A 1PJHA 2J5GA 2VSUE 1TYFA 3FF6A 1UYSA 3ISAA 4JCSA 3TVWA 3QREA 3GF7A 2J5GD 3TT7A 2VSSF 2A81A 4ELXA 2J5SA 3T89A 3N6RB 2EJ5A 3STAA 3DJAA 4KNPA 1J7XA 2A7SA 4I4ZA 2NP9A 4MI2A 4RCNA 5DZKH 1TG6A 3ZWAA 4HNKA 2Q34A 1HZDA 1WDKA 3Q0JA 3DORA 2IEXA 2QQ3A 3TLFA 3IBBA 2J5IB 3H0SA 3BPTA 3KTGA 3T8AA 3RSIA 1N6EA 3T3WA 1ON3A 3HP0A 4B3JA 1OD2A 3K8XA 3QMJA 4FNBA 4U0GA 3JU1A 5DU8A 4GHNA 5DTPA 4ELWA 2FBMA 4I52A 4K2NA 2DUBA 4B3HA 3TDCA 5DL1A 4YLHA 2ZQQA 4KWBA 5DUCA 5DZKA 1N6FA 4RYFH 4U18A 4EMMA 3WG5A 4NEKA 3QXIA 1FC9A 2D3TA 4FN8A 3SLLA 3Q1TA 2GTRA 2F9YB 1UYTA 4NNQA 2CBYA 2BZRA 4QIJA 3RSTA 2DEOA 4ZU2A 3OC7A 5G1QA 3MT6A 5MGBA 3NJBA 3LKEA 3PEAA 3H81A 4ZDFA 4FB8A 1WDLA 4EMLA 3Q0GA 3V5EA 3HINA 1XNWA 4OLQA 1EY3A 2VSSE 3R9TA 3LAOA 4ZDBA 1UYRA 3K50A 1UYVA 3TV5A 3IB9A 4Z0MA 1NZYA 2F9IA 3KTHA 4JYLA 1NZYB 2A7KA 2Q35A 4ZDEA 3BPPA 1PIXA 1DCIA 3Q7HA 4L6WA 2PPYA 1XNVA 2C8TA 3OMEA 2HW5A 3KTIA 5CTCA 3BEZA 4ZDCA 3ZWBA 3R9SA 4FZWC 4LK5A 2W3PA 3KQFA 4JCQA 4GM2A 3GF3A 4WYOB 3QK8A 3RRVA 1SZOA 1X0UA 4FJWD 5E0SH 3HLN1 3R0OA 4JVTA 3PGQA 4KD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q52 A;  3T88 A;  3I47 A;  1O8U A;  3H0J A;  4F47 A;  3IAV A;  1XX4 A;  2CE3 A;  4JYJ A;  3ZWC A;  1XNY A;  2ZQR A;  5FIF A;  3M6M A;  2PG8 A;  4JCT A;  5DU6 A;  4U19 A;  4JWV A;  1WZ8 A;  4ASI A;  3P2L A;  3G64 A;  1RJN A;  1XO6 A;  2VRE A;  4QFE A;  3KTK A;  3H02 A;  4L8K A;  2Q2X A;  1K39 A;  2F6Q A;  2ZL0 A;  4U0H A;  2VSU C;  5ING A;  5JBX A;  4JSB A;  3P85 A;  3V5I A;  1EF9 A;  4JCR A;  3NJD A;  2J5I A;  4JFC A;  3SWX A;  2FZS A;  3L3S A;  1Q51 A;  5C9G A;  3VIV A;  5G1S A;  4G2R A;  4HC8 A;  1ON9 A;  2UZF A;  3QXZ A;  3MFM A;  3QKA A;  3MOY A;  3KTJ A;  1RJM A;  4I42 A;  4OMR A;  4MOU A;  4OG1 A;  3TVU A;  4Q0G A;  5DUF A;  1OD4 A;  1Y7O A;  3TT6 A;  2ZL2 A;  3HRX A;  5INI A;  4EMP A;  4K29 A;  3H0Q A;  2VSS A;  4FN7 A;  2PBP A;  4ZDD A;  3GKB A;  4IZD A;  2F9Y A;  4RYF A;  2FW2 A;  4U0G H;  4B3I A;  3PZK A;  4ELS A;  5KDR B;  3QYR A;  2F9I B;  5DKP A;  2ZL4 A;  1W2X A;  4FZW A;  4Q1I A;  3TZ3 A;  1N6D A;  1FC7 A;  4WCZ A;  3QWD A;  4DI1 A;  2X58 A;  5DTW A;  3MYB A;  3PE8 A;  1HNU A;  3R9Q A;  4IZB A;  5FUS A;  5INF A;  4IZC A;  1DUB A;  1WDM A;  2VSU A;  2J5I I;  4MXI A;  3ZW8 A;  5E0N X;  1EF8 A;  1FC6 A;  5KJP A;  3T8B A;  5DU4 A;  3GMA A;  1YG6 A;  3P5M A;  3U9T B;  5JBW A;  1JXZ A;  2F6I A;  3TRR A;  5CTB A;  3GLM A;  2ZL3 A;  3BF0 A;  1FCF A;  4JJT A;  1YG8 A;  2VSU F;  3R6H A;  4WZ8 B;  2X24 A;  3U9R B;  3FDU A;  3OT6 A;  5E0S A;  1HNO A;  3ZW9 A;  5IKL B;  1SG4 A;  4JOT A;  1UIY A;  3HE2 A;  2WTB A;  1MJ3 A;  3M6N A;  4U1A A;  5KDR A;  4FND A;  1VRG A;  5C90 A;  3ST9 A;  4K3W A;  4KPK A;  1K32 A;  3H0U A;  4QII A;  5G1R A;  3U9S B;  2VX2 A;  1PJH A;  2J5G A;  2VSU E;  1TYF A;  3FF6 A;  1UYS A;  3ISA A;  4JCS A;  3TVW A;  3QRE A;  3GF7 A;  2J5G D;  3TT7 A;  2VSS F;  2A81 A;  4ELX A;  2J5S A;  3T89 A;  3N6R B;  2EJ5 A;  3STA A;  3DJA A;  4KNP A;  1J7X A;  2A7S A;  4I4Z A;  2NP9 A;  4MI2 A;  4RCN A;  5DZK H;  1TG6 A;  3ZWA A;  4HNK A;  2Q34 A;  1HZD A;  1WDK A;  3Q0J A;  3DOR A;  2IEX A;  2QQ3 A;  3TLF A;  3IBB A;  2J5I B;  3H0S A;  3KTG A;  3T8A A;  3RSI A;  1N6E A;  3T3W A;  1ON3 A;  3HP0 A;  4B3J A;  1OD2 A;  3K8X A;  3QMJ A;  4FNB A;  4U0G A;  3JU1 A;  5DU8 A;  4GHN A;  5DTP A;  4ELW A;  2FBM A;  4I52 A;  4K2N A;  2DUB A;  4B3H A;  3TDC A;  5DL1 A;  4YLH A;  2ZQQ A;  4KWB A;  5DUC A;  5DZK A;  1N6F A;  4RYF H;  4U18 A;  4EMM A;  3WG5 A;  4NEK A;  3QXI A;  1FC9 A;  2D3T A;  4FN8 A;  3SLL A;  3Q1T A;  2GTR A;  2F9Y B;  1UYT A;  4NNQ A;  2CBY A;  2BZR A;  4QIJ A;  3RST A;  2DEO A;  4ZU2 A;  3OC7 A;  5G1Q A;  3MT6 A;  5MGB A;  3NJB A;  3LKE A;  3PEA A;  3H81 A;  4ZDF A;  4FB8 A;  1WDL A;  4EML A;  3Q0G A;  3V5E A;  3HIN A;  1XNW A;  4OLQ A;  1EY3 A;  2VSS E;  3R9T A;  3LAO A;  4ZDB A;  1UYR A;  3K50 A;  1UYV A;  3TV5 A;  3IB9 A;  4Z0M A;  1NZY A;  2F9I A;  3KTH A;  4JYL A;  1NZY B;  2A7K A;  2Q35 A;  4ZDE A;  3BPP A;  1PIX A;  1DCI A;  3Q7H A;  4L6W A;  2PPY A;  1XNV A;  2C8T A;  3OME A;  2HW5 A;  3KTI A;  5CTC A;  3BEZ A;  4ZDC A;  3ZWB A;  3R9S A;  4FZW C;  4LK5 A;  2W3P A;  3KQF A;  4JCQ A;  4GM2 A;  3GF3 A;  4WYO B;  3QK8 A;  3RRV A;  1SZO A;  1X0U A;  4FJW D;  5E0S H;  3HLN 1;  3R0O A;  4JVT A;  3PGQ A;  4KD6 A; 
#chains in the Genus database with same CATH topology
 1Q52 A;  3T88 A;  3I47 A;  1O8U A;  3H0J A;  4F47 A;  3IAV A;  1XX4 A;  2CE3 A;  4JYJ A;  3ZWC A;  1XNY A;  2ZQR A;  5FIF A;  3M6M A;  2PG8 A;  4JCT A;  5DU6 A;  4U19 A;  4JWV A;  1WZ8 A;  4HDT A;  4ASI A;  3P2L A;  3G64 A;  1RJN A;  1XO6 A;  2VRE A;  4QFE A;  3KTK A;  3H02 A;  4L8K A;  2Q2X A;  1K39 A;  2F6Q A;  2ZL0 A;  4U0H A;  2VSU C;  5ING A;  5JBX A;  4JSB A;  3P85 A;  3V5I A;  1EF9 A;  4JCR A;  3NJD A;  2J5I A;  4JFC A;  3SWX A;  2FZS A;  3L3S A;  1Q51 A;  5C9G A;  4J2U A;  3VIV A;  5G1S A;  4G2R A;  4HC8 A;  1ON9 A;  2UZF A;  3QXZ A;  3MFM A;  3QKA A;  3MOY A;  3KTJ A;  1RJM A;  4I42 A;  5HUQ A;  4OMR A;  4MOU A;  4OG1 A;  3TVU A;  4Q0G A;  5DUF A;  1OD4 A;  1Y7O A;  3TT6 A;  2ZL2 A;  3HRX A;  5INI A;  4EMP A;  4K29 A;  3H0Q A;  2VSS A;  4FN7 A;  2PBP A;  4ZDD A;  3GKB A;  4IZD A;  2F9Y A;  4RYF A;  2FW2 A;  4U0G H;  4B3I A;  3PZK A;  4ELS A;  5KDR B;  3QYR A;  2F9I B;  5DKP A;  2ZL4 A;  1W2X A;  4FZW A;  4Q1I A;  4NAR A;  3TZ3 A;  1N6D A;  1FC7 A;  4WCZ A;  3QWD A;  4DI1 A;  2X58 A;  5DTW A;  3MYB A;  3PE8 A;  1HNU A;  3R9Q A;  4IZB A;  5FUS A;  5INF A;  4IZC A;  1DUB A;  1WDM A;  2VSU A;  2J5I I;  4MXI A;  3ZW8 A;  5E0N X;  1EF8 A;  1FC6 A;  3T8B A;  5DU4 A;  5KJP A;  3GMA A;  1YG6 A;  3P5M A;  3U9T B;  5JBW A;  1JXZ A;  2F6I A;  3TRR A;  5CTB A;  3GLM A;  2ZL3 A;  3BF0 A;  1FCF A;  4JJT A;  1YG8 A;  2VSU F;  3R6H A;  4WZ8 B;  2X24 A;  3U9R B;  3FDU A;  3OT6 A;  5E0S A;  1HNO A;  3ZW9 A;  5IKL B;  1SG4 A;  2YJG A;  4JOT A;  1UIY A;  3HE2 A;  2WTB A;  1MJ3 A;  3M6N A;  4U1A A;  5KDR A;  4FND A;  1VRG A;  5C90 A;  3ST9 A;  4K3W A;  4KPK A;  1K32 A;  3H0U A;  4QII A;  5G1R A;  3U9S B;  2VX2 A;  1PJH A;  2J5G A;  2VSU E;  1TYF A;  3FF6 A;  1UYS A;  3ISA A;  4JCS A;  3TVW A;  3QRE A;  3GF7 A;  2J5G D;  3TT7 A;  2VSS F;  2A81 A;  4ELX A;  2J5S A;  3T89 A;  3N6R B;  2EJ5 A;  3STA A;  3DJA A;  4KNP A;  1J7X A;  2A7S A;  4I4Z A;  2NP9 A;  4MI2 A;  4RCN A;  5DZK H;  1TG6 A;  3ZWA A;  4HNK A;  2Q34 A;  1HZD A;  1WDK A;  3Q0J A;  3DOR A;  2IEX A;  2QQ3 A;  3TLF A;  3IBB A;  2J5I B;  3H0S A;  3BPT A;  3KTG A;  3T8A A;  3RSI A;  1N6E A;  3T3W A;  1ON3 A;  3HP0 A;  4B3J A;  1OD2 A;  3K8X A;  3QMJ A;  4FNB A;  4U0G A;  3JU1 A;  5DU8 A;  4GHN A;  5DTP A;  4ELW A;  2FBM A;  4I52 A;  4K2N A;  2DUB A;  4B3H A;  3TDC A;  5DL1 A;  4YLH A;  2ZQQ A;  4KWB A;  5DUC A;  5DZK A;  1N6F A;  4RYF H;  4U18 A;  4EMM A;  3WG5 A;  4NEK A;  3QXI A;  1FC9 A;  2D3T A;  4FN8 A;  3SLL A;  3Q1T A;  2GTR A;  2F9Y B;  1UYT A;  4NNQ A;  2CBY A;  2BZR A;  4QIJ A;  3RST A;  2DEO A;  4ZU2 A;  3OC7 A;  5G1Q A;  3MT6 A;  5MGB A;  3NJB A;  3LKE A;  3PEA A;  3H81 A;  4ZDF A;  4FB8 A;  1WDL A;  4EML A;  3Q0G A;  3V5E A;  3HIN A;  1XNW A;  4OLQ A;  1EY3 A;  2VSS E;  3R9T A;  3LAO A;  4ZDB A;  1UYR A;  3K50 A;  1UYV A;  3TV5 A;  3IB9 A;  4Z0M A;  1NZY A;  2F9I A;  3KTH A;  4JYL A;  1NZY B;  2A7K A;  2Q35 A;  4ZDE A;  3BPP A;  1PIX A;  1DCI A;  3Q7H A;  4L6W A;  2PPY A;  1XNV A;  2C8T A;  3OME A;  2HW5 A;  3KTI A;  5CTC A;  3BEZ A;  4ZDC A;  3ZWB A;  3R9S A;  4FZW C;  4LK5 A;  2W3P A;  3KQF A;  4JCQ A;  4GM2 A;  3GF3 A;  4WYO B;  3QK8 A;  3RRV A;  1SZO A;  1X0U A;  4FJW D;  5E0S H;  3HLN 1;  3R0O A;  4JVT A;  3PGQ A;  4KD6 A; 
#chains in the Genus database with same CATH homology
 1Q52 A;  3T88 A;  3I47 A;  1O8U A;  3H0J A;  4F47 A;  3IAV A;  1XX4 A;  2CE3 A;  4JYJ A;  3ZWC A;  1XNY A;  2ZQR A;  5FIF A;  3M6M A;  2PG8 A;  4JCT A;  5DU6 A;  4U19 A;  4JWV A;  1WZ8 A;  4HDT A;  4ASI A;  3P2L A;  3G64 A;  1RJN A;  1XO6 A;  2VRE A;  4QFE A;  3KTK A;  3H02 A;  4L8K A;  2Q2X A;  1K39 A;  2F6Q A;  2ZL0 A;  4U0H A;  2VSU C;  5ING A;  5JBX A;  4JSB A;  3P85 A;  3V5I A;  1EF9 A;  4JCR A;  3NJD A;  2J5I A;  4JFC A;  3SWX A;  2FZS A;  3L3S A;  1Q51 A;  5C9G A;  4J2U A;  3VIV A;  5G1S A;  4G2R A;  4HC8 A;  1ON9 A;  2UZF A;  3QXZ A;  3MFM A;  3QKA A;  3MOY A;  3KTJ A;  1RJM A;  4I42 A;  5HUQ A;  4OMR A;  4MOU A;  4OG1 A;  3TVU A;  4Q0G A;  5DUF A;  1OD4 A;  1Y7O A;  3TT6 A;  2ZL2 A;  3HRX A;  5INI A;  4EMP A;  4K29 A;  3H0Q A;  2VSS A;  4FN7 A;  2PBP A;  4ZDD A;  3GKB A;  4IZD A;  2F9Y A;  4RYF A;  2FW2 A;  4U0G H;  4B3I A;  3PZK A;  4ELS A;  5KDR B;  3QYR A;  2F9I B;  5DKP A;  2ZL4 A;  1W2X A;  4FZW A;  4Q1I A;  4NAR A;  3TZ3 A;  1N6D A;  1FC7 A;  4WCZ A;  3QWD A;  4DI1 A;  2X58 A;  5DTW A;  3MYB A;  3PE8 A;  1HNU A;  3R9Q A;  4IZB A;  5FUS A;  5INF A;  4IZC A;  1DUB A;  1WDM A;  2VSU A;  2J5I I;  4MXI A;  3ZW8 A;  5E0N X;  1EF8 A;  1FC6 A;  3T8B A;  5DU4 A;  5KJP A;  3GMA A;  1YG6 A;  3P5M A;  3U9T B;  5JBW A;  1JXZ A;  2F6I A;  3TRR A;  5CTB A;  3GLM A;  2ZL3 A;  3BF0 A;  1FCF A;  4JJT A;  1YG8 A;  2VSU F;  3R6H A;  4WZ8 B;  2X24 A;  3U9R B;  3FDU A;  3OT6 A;  5E0S A;  1HNO A;  3ZW9 A;  5IKL B;  1SG4 A;  2YJG A;  4JOT A;  1UIY A;  3HE2 A;  2WTB A;  1MJ3 A;  3M6N A;  4U1A A;  5KDR A;  4FND A;  1VRG A;  5C90 A;  3ST9 A;  4K3W A;  4KPK A;  1K32 A;  3H0U A;  4QII A;  5G1R A;  3U9S B;  2VX2 A;  1PJH A;  2J5G A;  2VSU E;  1TYF A;  3FF6 A;  1UYS A;  3ISA A;  4JCS A;  3TVW A;  3QRE A;  3GF7 A;  2J5G D;  3TT7 A;  2VSS F;  2A81 A;  4ELX A;  2J5S A;  3T89 A;  3N6R B;  2EJ5 A;  3STA A;  3DJA A;  4KNP A;  1J7X A;  2A7S A;  4I4Z A;  2NP9 A;  4MI2 A;  4RCN A;  5DZK H;  1TG6 A;  3ZWA A;  4HNK A;  2Q34 A;  1HZD A;  1WDK A;  3Q0J A;  3DOR A;  2IEX A;  2QQ3 A;  3TLF A;  3IBB A;  2J5I B;  3H0S A;  3BPT A;  3KTG A;  3T8A A;  3RSI A;  1N6E A;  3T3W A;  1ON3 A;  3HP0 A;  4B3J A;  1OD2 A;  3K8X A;  3QMJ A;  4FNB A;  4U0G A;  3JU1 A;  5DU8 A;  4GHN A;  5DTP A;  4ELW A;  2FBM A;  4I52 A;  4K2N A;  2DUB A;  4B3H A;  3TDC A;  5DL1 A;  4YLH A;  2ZQQ A;  4KWB A;  5DUC A;  5DZK A;  1N6F A;  4RYF H;  4U18 A;  4EMM A;  3WG5 A;  4NEK A;  3QXI A;  1FC9 A;  2D3T A;  4FN8 A;  3SLL A;  3Q1T A;  2GTR A;  2F9Y B;  1UYT A;  4NNQ A;  2CBY A;  2BZR A;  4QIJ A;  3RST A;  2DEO A;  4ZU2 A;  3OC7 A;  5G1Q A;  3MT6 A;  5MGB A;  3NJB A;  3LKE A;  3PEA A;  3H81 A;  4ZDF A;  4FB8 A;  1WDL A;  4EML A;  3Q0G A;  3V5E A;  3HIN A;  1XNW A;  4OLQ A;  1EY3 A;  2VSS E;  3R9T A;  3LAO A;  4ZDB A;  1UYR A;  3K50 A;  1UYV A;  3TV5 A;  3IB9 A;  4Z0M A;  1NZY A;  2F9I A;  3KTH A;  4JYL A;  1NZY B;  2A7K A;  2Q35 A;  4ZDE A;  3BPP A;  1PIX A;  1DCI A;  3Q7H A;  4L6W A;  2PPY A;  1XNV A;  2C8T A;  3OME A;  2HW5 A;  3KTI A;  5CTC A;  3BEZ A;  4ZDC A;  3ZWB A;  3R9S A;  4FZW C;  4LK5 A;  2W3P A;  3KQF A;  4JCQ A;  4GM2 A;  3GF3 A;  4WYO B;  3QK8 A;  3RRV A;  1SZO A;  1X0U A;  4FJW D;  5E0S H;  3HLN 1;  3R0O A;  4JVT A;  3PGQ A;  4KD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...