2DETA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the pre-reaction state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
365
structure length
365
Chain Sequence
TAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 85
structure length 365
sequence length 365
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2detA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2detA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2detA01
1QU2A 2DEUA 1G7TA 3G59A 4MW5A 4JXZA 4ACAA 3QFSA 2EFGA 1JZSA 1NURA 4JFAA 3D6UA 3FETA 4MUKA 4PBRA 1HYBA 3C8ZA 4EG7A 1D2EA 4M1KA 1WDTA 1NZJA 1GTRA 1VQ7B 5AHWA 1YITB 1K9MD 2QN6A 1S0UA 4TMXA 1N0VC 1EE1A 3HL4A 3IOEA 2XRYA 3FWKA 1QG0A 1UFVA 3GLVA 3AG5A 4CQNA 4YP7A 1VQNB 1D8TA 3L93A 1DDGA 4YHBA 3U6KA 1FFYA 2A1TR 1K8AD 4M0LA 3CCRB 1WJGA 1EXDA 3JQPA 5TY0A 1J1UA 2HDNB 3CCJB 4XFDA 2OV4A 3WYAA 3N9IA 2CRVA 3WNCA 2VNHA 3UK2A 4MWCA 3ZJVA 4EF6A 3E1YE 4YP5A 1T9GR 4PBTA 1BJKA 1OBCA 2CT8A 2X1MA 4UAJA 2A1UA 2YWFA 1JNYA 3SYTA 1U2RA 4ZT4A 1FRNA 1QRSA 3VNVA 3JQRA 4RD2A 4DQLA 3ZZUA 1CNEA 3AFHA 2QUKA 1DARA 3ND5A 4CDNA 4H3SA 1ZM9A 3U2QA 4J76A 2PIAA 1CQXA 1F7VA 1KAQA 3FPKA 2ZP1A 3HV0A 3Q12A 1JIKA 4DNXA 1N75A 2BMWA 2QUHA 4PC2A 1O96B 4CDMA 5FO0A 2CYCA 2V0CA 1EP2B 2J4DA 4ZCLA 3PRHA 4ND7A 1XNHA 3CC7B 2BGIA 1DDIA 1YJNB 3CD6B 2DERA 1NUPA 1R6UA 4RPIA 3AVTA 4ND6A 2WQ6A 3OP1A 3CVUA 3IVCA 4OJMX 5H59A 1I6MA 1R6XA 4RD3A 2QTMA 3KT0A 2A84A 1QTQA 3MCAA 1BQEA 3CXCB 4Y9UA 4ZT3A 4NATA 4Y7CA 3ZBTA 2ZUFA 1QH0A 1MJHA 3ND6A 3LVBA 4TMTA 1QFJA 3H05A 2R6HA 2A1UB 4MUHA 2OQ2A 1TQ8A 1IQRA 4MVWA 4B3XA 1IJFA 1YULA 1UMKA 4NBSA 4B48A 3W2FA 3CCUB 2QA4B 1PG0A 3IUBA 1NI5A 3SJZA 3RK0A 2PMDA 5H5JA 3IOCA 5LFAA 3W2HA 1IRXA 2HCJB 1S72B 1VQ9B 4N3GA 1KQPA 1WXFA 3RK1A 1U7DA 1EFPA 4MUGA 4Y9RA 3F3MA 3IODA 1QU3A 3AVYA 2BN4A 2R5WA 4U7JA 1JECA 3V76A 1VQ5B 5THXA 1KP3A 1M1ZA 1OWOA 2DCUA 4FWTA 1MB9A 1SURA 1WXGA 1WXIA 3P52A 3CCVB 4MWEA 2VTBA 3COWA 2AKEA 4U8HA 3PNVA 2FX3A 3FH0A 1R5OA 3CMEB 4TMWA 3HFJA 3J81k 3QFCA 1KJZA 2IP1A 4OUDA 3TS1A 3AGQA 2V0GA 3TQOA 3KT8A 1CNFA 1ZM4A 4YP6A 3KFLA 4WSOA 4ZCPA 3SZGA 2Z09A 4J0QA 1EFCA 4QFMA 2PZAA 1FNCA 1N2BA 3LE8A 1GVHA 1H3FA 4KR9A 1ILEA 3QTTA 2PZ8A 4ZCIA 5DSZA 2NZ2A 2DXIA 1MB2A 3LOQA 4I6GA 1ELOA 1QRUA 5DB4A 2CUZA 3OZUA 2YY5A 2A88A 1WQ3A 3L92A 4HK4A 4I6EA 3QE2A 2DETA 1KK2A 3LO8A 3N05A 1F20A 1NUSA 5IJXA 3AIIA 4PC1A 3A2KA 1EXMA 1N0UA 1M8FA 4MYUA 1A8PA 1VQOB 1FYDA 4MVCA 4ZCTA 2OK7A 1U7XA 4JZYA 1QGYA 1EP3B 1W34A 3CW2A 4MW0A 3CB4A 1VBNA 1IQUA 1NJID 3CLSC 4KR6A 3QTBA 1GTSA 2QMUA 4ZGNB 4G1VA 2VTBB 3OW2B 3G5AA 4RCYA 4NAHA 5DEOA 3CLSD 5TEVA 2PZBA 1KH3A 2X3UA 2Z3VA 1H1TA 1ZJWA 3H9CA 1KK0A 4LC0A 2BSAA 2RC5A 3DO8A 1KAMA 2QTLA 2CV1A 1M8JA 2GQFA 3CRZA 1VQPB 3FY4A 3AL0C 1NP7A 2A86A 3N2YA 1WXEA 3ZXSA 3G71B 1G59A 1HA3A 1NUQA 1T6ZA 3W2IA 1G7CA 1MC1A 1BX0A 1KP2A 2YWGA 2PLFA 1VQLB 2XNJA 4AC9A 3AVXA 4G6ZA 2CV2A 3WY9A 1T6XA 3AVWA 5GV7A 1D2RA 1JMVA 3HMQA 5J59A 4JYZA 1O96A 2GPJA 2E21A 2A4MA 4H9GA 1MAWA 4TN1A 1Q15A 4GRIA 1YIJB 1W35A 3X1JA 3TQIA 5K0SA 1TTTA 1I2DA 4MW2A 1EFUA 3B8HA 1VQ4B 4MW1A 4MUIA 2QJOA 4K03A 2NPFA 4RD1A 3MXTA 1NDHA 1WZ2A 4X0EA 4RD6A 2C77A 5FNZA 4MW9A 1IQ0A 3U6BA 4PC3A 4FK8A 1KR2A 4L2IA 4KR7A 3CCEB 1O97C 2Z08A 1KKUA 2O8VA 1BX1A 4YALA 1U3CA 1V47A 1M8PA 1Q82D 1O95D 4AF7A 1KH2A 1B23P 2QTNA 3TZEA 3ZBUA 4EG6A 3FDXA 1O97D 1H85A 2RD2A 3E27A 5JBQA 4B44A 2A7XA 3ELBA 1F60A 4EGAA 1IJEA 1JILA 2IELA 3ZGZA 1TYAE 1N2JA 1KK1A 1TUIA 3VRHA 1GJRA 3E20A 2WB2A 1X6VA 3AG6A 1GLNA 1YUNA 2AG6A 1Q81D 1OBHA 2VNJA 3VO2A 1PFWA 3W5HA 1NUTA 1IB0A 2DY1A 1IH8A 3MHPA 4J75A 4BPRA 1FDRA 3INNA 5IHXA 3VO1A 4ZT6A 5J5AA 2QTRA 4RCZA 1TYDE 3G6EB 1R5BA 1OWNA 4DDKA 1I6KA 3I56B 4K0RA 1W2BB 3CMAB 4NCNA 1JA0A 1SM4A 1O6BA 2O5RA 5LM3A 1U0BB 1KH1A 2QUIA 1F4LA 4L2IB 2DUMA 3ZIUA 1E64A 1KRHA 1LI5A 3P0IA 3VU8A 1IHOA 1M8GA 3QE4A 2HMAA 1OD6A 3DV2A 1VQ6B 3H97A 3OZWA 1VBMA 1G7RA 3I1FA 4B47A 1O94C 3CC4B 3SEZA 3UMVA 1ZM2A 5H7XA 3W5VA 1FNDA 1YJWB 4GU5A 3CCQB 2VZLA 4YBRA 3UC5A 1KK3A 3B78A 1O94D 1ZUNB 1T6YA 5LLTA 1QGAA 2C78A 4PY2A 4HJXA 1XNGA 4NAUA 1DNPA 5DK4A 4QBTA 2J08A 2XRZA 1F9AA 4DLPA 1JIJA 1U3DA 4YMIA 4M53A 1WOYA 1IVSA 3P0HA 2BPOA 4U9UA 4MW7A 1YI8A 2E0IA 4R2LA 2CV0A 1P7PA 1CT9A 4FN5A 1H3NA 3HZRA 3PENA 1QX4A 4RJLA 1VBKA 1YUMA 2IJGX 1N8RD 4MYTA 3WXMA 1S4MA 3D6VA 2J09A 4ZT7A 3WBKA 3B82A 2CNDA 4YAUA 1ULHA 2YWEA 3MLBA 1KTVA 1QUFA 4ZCRA 1OWLA 3ZZ0A 2NSYA 4CT0A 4DE5A 4ZCQA 1E63A 2QDXA 1PFVA 3ZJTA 3IMCA 1AIPA 4MUJA 1QFYA 3CC2B 5J58A 1COZA 4QREA 3SDBA 4MW6A 1ZM3A 2D5BA 4WNYA 1F7UA 2BM0A 4UZEA 4EG5A 4AS1A 4LBWA 3IUEA 3FI0A 3TZLA 3ZC3A 2OTLB 3W5UA 1O5TA 1YHQB 1OWMA 1JEEA 4MWBA 5EMNA 1GZUA 4KKVA 2DR2A 3K9WA 2YWBA 1EP1B 3Q4GA 5KWVA 4K1XA 4DJAA 4LBZA 1VQKB 2DLCX 2DPLA 1N77A 2J07A 3FG9A 3GMIA 2VYQA 3Q10A 3CCSB 2HGZA 4TMVA 1VLHA 4EFKA 1MAUA 1E62A 4MVYA 1W87A 4AQ7A 4MVXA 1QVFB 4MUEA 1KORA 3RBAA 4F3RA 5TS2A 1A8HA 2CFOA 3JXEA 4MUFA 2JAXA 3IOBA 3X1MA 2XNCA 3G4SB 3ES9A 2GOYA 4G5GA 2GKSA 1K4KA 2EL7A 1QUEA 3A4IA 2BGJA 1XB2A 1JA1A 3MMXA 1D1NA 4MUNA 1QGZA 1KQSB 1H3EA 3UOWA 3PNYA 3CVWA 1GAWA 5JBNA 4ARCA 1OWPA 1XJQA 3RFFA 3TNJA 3QFRA 2EIXA 1EUQA 4NX2A 3N8HA 1YJ9B 3H99A 1B2RA 3S3TA 1TEZA 4P6VF 2XEXA 4E1AA 4RD0A 3ND7A 2G36A 3ILVA 1K73D 5GV8A 1G8FA 1B6TA 1LW7A 1QVGB 3NV7A 3VGJA 2JANA 1WKBA 5BNZA 4DDHA 4YAOA 3ZJUA 3AGPA 2QEXB 4MWDA 2PFSA 2J7KA 1J09A 4F7DA 2HZ7A 1GN8A 1QQTA 2E18A 1JHDA 2EJCA 1GAQA 1KC8D 3RJZA 1N2GA 1N2OA 1TYCA 2BTEA 3AVVA 4TMZA 1KD1D 4RUKA 3W2EA 1O95C 1V8FA 1FRQA 1M8KA 3RHSA 4LBVA 5FA6A 5TV2A 4ACBA 1WY5A 3P26A 2D13A 1J21A 1KQOA 3G6KA 3I05A 4WQMA 4NDAA 2RE8A 3MMPA 2CSXA 4MULA 4JXXA 5K0TA 3U1VA 2OK8A 2AZXA 1QJCA 2QTZA 1NUUA 2YWCA 3FIUA 5TGTA 3FNRA 3QSYA 4TS1A 4IW3B 4ARIA 2H2AA 1NYLA 1J70A 4LBYA 2GM3A 2E89A 1TYBE 3BL5A 2YWHA 1OGJA 1ZUNA 1EWYA 4EG4A 3SZ3A 4R71A 1J1ZA 3X1KA 4XFJA 3FJOA 3CCLB 1H42A 4P3YA 3GUZA 1QFZA 1OB5A 1YI2B 2D54A 4M2LA 5KSWB 3CLRC 3K32A 4HE5A 3CPWB 4Q16A 5H16A 5KCMA 1N78A 2QJFA 1JJ2B 1O0BA 1G8GA 3SEQA 1OGIA 3IMGA 3CLRD 3NBAA 4YAWA 1EFVB 1O0CA 1I6LA 3SP1A 4PBSA 3MLAA 3VNUA 4YAFA 1Q77A 1VL2A 2BF4A 3NBKA 4Q93A 4N3NA 2ZUEA 2C5SA 1TLLA 1ZH6A 1Q7YD 4KPUA 5F23A 3P27A 3A05A 1XNJA 3M5WA 3FHJA 1GR1A 2RC6A 1RQGA 4HPWA 4ZGQB 1FNMA 4A91A 3IH5A 3WBJA 4HE6A 3CVXA 4QRDA 3JQQA 1TVCA 2BM1A 4R2MA 5HXBA 2VNKA 3WNBA 1JGTA 4ZV4A 1ZH0A 3AKZA 4QHYA 2JA2A 2ZITA 2X0KA 3A04A 4MAFA 4NZPA 1PG2A 4I6JA 2I1LA 4R0NA 3OJXA 4AF6A 1VQ8B 1JB9A 3OTWA 4ZT2A 3W2GA 3I55B 4B4DA 4EH1A 1AMOA 1PFYA 1N2IA 2VXOA 3KT3A 4XSVA 1GPMA 2TS1A 2AHOA 3IMEA 1QRTA 3AVUA 4EG1A 3WNDA 1WQ4A 2WSIA 5DASA 2H29A 4Q7JB 4PC6A 1N1DA 1IFXA 4HJRA 5EKDA 2X1LA 1BS2A 5TR9A 1QNFA 2CYAA 1K4MA 3COZA 1XE1A 1VQMB 4G5FA 1K97A 2PG3A 4S1OA 1YIAA 3CCMB 3CLUC 1JZQA 4KPUB 4EG8A 2J5BA 2E1RA 4C0SA 1WXHA 2BYTA 1R6TA 3OZVA 1M1KD 5TEWA 1MRZA 3H9BA 2B7CA 4G5YA 3CLUD 5HG0A 3CR8A 1MOPA 4BWVA 3UY4A 1JIIA 1YIDA 2QUJA 4EG3A 5HUHA 1R5NA 2B7BA 3QFTA 2WQ7A 3DPIA 3ZZTA 4C43A 3LCJA 4ZCSA 1SKQA 3ZUGA 2PXHA 5HUJA 1Q11A 1OB2A 2BV3A 1DG1G 3HGMA 1MBZA 1G7SA 2A1TS 2BVNA 1Q86D 1J9ZA 4MW4A 1PFUA 1I7PA 2OTJB 3COVA 1J20A 1N3LA 3CA8A 5FO1A 1FNBA 3CVYA 1GAXA 1N2HA 4DDMA 2QJTA 4G1BA 1K92A 3ISJA 3IVGA 1T9GS 1NSYA 1LI7A 1M83A 3P0JA 4PC7A 2B7LA 2YXNA 2D74A 2X3FA 4ZCMA 2CYBA 4F4HA 1GO2A 4DQKA 4M4SA 1KQNA 3CVVA 1EFPB 4MQ6A 3CLTC 1EUYA 3DLAA 5KHAA 1Q19A 4RD4A 4B43A 1N2EA 3IVXA 2VNIA 4ZT5A 3CLTD 3PXUA 1EJ2A 1X8XA 2PIDA 3ZXIA 3FOCA 1EFTA 5AN9A 1TFUA 3COYA 4OUDB 1M90D 1Y42X 1G8HA 4FZJA 1JEDA 4P2BA 3MUEA 3VMFA 3KT6A 1EFVA 4PGOA 4MLPA 3PNBA 4UZFA 3OJWA 2B5OA 4U63A 3IDFA
chains in the Genus database with same CATH superfamily
3DVAB 3G7NA 3ST7A 1RI2A 2ZE8A 4J76A 1V7ZA 1OBOA 1XPOA 4U39A 5AKZA 2DPMA 4HTFA 2HDNB 4PONA 4PGMA 2E9SA 1A2BA 4I5FA 2QVXX 4M77A 4IO1A 3AR6A 1NDQA 2YVQA 4L5IA 1RHQA 3GJQA 4DREA 2XXJA 1AVZC 4ROTA 2JD0A 2PE5A 1YA8A 2CXUA 4Y0VA 3ZW9A 4TZ0A 3JV3A 5JDIA 4GZ3A 3OOCA 2DFDA 3DMTA 3CMEA 4Z0TA 4WOKA 2WHPB 1JE1A 3UH1A 1Z5WA 2HR1A 3CXCB 1QH0A 1U9JA 3OCZA 4BUCA 3V8PA 2X9VA 4V38A 1UQRA 2COZA 3RDPA 1J0EA 5LQRA 4FI3F 2X4LA 1WMDA 2WVGA 3EFHA 1WQ7A 1RQ7A 5AW0A 3OE7D 2AR7A 1DEOA 5JD6A 4AJHA 2P75A 3IP5A 4DA8A 2LJ1A 3E22A 1W88B 2WT9A 1VQOB 4G1EB 4XFKA 4FYMA 1GTSA 1IN6A 1ZH4A 5U4QA 3M83A 4NYIR 2AWNA 4O5VA 3MEUA 4KAFA 4NESA 4IQ0A 3D3QA 3ZDRA 1H4SA 3T1NA 3EZFA 2WTXA 3FPHA 1ZPDA 5K0SA 3GFBA 2V1QA 3FOEC 1KI6A 3B8HA 3PR2B 1E3LA 4MIOA 1HSQA 4X3PA 4OQQA 1GBQA 3TIGA 2H08A 4K8OA 1ONNA 3ELBA 4JLKA 1R3UA 3KTDA 2VP9A 2RHDA 1IE3A 3G8YA 2Q9UA 3GVLA 1KSHA 3GBVA 4OYHA 3R44A 2CP7A 3CCVA 1X38A 3MPUA 4M75F 3TOSA 1Y07A 2R4UA 3C3BA 3A9VA 2Q0QA 5DX0A 1C9EA 4TYQA 5FPHA 1HT0A 1CXZA 3OPYA 1NJ2A 2RJFA 3Q3CA 5AUPB 4B6EA 2YL2A 2CGHA 1DKRA 3UXYA 2CP5A 3EZ2A 5I9NA 2RHWA 1KK3A 2HBZA 2X3YA 5BO5A 3BB4A 1F9AA 4MGIR 5ABPA 1DC6A 2HA3A 2B6HA 1YE8A 2VK4A 1N8RD 1G8JA 4TKUA 1QR2A 5BW8A 2BM0A 5FU6C 4C21A 2HKQB 3VS5A 4UUMA 2YXEA 2FWNA 3VZDA 2VI5A 5T67A 3TG8A 3C3YA 4QQDA 1HKHA 1VE9A 2HTEA 4A6PA 4RE5A 3QFRA 3A5ZB 1GPH1 3HRSA 1PYGA 1IXDA 3QVGA 1VHJA 2FPSA 3UF0A 1YDMA 3HRTA 1RQLA 3FKSA 4JROA 2W8BB 2J9XB 1N07A 4R5MA 5CXSA 4CKCA 4JLSA 1BJTA 4RC9A 2WAOA 2UUPA 4ACBA 1RAIB 2P2SA 2PRSA 2FEMA 1J21A 3GHYA 4JB8A 3ASRA 3NJRA 4N12A 3EA4A 1RAAA 3ZBDA 2YWCA 2PMFA 2VF7A 1UTIA 4MUBA 4D99A 4WERA 2GM3A 1BCRB 5HVNA 2ZIWB 3FJOA 2RI1A 3ZGOA 1UFOA 3PUIA 3ER8A 1XQVA 3MLAA 1U7TA 3LP8A 3HJNA 4HS4A 2PXAA 2J85A 5DBOA 4IJ6A 4J9EA 3L0BA 2ZITA 4A0GA 3UB3A 2ZAMA 1ZD3A 2N47A 2QX4A 4LFAB 2VNSA 2M16A 1RWNA 2V9PA 3MJXA 2P84A 1XEXA 1RYMA 1YZGA 3G2PA 2QI2A 4X7BA 4O8CA 5CT6A 2G6TA 4C3ZA 1WHSA 5ALRA 2BKAA 4MVJH 3EISA 4RTMA 3VR4H 2HSWA 3CISA 1SPXA 1LZLA 1KVSA 5DLOA 2F90A 3PHCA 3CVYA 4DBHA 2EAUA 1P4GA 4ZZ3A 4CM8A 1E3IA 4V0NA 5CJ2A 3JSXA 2UUCB 1CZHA 2OHVA 2JLBA 1AQYA 2BHLA 4W9MC 3UWMA 3C70A 3M0EA 1GA4A 5LP1A 2X42A 1DMSA 1AURA 3QUCA 2YWJA 1VMAA 4FFVA 4MPDA 4QD3A 4H6XA 2YVKA 2NZXA 3IXMA 2Q27A 4E4RA 3ZYZA 3U6KA 2HA5A 5TY0A 5FPYA 4JL6A 3PZRA 3QYAA 1B73A 4YRMA 5CLJA 3DW3X 1RPZA 4AMCA 2HL5C 1NQWA 1M4ZA 2BTTA 2P0EA 3AB3A 3K0BA 3MQ4A 3U62A 4KXNA 3HEMA 4ZOLF 1PJLA 4GHWA 2JBAA 2QRUA 5D3QA 1PT7A 2R57A 1HE3A 3O5AA 1BC5A 4C2BA 2ZXHA 1TMOA 1BE0A 1RM5A 1NX9A 3OYIA 4IGAA 1IRXA 1F2DA 4N3GA 3EVBA 1ECGA 2VBSA 1AZWA 4Q9NA 1Y7PA 2AZVA 2WSEE 3F5MA 1L8LA 3AM1A 1SXJB 3SQXA 4C4AA 1G3SA 1FA9A 1FFEA 1P5HA 4QOSA 4HDSA 2BM9A 3LQQA 4R3WA 1HFWA 1VQ9T 1UDWA 1EIWA 2JFQA 4TLAA 1F4VA 2RG7A 2FCRA 1BCOA 4MVCA 3H2GA 4UJ3A 1J22A 2ZRDA 1FYFA 3HHTB 2RHRA 1NKVA 4BFVA 2HF8A 1YR1A 3KVVA 1UKCA 2ZR9A 3VSBA 3D0KA 4PGHA 2EVRA 4UTPA 2AC4A 2AL7A 4D44A 1Y1KE 4G6ZA 2QL5A 3TE7A 2QTXA 5ILOA 1C30A 4RPHA 5C0MA 3KL4A 4YRQA 1YNSA 2KX7A 3FJ5A 5ELLA 5FLXA 5AD1A 1BX1A 3CNBA 2L5QA 1B23P 2OOSA 1QVWA 1FY2A 8AT1A 3FTFA 2AD5A 1P2DA 4TXMA 4UU7A 3E2MA 3K05A 4CIYA 3S3MA 3KETA 4Y92A 2A0FA 4Q3OA 2R48A 2CNWA 1FXUA 1N1MA 3LLMA 3DMPA 1RQPA 1QDEA 2HMWA 4B46A 1DUSA 3A31A 2V6FA 4IMIB 3ABSB 2F1LA 3N2KA 4EVIA 1N1GA 3DF9A 3LH5A 4QYMA 1R4AA 1X42A 2D3TA 2OVBA 1QGAA 1U2EA 3DWGA 3EQ7A 4IRMA 5IDXA 2Q5FA 5AXCA 4AZ0A 3MJFA 4MMZB 3OSUA 3NU1A 1TCAA 2JEYA 4BJ1A 5D3KA 3V33A 5ALJA 5C7LO 4BNVA 3SDBA 1Y1SA 4BIIA 4WNYA 4F5YA 4A54A 1NF9A 1IAQA 5J2TF 5DPMA 5EMNA 1QRAA 3OLQA 4K3VA 4ZQGA 3NM4A 5YASA 1HF3A 2NSJA 3DOIA 1JA1A 4DLRA 1JSRA 2ZL7A 1YHZA 1NVVR 2XYVA 3TNJA 2ZQZA 4TTVA 2YJTD 1XQXA 2ZIXA 5TT1A 4QT0A 3PA8A 1PS9A 2P5SA 3SZUA 1PVVA 1WOOA 3EQ6A 3OU6A 4EHNA 4PLPA 4I50A 1XTBA 1NXQA 1BXGA 1RLIA 1T5EA 5AM3A 3I05A 1PE0A 1CUXA 4EA7A 3NBYC 1TMYA 1QPGA 5GOZA 4QU9A 1YN8A 3CH5A 5I4BA 2CN1A 5FOQA 1TADA 3BOSA 5EPOA 4YJ2B 1BVHA 1XVUA 3FYUC 3WLSA 4MIKA 5F23A 4MUYA 2QRQA 5LJ5g 5BW6B 4UAUA 3JQQA 3KAPA 5D5QA 3OJXA 3AVUA 1RPJA 2ORVA 1EM8A 4HJRA 5LWHA 2PQ0A 2ZM5A 5B3LA 4QO8A 2FFJA 1RRMA 1T1GA 2P5UA 2WI8A 1JVBA 1Z4KA 4FFOA 1XKXA 2NYSA 4GL2A 5BRJA 4MB0A 2YUTA 1NIJA 1G3WA 5DS0A 1VQMT 4AS2A 2YRWA 1BTOA 3VTKA 4TKVB 3RH0A 5BV0A 4K9OA 5A0VA 3M56A 1JT2A 2V8IA 1LDBA 4ZTJA 3W4JA 3D81A 2CLIB 1G2IA 2OQRA 2OGZA 1FBTA 1WTAA 4IZ6A 5ERYA 4G89A 3UYLA 3DMHA 4MOWA 1BU1A 1EFTA 1PS8A 4AUMA 3GPIA 1OX4B 1YWGO 1K6EA 1WCIA 1GG9A 4MJ3A 5GIPE 3CF6R 1G5HA 1Z88A 4FHDA 3PK0A 2FDXA 3VC7A 2BGRA 1EINA 2L19A 3DHWC 4JYPA 4LHVA 2Q6KA 2VOEA 1W36C 2K7AA 4OQNA 4XE5A 3HO1A 4KQ1A 4F45A 4G4SP 1C0PA 1VQ7T 1CHDA 2FW7A 2K5FA 3W6OA 2XDAA 3IEKA 1ZMTA 1EVIA 3ZHVA 3L8FA 1PJ7A 1UWCA 1G3IA 2CSUA 2BKEA 1N57A 1RLPC 2BKVA 1VYVA 4C8QB 4PEVA 2JFFA 2VRCA 4KQFA 5DWDA 5E6RB 4DA4A 4B82A 4P5DA 1GYQA 3K1AA 4MDWA 4TQ9A 1U8UA 3C3AA 3S0JA 1JWLA 4OKSA 5A5GA 3GUHA 3RS3A 3FIFA 1QAQA 2D3WA 1FNCA 3FVQA 4PXYA 3SC4A 4AS3A 4FIBA 4IIVA 1RAHA 3M6FA 4F60A 2M1ZA 4M60A 3WK4A 1Q74A 1RC1A 2DB3A 1AU9A 5K6RA 3FSRA 1BJRE 3D43A 3J80E 4PLZA 4Q1VA 1VLZA 2EG9A 1FTWA 1Z12A 3DWEX 5I7RA 1IK4A 5CLHA 4NYMR 4KR0A 1E9VA 1H2AS 4MRPA 1ADBA 4CBVA 1W0KA 3NH9A 1K2VN 4Q6BA 3OEWA 4IZHA 2EX0A 1JQAA 2CHVA 1LDMA 4X6XA 3CCEB 1F38A 2ECFA 2KRSA 4FW9A 4IWNA 1ZSZB 2W2LA 3Q41A 1KK1A 1TKCA 4XIJA 2DY1A 5SZKB 2FSIA 5LJ3g 2XUZA 1PD0A 1UPCA 4UULA 3EFBA 3M8KA 2VJIA 3D6TB 1PR9A 3D7NA 3QZ9B 4WLFA 3QHSA 2G67A 5KREA 4KMMA 5ALXA 3V8QA 1Q50A 2XT0A 4RZIA 4JNCA 4LFBB 3OQ5A 4GFDA 3SPXA 4PLIA 4XOIA 4DLPA 2I87A 1S6YA 2WFZA 4HFMA 3PENA 2PSJA 4LX0A 3FB4A 2ADOA 2XT6A 3OT4A 1Y0BA 4M78B 4P0TA 1WNLA 1AT1A 1R6BX 4BB5A 5FUMA 1XNRB 4LRSB 3W4KA 4ZU1X 4O1MA 3I35A 1X2BA 1KY4A 3CVOA 3DZCA 3FSEA 1OWPA 4IF6A 1SO8A 1ZXXA 4Q03A 3PC7A 2VP6A 3QJYA 5I4CA 1QK4A 4NS5A 3S7ZA 3G2QA 1U7WA 1X13A 1FQKA 3GQBA 4JFRA 4QZVA 2OGTA 1P2TA 1X8LA 1Z0DA 4EHDA 3FYDA 1B74A 3FJYA 2EFDB 2CBZA 4J0IA 2QJRA 3UJ9A 3RS2A 2IHJA 2PAAA 2ES4A 1MDFA 2X2EA 1Y9EA 4KNVA 4HE5A 1NF3A 1WP4A 2GK7A 3G9UA 1L4NA 4ASUA 7MDHA 2GBLA 3G8CA 3NBAA 1WF3A 4WZLA 3WJ7A 1RXWA 2JHPA 1QAMA 2YNMC 5DM2A 2XQGA 4RO0A 3HCOA 4N6NA 3B6MA 4BRUA 2L2PA 5DTMA 1U1GA 4G24A 1OB0A 2ODTX 2R5NA 3RS4A 3QPWA 2TS1A 1CG6A 1W85B 3EF0A 1KC8U 4AULA 4KODA 4FNOA 4U00A 1FFDA 4KYIB 5F4MA 4KKTA 3QKRB 3B8EA 3Q1JA 4Q21A 3BZBA 1WS6A 3PE4A 3GYGA 5IVIA 3DT6A 5C37A 2C3MA 4C5BA 2ZOSA 3V8JA 3KG2A 1CRLA 2FN8A 4GSYA 4A0RA 1YHYA 2GTPA 2FWIA 2AHRA 3PXEA 1GTVA 5EQTA 2O2XA 3BW1A 5D7NA 3ZXIA 3PC4A 4FB5A 2PKQP 2A7YA 1N9GA 1US8B 2RHMA 5EP2A 4ZYWA 4C0DB 4PJMA 3OAAD 1D4FA 4OL0A 3W78A 4LGMA 2GF2A 4QARA 2K5IA 3ZCRA 5TMDA 5ICGA 2IYNA 1GZ7A 2XKJE 3EQZA 4FYVA 1VI2A 1S89A 3EFSA 2RK6A 2C9DA 4U0KA 1DJNA 3B6ZA 1NM5C 3E9MA 4TT8A 3T9BA 5JZBA 3IQDB 3OLCX 1ZCJA 4QJBA 2PWZA 1OA0A 3M5CA 4KRGA 4J43A 3IVCA 2WSMA 1W1FA 3FGOA 4Z88A 3N8GA 1ZQ1A 2MDTA 4FQ7A 4HH0A 1EB8A 2QRZA 5AKLA 1WAMA 3N0WA 5FTJA 5A89A 3G88A 1ZUHA 2PWPA 2BUDA 3KZ1E 3KZKA 5BWBA 3KWMA 1OX9A 4KTVE 2FL7A 1YQQA 3PA2A 4GR4A 4N0EA 3T4EA 2FEXA 5I7WA 1DXQA 2IHYA 1DX6A 1RC8A 2C7GA 2GJAA 2JFUA 4GLBA 4IIYA 2L42A 2XWJI 3W05A 1BWPA 4ZN3A 4LA4A 2AEJA 3I4FA 4KN5A 5TEVA 2B0JA 3P2IA 1KEZA 5GAOn 4AFNA 4FC6A 4RL4A 1HTBA 4AG5A 2ZB7A 2XNJA 2R62A 2CV2A 2P5TB 4MTLA 4Y6GB 5JDCA 5ALOA 8OHMA 3VR3D 5TQ2A 3ENVA 2OGUA 3UA7A 3B1FA 2QJOA 1GD1O 2FPOA 1L4UA 2EW8A 1OXBB 3H65A 5LZ8A 2N1BA 4CR8A 5CCDA 4XQFA 4LHWA 1Q0ZA 2GCNA 3DFKA 4DIOA 3O92A 3BH4A 3N7AA 4CMJA 3LLRA 4S1WA 4EO4A 1BI2A 5LQCA 4BNHA 1SQ6A 1SCBA 1RWWA 1JN0A 1BWRA 1V1MB 3PF9A 1I0LA 1M0EA 3A3GA 3I73A 1KSGA 1UJ5A 2DH6A 3CNQS 4MH0R 1OBFO 4QLBA 3O9MA 3ON5A 3IR7A 4E2FB 1PJAA 4DA6A 1DFIA 1KPGA 2ZVDA 1U99A 4OA8A 5FUXA 3RKRA 1IZZA 3A0RB 3FUCA 1JFVA 3DDCA 3Q7IA 4QUKA 5HKKA 1BROA 4BP9A 4EY8A 4UBOA 3OO0A 1QTRA 2OTCA 2L0XA 1M6EX 4NPCA 2HA7A 4A8JA 3QWYA 1CQJB 1HI9A 4LXCA 4LKOA 3G0GA 1POXA 1QUEA 3R7DA 3DD1A 2CH4W 2ZANA 4UHDA 3WGOA 4A6EA 4BMDA 3QSGA 4JKYA 5CKEA 4PPFA 4C7OA 2NVBA 5L6MB 1QQTA 2HK7A 3IKVA 2GTHA 2KLBA 3EG1A 2BONA 2GRJA 1H8HA 1JG1A 3E81A 4Y67A 3N2EA 3ZWAA 3MMPA 4P26A 3I5XA 4OP2A 2B69A 1TYBE 3FSJX 3S40A 1J1ZA 4ZDIA 1C8KA 2GPBA 4F1WA 1PO7A 2VA9A 4DCNA 1WHTA 2QTTA 3HCNA 1OVMA 3SR4A 1PFQA 4GPD1 1F4PA 3IILA 4AF6A 1XMSA 3HNOA 2E65A 1OXXK 3KT3A 2IG0A 5AOAA 1K8RA 2JK0A 2QN7A 2EKDA 1YRBA 1U3OA 4BFYA 1PI3A 5CFQA 4EDUA 4B87A 3MWKA 2CF5A 5KYKA 3VDRA 1JJ2S 4YJGB 1DHRA 2QEXA 1CSKA 1N92A 3A6PC 1FOEB 2O7QA 3DEZA 1OJLA 3PGA1 1RABB 4Q18A 4HCCA 2HD4A 5CG2A 1V4VA 4F6RA 2WHRA 1MO4A 4YJFB 3FCYA 3KT6A 4DJFC 2RGUA 4WI1A 5GAJA 3SX0A 4OFZA 2X9HA 4UM9B 1LJUA 2DWQA 3ZJYA 1VYHA 5AVSA 2AX4A 1ZRMA 5I4KA 2FZCB 2QN8A 4NBRA 2BIVA 1ABFA 3DTNA 1OKKA 2AVDA 4Z9FA 1W36D 4QXOA 4WKBA 2WG2A 3HP4A 2HEIA 1ZM9A 2DF8A 5IHIA 1MGQA 3WL7A 1PR3A 3CVUA 2BJHA 2BMEA 1TF2A 5T4FA 4IUYA 4CM9D 4C92C 3BF8A 1Q14A 2P9YA 3EXHA 4ZK2A 3OQIA 3MILA 3PNMA 4QUZA 1JECA 4LOHA 4J49A 1OPLA 1TIBA 1Z29A 2KK4A 3MGKA 2HIMA 4JS4A 4PPGA 5DTJA 2IQIA 1AS3A 5KMGA 4MP6A 1K9SA 4G9GA 2V45A 5IN1A 3CCMQ 2ZI5A 3PEYA 5JZVA 1GZ4A 3OS5A 5COAA 5IAKA 3RDVA 3ETJA 4ESEA 4IUVA 1NM7A 3HBNA 1M8JA 3CRZA 1UUFA 4LTMA 1DIBA 1HFEL 1NUQA 5C7YA 2FEAA 3LG2A 4RTRA 1C1DB 2D7JA 1DRKA 2I34A 1P0MA 1CYDA 2GX6A 3FUTA 3SR0A 2ZDHA 4QYSA 4MNTA 4EJ6A 3A26A 4W5TA 4X92A 3RRZA 4I7EA 3WK7A 4DQ0A 5K8VA 3KQNA 1PIWA 1FUUA 3NP7A 2ZRKA 1TD9A 4E2WA 2G09A 3INNA 4ZODA 5FOTA 2D1TA 1Z0IA 1VKOA 3HKDB 4KIGA 3L1UA 5INTA 1L5OA 1PEYA 4R31A 1THTA 4Z0NA 2EFEB 3TREA 3Q2OA 4BRZA 4GPTA 3L2ZA 3ESYA 3MCUA 3LFUA 2Z43A 3VOAA 3BD6A 1WUKS 3F49S 1ZMOA 3V8NA 4K6CA 3I1JA 3EIWA 3RNJA 1A9SA 4NL4H 3NHPA 4C4TA 4RS3A 4FTWA 3T7TA 2FETA 2CNDA 4WV3A 4OJKA 3R20A 2JGFA 5I22A 3GLGB 2OX7A 4HDCA 4AECA 1NU8A 2C5AA 4GMDA 3CT4A 1UGSB 1M1YA 1M2OB 2OV1A 2WZPP 3FCXA 3PTLA 2QPTA 3CCSB 2YV2A 3UPUA 2QVGA 3EQ9A 4LF5B 1W1UA 1G5PA 2HRQA 3ZVKA 1RZVA 1S02A 3G7ZA 1ZUIA 2IUSA 2X0JA 3WHLA 1IK6A 1Y1LA 1GAWA 1YQDA 4OK5A 4BWYA 4AZ3A 1S8NA 4EPXA 4KLZA 1NBEA 2RH8A 3GFTA 3ZD8A 5DVZA 4R68A 2IPNA 5CR2A 3H4IA 1KD1C 2IBSA 2BY4A 1TZMA 2IT1A 3DO5A 3RFCA 5IK2D 3RS0A 2CLDX 4E7JA 3P26A 2X4XA 4A5SA 4FYPA 1VQPQ 4OU4A 3S2ZA 2G9UA 3JQDA 4UBKA 4HUJA 4KDCA 4XFJA 7REQB 3AL2A 3D4OA 4TZ6A 5EGNA 3GRKA 3PC3A 2VF2A 3GU3A 1Q77A 2E48A 2EC5A 3EZXA 3KS9A 4LE9A 1GKLA 3BHJA 4H7KA 1VL6A 3GPCA 1QIKA 5GVSA 2YNMD 4UKDA 5KO2A 3NOXA 3WQZA 4LSMA 2ZBRA 5IJWA 5A4DA 1PWZA 5AIBA 4WOBA 1DOHA 1C7QA 5LBUA 1NN5A 3CPWS 2FKNA 1UK9A 2QL7A 1IY9A 2QT9A 2C31A 3SQOA 3D0QA 3BGIA 3N2ZB 3N87A 5M9OA 1UPBA 3N6XA 1XTVA 5JCJA 4OI4A 1QO9A 3JQ9A 3LQFA 3G0BA 2PTHA 1DX9A 1PD1A 5BQXA 4YEJA 3UAWA 3HEAA 3VMFA 4UJ5A 3CBOA 3Q0EA 4RTJA 1UM9B 4UE3S 4UDOA 2ODNA 4GRDA 3I5AA 1RI3A 2QMEA 1VQNB 1N5OX 4DIEA 3KJQA 3H9JA 4PRYA 3P2YA 4LI3X 4ANFA 1YWOA 1P3Y1 1YVPA 2YCBA 2YC4C 4R83A 3T3DA 2GQVA 3O8QB 5T4HA 1U28A 1E1RA 3CD6B 3CWZA 4HH4A 1I1HA 5CVJA 1ZH2A 2CXOA 1K27A 4BECA 2EJFA 1T1JA 3NDBB 4LRTB 3ND6A 5AOBA 4YV2A 1EJ6A 4DNQA 1S2LA 2IKSA 5D87A 4RK7A 3Q8KA 1FX0B 4DLUA 5ARCA 5FFFA 3ETLA 3EMDA 3NNNA 1HH4A 3JZIA 3GLXA 4OPVA 4PWZA 4M75A 1PV2A 3LRTA 3TSCA 5J3BA 5HZHA 3U37A 3P5BA 2CMDA 4GI2A 3B51X 3RIHA 3DL7A 1NBMA 3T9EA 2VBGA 2WB2A 4RIGA 1W6XA 3QG5A 5ALFA 4FYHA 1I1QB 3TTTA 3UBTA 3V4RA 5AOCA 3OSSC 4NH0A 3EWNA 3RVMA 1TK9A 2FU5C 1BXRB 2AOTB 3FVWA 2IIMA 1DBPA 2X7JA 4DZRA 1D07A 4FYIA 5FROA 3VR2A 3L8ZA 3REFA 1ZA2B 4RD6A 1SXGA 5I8PA 3EXEB 1NHWA 3TL6A 3HKSA 1HRDA 1U3CA 1TWBA 1MEEA 1LUAA 3AI3A 3TEJA 1DUVG 3ZKAA 3WGNA 3M54A 3ZGZA 3RS9A 4KO4S 2D00A 4K9RA 2JNWA 1YDWA 2C06A 5LDDC 4KV7A 3G6EB 1R5BA 4ELZC 1OXSC 1W2BB 4JT9A 3L2UA 4NCNA 2A9PA 1A04A 1O87A 2YZ2A 4KVGA 4AIRA 4GY5A 1DKQA 2D9RA 2HU8A 1GAEO 4FW1A 5KOIA 2GHQA 2CP2A 3WB0A 3OYEA 1NUHA 2WJHA 4EFNA 2XMBA 1PBTA 4JJDA 5FR1A 4YRBA 3ZHBA 3CC2B 2FZVA 3Q6QA 3HLYA 1OT3A 3PQ5A 2V6BA 1NV9A 2JGDA 1CUHA 1E92A 1FJGB 3BB3A 3OIWA 3FOFC 2NZWA 1GGJA 1A8QA 3JXEA 3UK0A 5A2GA 2GOYA 5D1NA 4JBWA 1C0MA 1DAFA 3RD5A 5JMWA 1YJ9B 2F4VB 2HK8A 2YR0A 5EFZA 3P5SA 3VGJA 1ZOOA 1GYRA 3UUGA 1BIFA 1WA5A 3EAQA 3JCMX 3H1AA 1G5RA 1WABA 4BNIA 2QR3A 4N3AA 4UEJA 3LQ6A 2IA5A 4RGBA 5H8WA 1KQOA 4MULA 2OK8A 1M1KU 3WB1A 3DUFA 2HLNA 5IEJA 3TMYA 2WHXA 3AEYA 4GBQA 1JAIA 1EBFA 2GD2A 3HWSA 4YT4A 4R9UC 2VZ0A 3PNLA 1JDVA 2EWVA 4R1SA 3HYCA 1LPSA 1U8TA 1Q0LA 1VBFA 4XWTA 5C7OO 6YASA 4M9UA 5IYPA 3ICWA 3RM3A 4JJ8A 2XA9A 2O52A 3OTWA 2Y8EA 3OQ1A 3A8TA 3G0OA 3L6DA 4FMBB 2H63A 3H16A 2AXEA 3BE8A 4HYTA 4X84A 2PH1A 4LIPD 2WTBA 3K15A 2OD9A 3DV0B 3DOCA 1KE1A 3FEOA 1TB4A 4BEVA 1JIIA 2ZT7A 2B7BA 1NRXA 4US1R 4ZOLA 2AJ8A 2QR5A 1YJWQ 1XA3A 2GN1A 2YJGA 5LJ5f 2ABWA 4C4ZA 4CM6A 2J9RA 4ESHA 4MI1A 1CUJA 1EBUA 1N36B 1ABEA 2DRMA 1A88A 1A8UA 1VRCA 2R8RA 1GQQA 1DOAA 4XEHA 3EDRA 1W2HA 3CNLA 3WI7A 2J3DA 2HHJA 1AEYA 5IT4A 1J0XO 4RIIA 4GMXA 1ZOLA 4JA2A 1Z8HA 1FMVA 1KR5A 3TK1A 2H7YA 2Y93A 3ZQJA 4JFAA 4N0DA 5JVDF 3D6UA 4QUIA 4FSXA 3ZY6A 3MBOA 2IXGA 1FSSA 5C8VA 1RKUA 5TT0A 1EH5A 1IHPA 1U4NA 5K3AA 2PJZA 1EIFA 4G85A 3L7CA 3MCWA 3R41A 3ROGA 5JZSA 2TSYB 2X1MA 3SXUB 5GZ6A 1T0BA 3HTXA 3ILHA 4DF3A 3OI7A 3D3WB 5TQVA 1CFJA 3GUYA 2ONJA 3EXFA 1ULBA 4BEWA 4J1QA 2C4MA 4Q15A 3EXG1 1NJGA 4ZHQB 2O14A 1BO6A 1KOFA 3IOMA 4PIVA 5K3CA 4C92D 3LL4A 4PCAA 1MFPA 3JRZA 2FW0A 3DZ8A 4JZ4A 3P45A 1KAEA 2GEJA 2GI4A 5B12A 3TVDA 2VTKA 4WINA 5BR8B 3OYHA 5EE0A 4KRXA 3U7GA 1A4IA 4N6GA 1EX6A 4YCLA 3TEFA 3CRMA 5CKDA 3NHZA 1N0UA 4EIKA 2NZJA 3CEHA 1TQ2A 4JZYA 5KWIA 1JEAA 1TVEA 4LZLA 1L7BA 3AEKA 2EJWA 4NNOA 1WTCA 1URPA 2W6ID 4A3SA 4RXUA 2VGNA 1BWQA 3VOTA 3OTHA 1G3YA 4JBYA 4K9QA 5GV7A 4ND1A 2AFIE 4NOLA 3C5HA 1Z08A 3B5IA 4Z0PA 4KFTA 3SSOA 4IEEA 1P33A 2V7VA 1QO7A 4FMCB 3WRYA 3BGSA 1U02A 2AOVA 2HSGA 3O4HA 1SUDA 1S3GA 3MGAA 3ZV7A 1SIUA 4LCJA 4FPXA 3P1JA 3PJGA 4XJSA 2X9LA 3ABOB 1NW5A 3KB8A 2V1RA 2WWHA 4L8JA 4HGPA 1MXFA 5B55A 1OH7A 3BXEA 3ZCSA 4ENSA 4BVFA 3MW8A 1C50A 1W9HA 2JJ1A 2HL3A 4Q5WA 4ZGDB 2GF0A 1QZ3A 2E85A 3V1TC 4KXLA 4Y2XA 1G7RA 3SQWA 4RJTA 3O90A 2YV1A 2G9NA 2V9ZA 2RARA 1ESNA 1XCOA 4DSTA 4X7FA 3N0VA 1G1AA 1E79A 2ZRHA 3IPCA 1QDLB 1KGDA 2J0QA 4XEUA 3FDZB 2KY9A 5LJ3f 3R3WA 2V7EA 1PFVA 1XTZA 4BVGA 1KK7A 5B2ZA 2PJRA 4WKCA 4X8MA 4RG8A 2F1HA 1T8RA 2J07A 2QQEA 1PZGA 1W5BA 3RRXA 2ZWMA 4YRCA 4OSPA 1SJ9A 3DWFA 3AHEA 1YI1A 1D04A 1E9DA 3BSWA 4E5MA 3NYQA 4X95A 5KNCH 4IEFB 3GCGA 1DMRA 4PYJA 4EHKA 4QTXA 3AKDA 2HHCA 3KOXA 4D9CA 1FZQA 2Q3CA 2F3RA 3IBYA 1KD1D 2GCOB 1ACJA 1L4KA 1RXUA 1TIPA 2R8PA 4KWTA 2JFPA 3HKEB 3G71Q 1JEYB 4C88A 3ZHUA 5M34A 2AJTA 1H42A 1SHJA 3NALA 4JX8A 3S1LA 3RIEA 3H3FA 3CZRA 5T7BA 2C2XA 1W6UA 1K7EB 4E7LA 4YT2A 2M32A 3RUDA 1O9BA 2WSCE 1KDYA 1PNTA 3JTEA 2ZB4A 1SIOA 1PN3A 1CB7A 1QE0A 3WISA 1R9JA 3PHGA 1QNFA 2BE9A 4KGVB 2BR3A 2VUTA 3QY0A 4MLDA 1XTKA 4AN1A 3JRXA 1XRRA 3VR5H 4DQDA 5A4JA 4DEYA 5BW5A 1JLLB 2A1TS 1HG1A 3CCMT 3HSBA 4OGLA 5SZJA 2Z83A 2J6OA 4E47A 1TEHA 1M3AA 3X24B 5B4TA 2PUEA 2NU8B 3MIIA 1WPXA 5E4YA 5C8DA 1EFPB 1NF2A 1W47A 3ZLBA 2WG0A 3NC4A 4H2DA 1IN7A 5BT8A 3SKXA 2RHHA 5CT5A 4D3YA 1YJBA 1G8HA 1N5JA 4C92F 3M9QA 2ZGVA 4DSAA 1Z9BA 1KO1A 2YZGA 2R8ZA 5COBA 3T99A 1QHEA 3GVXA 4QYWA 3RV3A 3PGKA 2XCLA 4POAA 2PWAA 1OSNA 3LXMA 3L7AA 3RG8A 3TLEA 5IRCD 3I2YX 2OV4A 1L5KA 5ALWA 2I2WA 2B4YA 4HBZA 3RARA 2P6PA 4KGZA 2Y99A 4MA4A 2E6NA 1IY0A 5CFRA 2FPIB 3MWEA 4V0MA 3DLHA 4BKRA 3BIXA 3TNLA 1S3SA 1NSFA 2C8LA 2B99A 3ABRB 4BKQA 3CVJA 1UADA 5KTRA 2QA4B 1Z18A 5DHAA 1L5LA 4IKFA 3N0XA 1IB8A 4P38A 4ZRNA 5FLYA 3TU4K 2R5WA 1ILWA 3GO4A 2Z0MA 3ZZ1A 2ZXEA 2EFHB 3J81k 5IVDA 4K6FA 5FBWB 2HRZA 4EZBA 1C3LA 4N0AC 4ZYUA 4LNUA 2DXTA 2O8EA 1K5GA 2JIZA 3VUEA 4JVLA 1G66A 1K0UA 3AIIA 2I4OA 1CKAA 2ZWOA 4D79A 2HU2A 2QPAA 1VQ4A 1C3OA 2FSVC 1M90C 4IXTA 5D8DA 1XRMA 2LMJA 6ADHA 5KC8A 2ZK7A 5HS6A 2V4ZA 2QTLA 2Z2IA 1NN1A 4UHEA 4DJDC 3T7IA 4MPJA 3P9CA 4ZTBA 4ZVQA 5CVVA 4NG4A 1H3ZA 1WDKA 4PIMA 4K8RB 2P2GA 1VQPT 4JGIA 1QWEA 4PTYA 3NHUA 1O95D 2QI9F 3M3DA 4CG1A 1G4AE 3JD0A 2JAWA 1GCAA 4JH0A 3GMTA 4A4FA 3G2NA 5I7SA 2I6QA 3PP8A 1JVNA 3K2IA 1ZNYA 3RSHA 3LXXA 1L7MA 1XPUA 1K76A 2PZEA 3SC6A 1LSSA 2J5XA 3RKXA 1VBMA 3U9TA 5LLTA 3Q38A 2ZAIA 4FCVA 2F1KA 3R9WA 1R0BG 3ODGA 1KY2A 1YUMA 2GZHA 3MLBA 1IG0A 4UUOA 4NF2A 2ED0A 3CR3C 2NV0A 4Y1RB 4PLLA 2HO5A 1TZJA 1DWQA 4WDRA 1T9DA 1TGYA 3KBGA 4GR9A 1U4SA 1DUIA 1OOEA 5TF4A 2QVZX 2OVFA 1L8AA 1I24A 4K87A 1Z9QA 2GVNA 1DWOA 1FUYB 4JI4B 1RTKA 3EDYA 2P0QA 3K9HA 1AMUA 1BW9A 5FTWA 1Q16A 2ZBPA 1CRWG 1RM0A 2GN8A 3TSOA 2JCYA 1S4QA 4AWXA 1ZGHA 3VAAA 1E43A 5L7WA 2ZSKA 1ND6A 2GTIA 4O2BF 3IBFA 3PI6A 4H15A 5HZBA 5J5VA 2ECKA 2ZWPA 4OA5A 4A7PA 5DBFA 3GUZA 3CLRC 3IUMA 4KKXB 4ZAWA 1CY4A 5JE8A 4JBXA 2O2IA 1JQDA 3VO9A 4D6YA 2EYYA 4IHJB 5LZ9A 2ZJ3A 2YC2C 2RH2A 4QU5A 4M7DE 1SG5A 4Y98A 3V4SA 4F4DA 1HYOA 4CTKA 5H81A 4TTQA 1XZIA 2PGJA 5B53A 3M6MD 4X54A 3TQHA 4B4DA 3ASTA 3L0YA 3SAJA 4O2RA 1UQUA 2PFGA 5KNDH 2A9JA 4ENWA 4QVIA 2OMKA 2WQ7A 1EWRA 4HVCA 4DIFA 3GNGA 4I0WB 5AKIA 3K5IA 3K4QA 4HAYA 1H4VB 3CA8A 2R1ZA 3G9ZA 1X1CA 4QDZA 3T5PA 3C39A 5EWMB 4JJAA 5F64A 4C4OA 4L0CA 3VVLA 4DCTA 4M87A 3HCFA 2IXFA 2P8JA 4YI3A 1GPAA 2DSNA 4NQZA 4D7AA 5F4ZA 2O0KA 1TX4B 4J1TC 5HFJA 4Q7QA 1AHNA 1P91A 4JSTA 2QQ5A 3E3OA 3F6PA 3I9NA 3UJPA 1R0ZA 3NC1C 2OHXA 1ZK0A 2OXFA 1PKXA 1Y1TA 1Z6AA 1CR0A 1PW7A 5HK0A 2OESA 1V2HE 4PNPA 3RVDA 1HGXA 5K09A 2OXCA 3BTVA 4F2HA 4Q4AB 3VNVA 1F14A 3K94A 1HYHA 1NHGA 3I5MA 4N65A 3M5PA 7AT1B 1GGEA 2V0CA 1DOZA 4E13A 4J0KA 4N5NA 1CP2A 1G2QA 4JJ6A 2ZYGA 4LJ7A 4MKFA 3HPQA 3I6QA 5NULA 3JAKB 3P9QA 1EZZB 3AOEC 3WE7A 3HUEA 1Y3AA 3MB8A 3COWA 3TX6A 2HYIC 3ZWXA 1RXYA 4JU9A 1Q7TA 3TLGB 3VU1A 4OUDA 1H6AA 2ZYUX 3U80A 3RUXA 1VFNA 3RVKA 1E1DA 4JUFA 2JMAA 1QLWA 3AESA 2MMPA 4M7DC 3SWNA 1M8FA 4DA9A 1FVXA 3C7TA 2VG8A 4ZVTA 1E1KA 3L7OA 4Z2AA 1WSRA 1XZCA 2VTEA 1G21A 3CONA 4BRSA 4IJQA 5LYJB 1QKXA 5ALTA 1J2EA 4GPEA 2C04A 3IMKA 3ZNQA 1P1RA 4C6TA 3FGPA 2WMNB 1PG5A 4WCFC 4CN9A 2J3IA 5F3DA 3HYNA 3NP9A 3PGLA 1L1RA 4JJIA 4C0FA 2EP7A 2UYYA 1FL9A 3PG5A 4EGAA 1Q81C 5DT2A 2I55A 4TYNA 2CXSA 1ZNWA 1Q95G 4Z99A 1ZNZA 4UOEA 3MHPA 4II3A 3E9CA 4DWWA 1M3SA 3TQCA 5CYOA 1TYDE 2BJWA 2NT4A 5KE3A 2Q1SA 3C41J 2NZVG 2P9JA 1KH1A 5EJIA 3TEEA 1QGUA 1SG6A 1H93A 1Z45A 1UZNA 3SBXA 4O4LB 3MZ0A 1LW6E 3AP2A 2BI4A 4RNCA 4XYGA 4J4TA 1IVYA 1SVLA 1QH9A 1Y5LA 1H3NA 4RJLA 3TZCA 2Q2QA 3IQXA 4TV8B 4IUCS 2V4MA 3DEIA 1YJWT 2D8MA 1Q86R 2XB6A 2LNDA 1A2QA 4LYJA 3SCZA 3K9WA 3LT2A 1YRAA 3F4KA 2H4WA 3LUDA 2YSQA 1A1VA 3OAAA 4NOKA 4R8RA 2GREA 3D7SA 1IWBB 5HJ2A 3PYMA 2QRVB 2WP0A 2X7XA 1XEWX 3L40A 3WFIA 1XT6A 5HSGA 2AZSA 2XITA 3A11A 5F9FA 3PPIA 3DHVA 5JSZA 3GRYA 2ZAGA 4FX2A 4KLAA 4ISBA 3S28A 1WUIS 4OOEA 3N8KA 2DWPA 1RRKA 1GFDA 4LBVA 2VYTA 3J7TA 4O25A 4UNQA 2AVNA 1PTKA 3WIBA 3SBEA 4CLRA 3YASA 4NCKA 4HMPA 4O02B 3O26A 1XTQA 1USIA 5FNVF 2HGSA 1G8GA 2R79A 7MHTA 3W79A 1IZ0A 4PYNA 4RJIA 1G8PA 2ZTMA 1ZINA 3ANNA 4G3XA 4CXMA 4GYKA 3TVTA 3L8GA 2OORC 1VI5A 1USKA 5JHGB 3I6YA 5EZSA 5KJEA 1M30A 2XLBA 1P62B 5LBIA 4PSAA 5HBRA 1OE0A 3FHLA 4MMLA 3NHSA 3FA2A 2VN8A 1JR3E 4U6QA 4FDAA 4ZCSA 3F98A 1Z74A 2F8LA 5K20A 2FWJA 1RHJA 4AMUA 4MDHA 3VS3A 4UM7A 4QEZA 1UMBB 1NY5A 1FNBA 4QGBA 4CI0C 2A2ZA 5CGQB 2IC5A 3VR3A 2HKNA 2IXTA 2QPOA 2QIOA 4KOEC 4F3KA 4HCJA 2KS6A 4ZGBA 1Y3FE 1H2RS 1ORWA 3KEMA 5DM60 3A14A 1VL0A 2P3QA 1GNSA 1W4AA 1CJVC 2C7RA 5C34B 5EJ8A 3WMGA 3W9SA 3R8CA 2YXDA 1XR3A 4YJ3F 4IWYA 3OY9A 4ZZIA 3GLIE 3QHQA 5CHEA 4MZPA 2R6FA 4ZEMA 1MAVA 1RVV1 1E2IA 1EDEA 3OTIA 3MT7A 3FNHA 2H7CA 4MV5A 1RM4A 1VCMA 2J4DA 4LAFA 1ZCFA 1L5FA 2CJYA 4FXPA 1VPWA 4I81A 2ZCJA 4MVJE 4RVGA 3LVBA 4H18A 4YXFA 5A05A 1BZYA 3ESQA 3NTXA 4KXVA 2QSUA 4QULA 2CT3A 1IZ8A 4Z8XA 1Y6GA 4QTYA 4MB6A 4MYRA 2PTGA 1DQZA 4XGKA 3ZHXA 1S8AA 3WWPA 4FBLA 1OXUA 2O9SA 1T5DX 3LWBA 1Z6YA 3UJNA 1JJ2P 2WSYB 4ZCIA 3RIGA 3OPNA 3IO5A 2H1CA 4Q0MA 4DMKA 3HJRA 2VWHA 1Y81A 4CL0A 4KZKA 2ZT6A 1UM8A 3DE6X 2EJTA 4CIAA 3MWGA 4IR7A 3C3MA 4HNAA 5E6TA 3REAB 2ZJBA 3BTSA 3JW8A 4Q4HA 5FPPA 1VQLB 2AQKA 1VE3A 1A1SA 3H7IA 3INGA 3ZU2A 2GPJA 1E7OA 2W83A 4U2DA 1TTTA 1SOUA 4BFWA 2WB4A 2AV6A 2PZFA 3LLUA 4XD7D 4KDEA 1J07A 4X24A 1IQ0A 3G71T 2IRWA 3FYUA 1J5EB 2LCSA 4QKQA 2AUMA 3V8BA 2G3RA 2UKDA 1FSFA 3X2EA 3IX7A 3I83A 4F91B 3IIMA 4BGEA 1EK2A 1AXEA 3B6JA 3HLKA 4UHCA 1BH6A 1E6GA 3CCJQ 3OQOA 3L0IB 1HEUA 3H7AA 3EYWA 4MCIA 5EMMA 2BFCB 3KXKA 4HN9A 4JITA 3EOBI 2FZ5A 5AKJA 1GGHA 1U8ZA 2HK6A 3DBLB 4YMIA 2V1UA 2QLLA 2OCYC 4FC7A 3C3PA 3HZRA 5AVTA 3BFKA 1U1DA 3LVFO 2O07A 2PUCA 2OBSA 3VHXA 5G3ZA 1S2OA 1YZYA 4M8IA 4UZUA 4KKVA 1U1IA 4AZWA 4BV8A 5H83A 5CM9C 4NCXA 1Z0FA 4D97A 2ED1A 1KIFA 1QVFB 1M2VB 5FWCA 1E2UA 2O3TA 4X8IA 4B81A 1N0IA 3ZCTA 4R98A 4CKEA 3U7FB 1VJ1A 4YRFA 2FP4B 4ER0A 2Z1MA 3A3NA 1DXOA 4IDEA 2WVAA 2JZ2A 1XMJA 1TJ5A 2PUFA 4URXR 2CE7A 1UBTS 1KEUA 3T0GA 4HHEA 4TMZA 4GSKA 2A57A 1TUCA 1MQAA 3CC4A 1EWQA 4CM9A 3B1YA 5K3FB 2Y0BA 3I55A 3FOBA 1ZOPA 5K4GA 5FIUA 1P1BA 3GFGA 2HSDA 4UNPA 3CLRD 1PUJA 2BF4A 1NIPA 2H9IA 2IUEA 3BFMA 4B6RA 3DPUA 4J8PA 1X15A 4OLHA 3GD7A 1FBNA 1ONSA 3GT3A 4KG7A 1TZ2A 1U1CA 3DB1A 1CUFA 1OPXA 5JQWA 4WTOA 1EGMB 1WQ1R 1UPTA 1ODLA 1OR8A 1DC8A 2M9MA 4UCFA 2JZCA 4D80A 3G79A 2Q50A 2NXEA 3BGOS 2GJSA 4GLMA 1IVNA 4D43A 1UPAA 4MQMA 4CM4A 4V0QA 2N46A 3K0KA 13PKA 2EKHA 1EHCA 4MVJI 4RJ2A 3IVRA 2PUTA 4WXPA 3T41A 3R3XA 5LSAA 1NT4A 5JZ9A 4OHWA 1SXIA 4WZBB 1UBJS 4DCOA 4MV9A 1NBHA 2Y3IA 2GCIA 4JDUA 2ZL6A 4I1SA 2GHTA 5CT8A 1RACA 1O1YA 1GTRA 1I5RA 4DZTA 4YVFA 2W37A 8GPBA 3U3KA 5GANe 3WKBA 4S35A 2FN7A 2X8KA 1YZ3A 4ORZA 2D3NA 4M0LA 3DAPA 3QPCA 2CRVA 3LX4A 4X85A 2DXCA 4IX9A 2A35A 3ACBA 1UB4A 4JJGA 4DLWA 4C2TA 4P3KA 3CIOA 4HT9A 4YMWA 4JUBA 4BBZA 4OTZA 3VC1A 1O96B 4ZGJB 2NPOA 4DM7A 4UTNA 1NXPA 2PO5A 1K0SA 4JI2B 1Y9ZA 2EYUA 4BNYA 4Q4JB 2FPMA 4IIBA 3E53A 3H05A 3R7FA 3GUVA 4LECA 3V3TA 1R66A 1CJKC 4HGQA 1V96A 1GUFA 4YASA 2V6MA 1K68A 5LJLA 1MFZA 4PWYA 2ORWA 3GLTA 2FSSA 4GBED 3TQOA 3CPWP 5SY9A 1WHLA 4JLNA 1DQPA 2GJ8A 2ZAYA 5IMBA 3PKJA 4HWTA 5DSXA 3VSEA 2OBXA 4KXQA 3QEMA 4PPYA 4M7DD 3CLSC 5IK2A 3K9QO 3D4BA 3UFXA 2B4QA 3ZCXA 1XQHA 4ALKA 2OAQ1 2DEQA 2W6ZA 1I2ZA 5EIOA 1XTPA 2H9AA 3WLOA 4DOVA 2LIPA 3F5FA 2C54A 3WLNA 1VECA 3LQRA 4A2QA 3KXLA 4KR3A 4PFSA 3H5LA 1DIAA 2E2WA 4OGGA 1GXSA 2ZIEA 3L6EA 3AMVA 3EEQA 1JG3A 2YNMA 2NV6A 4J03A 5AICA 1TYAE 1X14A 4L78A 3ROZA 4AJOA 1Q81D 3TGWA 4LXQA 2CMKA 3CBMA 1N8NA 4KDRA 4C9BA 3H6GA 4IH9A 3C1AA 3UG6A 4QOGA 1UZAA 4IDAA 4L74A 4J91A 5J4YA 4Q3BA 1JSZA 1LTKA 4N8DA 2RH4A 3IC5A 8MHTA 2DIEA 4IV8A 1AF7A 2DVMA 2DZ9A 3CC7Q 3PV0A 3KKKA 3O8DA 5JZMA 2OM2A 3RW9A 3HU3A 2RAFA 4V0LA 1U0TA 4LYGA 4Y2SA 4I46A 2ZUUA 1SUEA 4QAQA 1Z28A 2OGWA 3L4EA 1NLUA 3BJRA 3L7BA 5JRJA 3LBYA 3T94A 4S1VA 4QUGA 1FYXA 2BI8A 5E9JA 4WCVA 3RAEC 5TPZD 5C5IA 4ZQCB 3WHIA 5IJ0A 3M4XA 5LJIA 1XL0A 1U3WA 3DCNA 3UYKA 3IMFA 5C80A 4DS3A 4IGEA 2M02A 3ABIA 1N2OA 1XHEA 4BTLA 4YGXB 2CSXA 1NT2A 2GGRA 2JTEA 2R7AA 4JJ4A 2E1BA 2BH9A 4QDOA 4H17A 4EW6A 1X9HA 1Q0HA 3PF8A 4U2BA 1NMXA 1D2AA 2WZBA 1PR6A 3S2UA 4XNFA 3SNHA 1YCHA 4EG0A 3LK6A 1OUMA 3JU3A 4NQRA 2LDMA 5KOHA 5JVDA 4G4SO 4KRYA 2PKEA 1A2OA 3QWXX 2K5LA 2IYUA 1CR1A 4BJ3A 4DG9A 3V7YA 2I4IA 1B14A 4US0R 3IAHA 1EGHA 4ZTZB 5IAYA 2VXOA 3NDRA 1PL0A 2X9NA 2GFAA 4PGGA 4DRXB 2Y90A 1UBFA 4Q4LA 2HWXA 1G3TA 1E4VA 2W6MA 4OQXA 4JP2A 5FBZA 2V26A 4MGHA 3UCEA 4XRGA 3KJZA 1K0FA 1C1HA 2PKXA 4ROXA 4JC8A 1YB1A 1ULSA 4J7UA 1AZGB 4B34A 3EAFA 4P1VA 4A92A 1RJFA 2QJTA 4QTZA 3QM1A 1HDYA 1NVEA 3EEFA 5FQNA 2LDBA 3KQUA 2OTLQ 5CKHA 1D0SA 1O03A 2GCPA 2CC2A 1JHMA 2MHCA 1GTZA 4FZJA 5A3QA 3F8TA 5ERXA 3BMOA 4Y1EA 4IUUA 4F21A 2FWPA 2ZZKA 2GSWA 4TM8A 4YWJA 3BE6A 4S1NA 3UUWA 2C2OA 2OUKA 4RFSA 9ATCB 4H0FA 2WV9A 2XGMA 4UAJA 4DMLA 2A8YA 5HF5A 2UVDA 4TUYB 4EGFA 3N0TA 3A1EA 2H4ZA 3WIOA 2CF6A 3F8SA 4OMPA 5IU6A 4DY4A 3K9LA 2MYPA 3R0VA 3RYFB 3RYCB 2XAAA 5I2MA 3DYIA 1VB5A 2O48X 1TAGA 3BK1A 4GAEA 2QUAA 3BE3A 3EVCA 4EY5A 3TWOA 1FUIA 4QYXA 2SICE 3GJZA 3D7KA 1S72B 4NIMA 1T0HB 3I6IA 2HF2A 3V76A 5GONB 3OQBA 2DCUA 2AXQA 5CAIA 4MV6A 2W0ZA 1OLSB 1SC1A 4CN8A 3TNYA 4HFRA 1E98A 3HJCA 3O94A 1OF1A 4O4HB 4FFWA 3T15A 5JS2A 4G4IA 2JAQA 4GOLD 1NJIC 4O2AB 3CE6A 3O7WA 5E6SA 1VPVA 3G1JA 1W44A 2ZATA 3H9CA 4PJJA 3OS1A 1ZESA 1VHOA 2Y66A 4Q9KA 3U7RA 1GADO 4KLNA 5H82A 3ZTWA 4EGJA 5CDSA 2O23A 4G65A 5DGHA 2YFQA 2G1JA 3BQMB 2ICAA 3ZJ5A 2XYGA 2DTEA 2RGEA 1NDHA 1U80A 2WUWE 4G1FA 2OZPA 4YALA 4C6HA 2UUOA 2FUG6 3TZEA 1L4YA 1E1QD 3X25B 4R8MA 2QNIA 9LDTA 1UF9A 2AG6A 2UYQA 3KPYA 4ARAA 1YVRA 2Z6BD 4X9CA 1RWPA 2B82A 3UVEA 3GJ3A 2FLKA 3NKFA 2FMXA 3OQHA 3AEUA 2VDKB 5ECAA 3I72A 2CUKA 4M77G 5LKAA 3H04A 4Z4ZA 2DTXA 2FRWA 5CYFA 5G1OA 2BPOA 1HUQA 4X45A 2D2VA 3QELB 1QX4A 1W4BA 3FNGA 5LCXA 4ZU6X 4CW7A 1ULHA 3A3PA 3KEQA 2BOVA 1OX5A 1XLVA 4IWXA 3UW3A 3L9WA 5JAUA 2CGEA 4EY4A 4IQ4A 3NVKI 1B34A 4DABA 4QJIA 4PZPA 4ANJA 2XNCA 2XUGA 2EJGA 3DJFA 5DTQA 1BN6A 5KPJA 3OQPA 2WJZB 3L8CA 3VXKA 4RCBA 5CA1B 2ONZA 2ZYVX 3S29A 4IDCA 1K28D 4RE6A 2XMZA 3VR4D 5JFTA 3R6LA 2YFYA 4MCJA 3I92A 1U94A 1ZHFA 4Z4GA 2JIPA 3UJHA 3WKDA 2L3PA 4ODIA 4UAVA 5ANRB 3G9QA 1KFJB 4NDAA 2ONYA 5EMHA 4ZC8A 3JQFC 3HU2A 1FMCA 3GUUA 3W7VA 2H4XA 4F7UE 2DTDA 3OUZA 1QFZA 2V4UA 5FOVA 1GY8A 1EHIA 1SHTX 3ZK7A 1RE0A 3S3NA 4C92A 3GHHA 2ZXIA 3U4GA 2VJBA 5TMPA 5IJ9A 2OV8A 3QI7A 4JV5B 5IBQA 2YWRA 4RV4A 1CJTC 2JN9A 4Q19A 3MTDA 2LX7A 1NVUQ 5GAMe 4CLDA 4G2TA 1SQSA 5HGXA 2J87A 4I6JA 5FOWA 1YWPA 2FG0A 3KR1A 4TYMA 2FZGB 4W5RA 4EG1A 5DASA 2OYCA 2OTJA 1N1DA 5EIFA 2WIGA 3S6WA 2PG3A 2W98A 3KSUA 1IXZA 1LX7A 3N2IA 2JIRA 1VLOA 1VQ6Q 4EUFA 5JASA 5HIIA 3NKVA 5GADl 2W6IA 1NI4B 1CZOA 2CJWB 4K2AA 3ZH2A 1O6ZA 3OEYA 1R8XA 1DXHA 5SZHB 1D2GA 5I2SA 1FFXB 2O6HA 3VYVA 3LX8A 4BP1A 2WZNA 4WL0A 3H5AA 1CY2A 4PHFA 3I2KA 3IVXA 5D84A 2G88A 4P2BA 1DBSA 3AF4A 3F3KA 1F17A 3H0IA 3QVTA 3X20B 5B3KA 3FWKA 1Q83A 1Y8QB 1T0JB 3RYHB 2I3BA 4WESA 3ODPA 2H4JA 2KMLA 3ENKA 3DBRA 4BJHB 2RN8A 2YZMA 5EEHA 5A7FA 2JLXA 4N49A 2LT4A 3LFHA 2RGBA 3OOYA 2J9GA 3AFHA 2VQ3A 2EQBA 3GVKA 3U2QA 3CCRT 2R8YA 3CCJT 1IWOA 1U8RA 4FZRA 3KKLA 3PD7A 1MMFB 1HQKA 1H1LA 3D9QX 1QIIA 1M6WA 3R3VA 4TRJA 4Y7CA 3HZOA 2BFDA 4OSEA 3V00A 4LZJA 3ZHOA 4I2NA 5A6SB 1WZNA 3TECE 2WJPA 2LBPA 1LLUA 4HUTA 3U61B 2ORYA 3GP8A 3AX6A 5BVGB 3P9PA 3I5UA 2CVHA 3Q9NA 4EFLA 4KR9A 2C0TA 2AQIA 1NW9B 6GPBA 2A3NA 3LOQA 5IXBA 1PR1A 4NEGA 1K4US 2ZAEA 4EUNA 3LP6A 1EXMA 2N1MA 1NATA 4CF3A 1UJ4A 1FTSA 3T6KA 3TI7A 4W9NC 3R5SA 3ZDFA 3AP1A 2RD1A 3VX3A 4D57A 3CLSD 3RGWS 3F46A 3ZXSA 1PFGA 3PFWO 2ASEA 2QN9A 1P74A 3U17A 1PGQA 1ATZA 1HETA 3SEMA 4MINA 3JYLA 4CR6A 1QG6A 2PVCA 3CF0A 3BDIA 4PU0A 3JWJA 5EYPA 3TXXA 1XHFA 2GO1A 3P0FA 3ZNPA 1D9ZA 2RHZA 4BGUA 1SC3A 1T34A 1CSEE 2I6SA 3LVQE 3C1UA 2NP7A 4EW3A 5JXWA 2KR3A 3E2UA 2RHUA 5IKEA 5ED0A 3LKBA 5AM1A 3KRTA 4IMRA 3SE0A 1YCDA 2IEBA 1Y96B 4Z1OA 3U4QA 1FX7A 2AF4C 5REQA 4O2BA 2CZ1B 2CKKA 3QWAA 1BB9A 3LY5A 4B1FA 2H1VA 4TZKA 1A72A 4K88A 1ZD1A 3FJPA 1C2TA 2QXUA 4ZVNA 3OE7A 4W6ZA 1KEKA 2X51A 3C4JA 1FVFA 5D85A 1S3FA 5FPKA 4E94A 2QDXA 2IEDA 3AYZB 2JJ2D 5DLPA 3WYBA 4EAQA 5ALPA 4W7IA 1W96A 1T6BY 5L46A 1N2CE 5HA5A 2GJPA 2Q6TA 2O7VA 5L3QA 1VLHA 2H2WA 1MUUA 4KLRA 4MV0A 2W2NA 2O57A 4CV0A 4B8YA 4UHFA 3RAGA 4TTIA 5LDHA 1CE8A 2IP2A 1QH1B 2ORIA 1M0SA 1J8FA 4XAXB 1BFKA 1GKYA 4HQNA 2H9YA 4TVOA 3OUTA 4DXAA 4EBBA 3SHOA 4BP3A 5KSZA 2BFEA 1AK9A 3RHSA 3PFGA 1YS4A 2CP3A 5GJBA 3ZGLA 3C0KA 3QYPA 2VP5A 2FPPA 1BE1A 3CCQA 4FU6A 1SZCA 1QMGA 3C87A 3TGLA 2QJWA 4UC4A 1OB5A 2D54A 4HPXB 2VK1A 1N78A 2Q4TA 2ZGWA 3H41A 1LVHA 1P6QA 1BHSA 4F4IA 3K16A 3Q0TA 4O5AA 2QY6A 5JI3E 1FNMA 2XE4A 2X22A 3D3KA 3O1IC 3KM0A 3OLXA 1VHEA 3KXIA 1T0IA 5EWJB 3L6RA 3KUKA 3TOZA 1E1MA 3LPDA 3PUHA 2FJUA 2JGEA 4PC6A 4GQIA 1DWPA 4X20A 2V96A 5CK4A 2EYZA 1YQGA 1X86B 5JOQA 1Q5PA 1Z4PX 4M55A 3I37X 3T34A 3JB9H 4U2KA 4NH4A 1N5IA 3D5TA 3JB9J 4KO8A 1KOJA 2EU8A 4OL9A 3LLVA 3OCCA 1LGYA 2CJXA 2C4UA 1EYZA 5I5EA 1ZAKA 2FN9A 3ZW8A 4LC9A 4AG6A 5AVVA 4REMA 2PMWB 1K73C 4BLVA 1Z7EA 2GPAA 4X91A 3KJFA 1M5Q1 2A9FA 2AFRA 1Z83A 3CPWA 3VUFA 5C46F 1O95A 5JLAA 5F1PA 4C0HA 4P5PA 4K6HA 4BWGA 3EG0A 3OJWA 5J2TA 2ERCA 4V1CI 3OZAA 1GRNA 4UD2A 1XQ9A 4AB1A 2AEMA 3AG5A 1UBLS 5AJZA 1WJGA 3LX6A 5C4MA 3F71A 1XFOA 1JB0E 6AT1B 5I48A 3A2LA 1ZP6A 1OZ3A 1QRSA 3O5ZA 5CAEA 5FRMA 6ABPA 3AKCA 3CZ4A 2WV7A 1G9XA 3NFYA 1YL6A 3OU2A 5HTKA 2B4AA 1PRMC 2Q3EA 4EL5A 1SOWA 3DHNA 3ZD7A 1T5SA 3E3MA 2ZYRA 4RF3A 3CC7T 4HFNA 1KP3A 3JCMV 5I47A 4GX2A 4ENUA 4FR0A 4M0CA 1A9TA 1W8IA 1U2TA 1P80A 2FR8C 3PTZA 3DKPA 1Z4QA 1EX9A 4INZA 3QBEA 3BF7A 4QXMA 3ZQUA 3AWIA 1A8PA 3PUWA 4YREA 3K6SA 2JFYA 2QZ4A 4JASB 2Q0XA 1NJID 4QDXA 1WXDA 3QF4A 2VAMA 1YL7A 1O4WA 1N8KA 4PO3X 1U04A 2CUDA 4G0UA 3HVUA 3CH4B 3L7LA 4XYLA 1WZEA 5HIJA 1DRWA 4IUQA 2DHRA 4N5IX 1PNQA 2GEUA 1U7OA 4L22A 1ZSVA 2PD3A 4GS5A 1VL1A 2EKZA 5J1TB 3IJRA 3KE8A 1RQRA 2PGDA 3AUAA 1J0AA 2O2CA 4FGSA 3WAGA 1OWNA 2J0EA 3PMTA 3A9CA 1LI5A 4DDTA 5AJVB 3O38A 2GMWA 1Y89A 3C15C 1IY1A 3IHTA 1QHGA 1U5CA 4LY3A 4DB4A 1DNPA 2X6WA 5FNVA 3G7UA 3KHTA 1P19A 1Z7GA 3CBGA 2KWIA 4J7XA 2RQRA 1CS4C 3F4LA 1F5SA 4MO9A 1NL3A 3KTAB 1YJQA 2D5BA 2RONA 1TSFA 3S2YA 3V46A 2GWHA 4WZ6A 3ZQ6A 1ZICA 3MFYA 4PG8A 4AMGA 4G0VA 3B53X 1CVIA 2JZNA 1YDHA 4AURA 1Y8RB 2IZ5A 2XI9A 3HFRA 2OTLT 5GZ1A 2JLAA 4NJMB 4TXHA 5G41A 2OBYA 5LU8A 4L8VA 3PB3A 1Z73A 2XCRB 3H5IA 4ZN6A 2R60A 3R3YA 5KQSA 4HUQB 2C4TA 3SC2B 3I32A 1XRPA 3EC1A 2JFXA 4OFXA 1OZ0A 4WLEA 3TLZA 2XUPA 4FS3A 1JG7A 2DL4A 4WQMA 1I5LA 4MDFA 3PNQA 1GNPA 1MNEA 3EDQA 2JDID 3KJGA 1J70A 1AQLA 2DULA 2ISSD 3ORHA 3TZKA 4F93B 1AG9A 4S24A 2OENG 2A59A 5AM5A 3UJBA 1FNNA 3UT5B 1HE5A 1TXGA 5K8TA 4YXWD 1AF4A 5C8YF 4WXHA 1DKOA 3UMFA 3JQ6A 1ZIOA 3ZGVA 4YJ3A 4Q7KA 1JHAA 3EGXB 2L3QA 3NTUA 1E18A 1PT6A 2O31A 1OTHA 4LY6A 5BYBA 1KDOA 2QR2A 1BS2A 3DZIA 1PRYA 1GLVA 1E6LA 5EINA 5DJ5A 5GP1A 4C0SA 4XJVA 4ZAXA 4C78A 3R6JA 3DAGA 3RQIA 3GCWA 3AIOA 3W3ZB 1DAHA 1E0JA 4HN2A 3THOA 2E6ZA 4CUJA 1B42A 4HDMB 3V1MA 4AMVA 5KX5B 4RTSA 2C94A 4IURA 3OCUA 4E5VA 1X01A 1V3VA 2DUWA 4G0ZA 1WA7A 1FSZA 4WWHA 4HZIA 3KLNA 1L1EA 1EWVA 2CLSA 4KK4A 4D3FA 1ZJJA 2EFJA 5BSKA 3R6TA 5CX1A 1ISJA 4AJNA 2W11A 3QVLA 1X1EA 3JVIA 1JEJA 3K0SA 2FG7C 2QX8A 3RVLA 3LY7A 3U9LA 1CEXA 3PCTA 3R5FA 1E61A 4BOYA 4CIBA 5JJ5A 1MVLA 2V74B 2HW8A 1CVLA 3KXPA 4A9AA 4MZTA 2VNHA 1VKHA 3HV2A 3G2OA 1RLOA 1EG7A 2NTYC 1ADGA 4W9RA 1Q91A 3OT5A 3C24A 4MMXB 2QQSA 3QVVA 3QWBA 2D2XA 3GZTB 1HTTA 4CJXA 4XPZA 3OA0A 3ZHTA 1YI2Q 4R81A 4LNAA 4OB6A 4QASA 3AZOA 1N8RR 4OM7A 4WZAB 2J5RA 1ZXBA 1HXDA 2ZSHA 3HA2A 1BNCA 4KUEA 3T38A 4O4IB 3DULA 1UXGA 1SCIA 1ZIPA 3ELDA 2YFHA 4W1PA 2BH2A 1TD1A 3BJEA 4RYDA 5J2UF 3ASKA 3UF4A 3AOGA 5JCOC 1M6YA 2XUQA 5DBGA 4NZ9A 1FZTA 3IDZA 1MOSA 4QBHA 3LGAA 3OY7A 3CW2A 1GL6A 5K8UA 1DIOB 3G5AA 1KH3A 1Z75A 3GNTA 4BAGA 1T4BA 4KH0B 1ZA1B 4YCCA 4AMBA 1T0UA 4UM5A 1AHPA 1H92A 1XAGA 3OMGA 3V2IA 5FDFA 5LL6S 1X6BA 2XYPA 4MRVA 1DTWB 1LPAB 4RKRA 4L2IA 2JLCA 3ZD9A 1J9GA 3QKSA 3L2OB 3OLVA 4I99A 3IHLA 3R3HA 1DKPA 4MS1A 1YS1X 1HZZC 2X15A 3W8DA 5KVSA 1ODFA 1XFDA 4G81A 1MG5A 1ZDMA 2HO4A 3RPEA 3ZX4A 3AEQA 4NZMA 5EE1A 2H85A 2QHXA 2GWRA 2RJOA 2MYTA 4ISCA 2AIRA 5K0ZA 4G63A 4WOPA 3UK7A 3P0EA 3QJ5A 4FMDB 4GU5A 1WDMA 4FOTA 1WVIA 3OYMA 1CETA 2J6BA 3B1WA 3U7QA 3SFTA 3IURA 5CIYA 4FN5A 1EI9A 3NAGA 2Q9CA 1KSJA 5J4HA 1VQ6T 5ED4A 2YWEA 2ROTA 3K2QA 1Y8ZA 4H1WA 3NBZC 2QXFA 3ZC3A 4EAAA 5KYWA 3Q10A 5K45A 2VJQA 1COWD 3LC0A 3KOYA 4B3MB 1CJSA 1T26A 5LUBA 1P4MA 1K8YB 5AM2A 1PX2A 3VKFA 3LECA 3JATB 5J39A 2F00A 4I66A 5AESA 4L8LA 3QX7A 6REQB 3C3DA 3KJXA 1F8YA 2B1RA 1WKBA 5JNLA 3AF6A 1PSEA 3SIWA 2F3TA 2K2MA 3PJEA 4TPKA 5GAN6 2C29D 3NS7A 5IF3A 1Q92A 2FSUA 2FVYA 1VG9B 5IYWA 5GANh 1BVYF 1W5EA 5HFNA 1Y8CA 1NUUA 3AI2A 1A5BB 3N7TA 4GNKA 2XMSA 3NWJA 4CVNA 4OP7A 4HWOA 2DG2A 2NUZA 1Q1GA 3QPUA 1SA0B 3QMVA 4Y1FA 2E82A 2EEZA 4ZEXA 1V3UA 2M6LA 1OLXA 1RYYA 3QXHA 1TVCA 2VNKA 1BA2A 4Q7MB 5AUQA 4XSVA 1GM5A 4KXYA 3NNDA 3B85A 1WOPA 4EPRA 4PZUA 2H0QA 2DE0X 2G7ZA 1R2QA 2D4AA 1MC4A 5DCUA 3SD7A 4MRMA 3NETA 4OY3A 2H5IA 5BSXA 1ZJYA 2TMYA 4PZLA 5TLSA 3DDHA 3PPYA 1OFUA 1E94E 1SCAA 5DBHX 2FG5A 3OC0A 3LV8A 4OMCA 1E7WA 1N3LA 4IDHA 1C3JA 1I7LA 3WG9A 5LC1A 4IYRA 5EHQA 1E3JA 3B9BA 1IM8A 4XD7A 1XZGA 3NTHA 4LJKA 4RTNA 3J7AC 3UWOA 4WGFA 1NP6A 1OX8A 3AERA 2ZUSA 5CFMA 4UZFA 3NHRA 4GLOA 4JXZA 4UBIA 1SUSA 5G0VA 4HXJA 4TMXA 4Y1GA 4JWTA 3N39C 3EDCA 1LDGA 1NNEA 4X1IB 1OA1A 1I4DD 1QK3A 2CHEA 4S1PA 5AI6A 3CO0S 1RLJA 3K9BA 1CF9A 1YA6A 4MGYR 1F1JA 4U9IS 5HF9A 4I5IA 2D0NA 3JCMW 1GQFA 2BMWA 3RKUA 3S70A 4E14A 5HXAA 1TVKB 2KROA 4NFSA 4DVGA 4ZFNA 1R6DA 1V1RA 5F4BA 3IQZA 2H92A 1QFJA 5F9MA 4FONA 1QV9A 4GMKA 1C7JA 1F9EA 3DSRA 4FHEA 3WK9A 1O4VA 4U7JA 4YBZA 1WL8A 1EBBA 3K0CC 2OOKA 3AGQA 3M58A 1THZA 2E37A 2QSJA 4WGGA 1GTJ1 2HL6A 4P4LA 2PKCA 5DCLA 1GXIE 3W9YA 3EXIA 4PSKA 2X9GA 3RU2A 5GMOA 1S2GA 1XDDA 5C1BA 4YTEA 1K5DA 2BFBA 1ZU4A 4YO7A 1YB5A 2G72A 3Q9SA 5GY7A 4LDRA 2VZ9A 2ODAA 1TO2E 1V8BA 3GGOA 4CL2A 1UAAA 4I9UA 4M4ZA 3N76A 4KX3A 1IWPB 4TS4A 2XMCA 1D3BB 1XCPA 5ENDA 2W90A 3W5SA 4H9GA 1S96A 3LDAA 3NHNA 2OZLB 4MW9A 3D7LA 2VUBA 3KYCA 5ALMA 3DOOA 1G16A 1QQ7A 2O2YA 1K8ZB 5HTOA 3CCUA 1N8SA 3K9NA 1JQBA 4EKGA 1YZNA 1X6VA 3KR0A 5BN5A 1NVFA 1A4UA 2GCXA 3UPTA 3ADCA 4DLNA 1DAEA 2X8WA 4C7XA 5H3CA 3USES 1X1BA 4DANA 2XDDA 1KHCA 5KU7A 3T0FA 3NPMA 5FL3A 3H4MA 4Y2VA 5A0TA 3ENNA 1GZ6A 5IBCA 4B47A 2XQIA 3RVQA 1ZWLA 1Q0RA 4AQDA 1BXKA 4PY2A 2G8LA 5B6JA 4OHMA 3QKTA 3UJAA 5U9CA 2RNAA 2VHCA 2PT7A 1AD5A 1FWZA 3CEYA 1T8TA 5EJEA 5DHTA 4G6IA 3WBKA 2G9RA 4YH1A 3AB8A 4JMQA 3QOWA 5AK0A 5DH9A 2ZJ2A 1JEEA 1ZGZA 3Q3JB 4P53A 4YCJA 5E2BA 2WU3A 4G25A 5DGIA 1C2YA 3TE6A 4J6YA 5KWEA 3JD3A 1T2DA 4LJSA 4XWKA 3GC6A 4R6XA 1RZUA 2ZROA 1YV9A 2YXLA 4ZVKA 2CMFA 4ZJYA