2DETA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the pre-reaction state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
365
structure length
365
Chain Sequence
TAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 85
structure length 365
sequence length 365
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2detA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2detA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2detA01
4HJXA 1M8FA 2QTLA 4CDMA 4OJMX 2QUKA 3FETA 2O8VA 1YI2B 4GRIA 3W2EA 4MW2A 3CCJB 4LBVA 1KR2A 1KQPA 4NX2A 3CVUA 5HG0A 1G59A 1WY5A 5LFAA 1EP2B 5GV7A 3I55B 1ZH0A 3CLSD 3SZGA 3CC2B 1YUNA 3A2KA 1EP1B 1NP7A 3CCRB 1IH8A 4M4SA 1NUPA 1TYBE 1G8GA 1YITB 2RD2A 5LM3A 1MAUA 1MBZA 4YAUA 4MW1A 1TUIA 4B48A 4ZCTA 4M0LA 2Z09A 2C78A 2QTRA 3COVA 3W5HA 3ZIUA 3IMEA 4MUFA 2GKSA 4MUEA 5H16A 4ZCLA 1OBHA 4GU5A 3UK2A 3N05A 2CV2A 1EFUA 5FO0A 1F60A 4DDMA 3S3TA 2YWEA 1O97C 5LLTA 2B7BA 2OTJB 4ND7A 3AGQA 3U6KA 4M2LA 3WNDA 1XNHA 5DSZA 1U0BB 1OWMA 4ZCPA 3PNBA 1QFZA 2YXNA 1TYCA 3CLUD 3VGJA 1KH2A 2BM1A 1YHQB 4JXZA 1VQ8B 3RJZA 2HGZA 3VO1A 3WNCA 4B3XA 1VL2A 4ZCMA 2CYAA 3IH5A 1JNYA 4EG4A 2DLCX 1GTRA 1JIKA 3X1MA 4B44A 4MVYA 1KK1A 2Z08A 3VNUA 1EFVB 2DPLA 3W2FA 3SP1A 1D8TA 1QUEA 1B6TA 2BV3A 2X3UA 2BF4A 3CLRD 3LOQA 4MULA 3SEZA 1NI5A 1EJ2A 4P3YA 5H59A 1JA1A 4B47A 3FJOA 2D5BA 4YALA 2BGIA 3IUEA 4MLPA 5K0TA 1KQSB 3E20A 1QGAA 1R6TA 2D54A 3Q10A 1GAQA 1S4MA 5HXBA 1X6VA 3G4SB 4ND6A 3ZJTA 4RD0A 1DG1G 4UZFA 1BX1A 3FNRA 1KH1A 1N3LA 1P7PA 2WSIA 1G7RA 1ZM2A 1JMVA 2AG6A 2GM3A 3CCLB 4MUKA 1MB9A 3JQQA 1BQEA 4F3RA 2G36A 3RK1A 1KJZA 1K4MA 4AQ7A 1QRUA 4KKVA 2BPOA 2GPJA 1IRXA 1D2RA 1DDIA 5DASA 3ZZUA 1YUMA 3V76A 1EXMA 2VNJA 4YBRA 1H3FA 4ZCSA 2H29A 1WQ4A 2QEXB 1EWYA 1YULA 4I6EA 1D2EA 1WXEA 1I7PA 3AVYA 2VZLA 4ZGNB 4NDAA 2E1RA 1NJID 1N0UA 1GAWA 2R6HA 1FYDA 1N2BA 4QHYA 2OV4A 1MC1A 4MYUA 4ZT2A 5TV2A 3SZ3A 1FNDA 1XNGA 2I1LA 3ZJUA 3COWA 1R5OA 2A4MA 3GUZA 2QUJA 2CRVA 1VQNB 2OTLB 3A05A 4K03A 1N78A 4NCNA 1FNCA 4YAOA 4C43A 2A1TR 1EFPA 3QE4A 1VQOB 1O94D 2E89A 5KWVA 1FRNA 2RE8A 1BS2A 3N9IA 1J1ZA 1JB9A 2TS1A 1NDHA 3DO8A 5F23A 1GPMA 1U3CA 1KAMA 1W87A 1Y42X 2PZAA 3AG6A 2CUZA 1CNFA 1FNBA 3LVBA 3CA8A 4MWEA 2QMUA 3ZZTA 3FIUA 2A84A 3FHJA 4UZEA 3COYA 1Q86D 3ND5A 1JEEA 3UOWA 4MUGA 3M5WA 1R5BA 1DNPA 1R6XA 2B7LA 2IJGX 3F3MA 1TYDE 2J7KA 1PFUA 3HMQA 4BPRA 4N3GA 4EG1A 3MHPA 3I1FA 2XNCA 3MCAA 3UY4A 4HPWA 3COZA 2QTNA 2V0CA 1DDGA 2VNIA 5THXA 1NZJA 3TS1A 5H7XA 3U1VA 4ACBA 5BNZA 1M8JA 1M83A 3MMXA 3B8HA 2QUHA 3ISJA 2J09A 3MLAA 1JILA 4LBYA 1ZM4A 1JIJA 1PG0A 3MUEA 4Q7JB 1I6KA 3HFJA 4ACAA 2PFSA 1KK3A 1FNMA 3IMGA 2FX3A 4P6VF 1RQGA 4FK8A 2A88A 4QFMA 2A7XA 4TMVA 3IVXA 5FNZA 3AIIA 3HV0A 1WXGA 4YP5A 3OW2B 4AF7A 3J81k 3L93A 4KPUB 1TVCA 3I56B 1B23P 2VNKA 1YIJB 1IJFA 4I6GA 1O0CA 4TN1A 1M1KD 1COZA 3TQOA 2VTBA 4MYTA 3AVXA 1O5TA 3NV7A 1KC8D 1TQ8A 2QTZA 3ES9A 1AMOA 2J5BA 1JZSA 2GQFA 3CRZA 1ILEA 4ZGQB 5KSWB 3HGMA 1XNJA 1CT9A 4PBTA 3RHSA 1G7TA 3FPKA 4Y7CA 3PRHA 2JA2A 1NUTA 4XSVA 5AHWA 1K97A 1G7SA 2DXIA 4WNYA 3CD6B 2QJOA 3CR8A 1QGYA 5AN9A 2A86A 5FA6A 4TMWA 1SM4A 4CT0A 2PMDA 1H1TA 3E1YE 1OGIA 4FWTA 1N8RD 4MW4A 4MW6A 3IMCA 4PC3A 4G1VA 3ZJVA 1PFYA 1QFYA 2BGJA 1QTQA 3WXMA 1VQ4B 4ARCA 2CT8A 4ZT6A 2PIAA 4MW9A 4EG3A 1W34A 1V47A 3H97A 3CCQB 3ZBTA 3IODA 1UFVA 4MW5A 3UMVA 3QE2A 1QRSA 4RD6A 2EL7A 1W35A 1Q11A 3N8HA 1WQ3A 3QFSA 3TZEA 4RD3A 3GMIA 5TS2A 1GN8A 2CV1A 1MB2A 1EFVA 3K9WA 3AKZA 1N77A 1PFWA 2X3FA 4KR7A 1O96B 3ELBA 4RPIA 4HE6A 1KRHA 1JHDA 2QJFA 1S0UA 1QQTA 3H9CA 3CVYA 4K0RA 1O95C 4M53A 3H99A 3HL4A 4HK4A 4XFJA 3WY9A 4EGAA 3Q12A 4B4DA 3CCVB 4G5GA 1U2RA 2BYTA 1M1ZA 1J9ZA 4NATA 2YWHA 3OZVA 3RFFA 1NURA 3L92A 2DEUA 1QG0A 3CC7B 3ZBUA 1VQKB 1IQ0A 4IW3B 2QTMA 1KAQA 1GAXA 4OUDB 1M90D 1Q81D 3FWKA 4YMIA 2H2AA 3CLTD 3VO2A 4F7DA 1KD1D 5DB4A 1F7UA 1MJHA 1UMKA 4HE5A 3PXUA 1EXDA 5FO1A 1J21A 2ZP1A 1OWNA 1OGJA 3CCSB 3G5AA 4PC2A 4TMXA 4YP6A 4EG6A 3CB4A 4KR9A 2DERA 1SKQA 1OB2A 4WSOA 3ZUGA 3TQIA 2D74A 3DPIA 1U3DA 4YAWA 3W5VA 1GZUA 2PIDA 2BSAA 2HMAA 4P2BA 3CLSC 4MQ6A 4DQLA 1X8XA 1NUQA 2A1UB 4G5YA 2VXOA 4R0NA 1QU2A 2NSYA 3P0HA 1IJEA 1GTSA 4L2IB 2RC6A 2CNDA 1JA0A 1T9GR 1VBKA 1OWLA 3U2QA 1EUYA 3PENA 1IFXA 1VLHA 4C0SA 3IVCA 4U7JA 1H42A 4DLPA 4PGOA 2V0GA 1T9GS 3ND7A 4DDKA 3PNVA 1XB2A 2X0KA 1J1UA 1FRQA 1ULHA 3W2GA 2CYCA 1TYAE 1K8AD 1IQRA 2ZITA 2A1TS 3CCEB 1YIAA 2XEXA 1QJCA 2XRYA 1VBMA 3IOCA 5J5AA 4F4HA 2OK7A 4MW7A 4B43A 1U7DA 1GJRA 2B5OA 3W2HA 3CLUC 2E21A 2DR2A 4ZCQA 1IB0A 4EF6A 1WXFA 1E62A 4RCYA 1WXHA 1N75A 3KT3A 1ZJWA 1J09A 2Z3VA 3LO8A 1JEDA 1Q77A 3A04A 5TR9A 1O97D 4TMTA 1Q19A 2IELA 3G6KA 1M8GA 1K73D 3QFCA 4I6JA 4N3NA 4DQKA 4AC9A 1M8KA 3AFHA 3CLRC 1FDRA 3OP1A 1N2HA 2WQ6A 1SURA 4EG7A 2BTEA 2EJCA 1LW7A 3B82A 1O0BA 1U7XA 3I05A 4MVWA 1R6UA 5IJXA 2PLFA 4KPUA 1G8HA 4J0QA 1IQUA 1TFUA 1EE1A 2PXHA 3GLVA 3KT8A 4BWVA 5K0SA 1I6MA 3ND6A 2EFGA 4MUNA 1OBCA 4QBTA 1TLLA 5DEOA 3W2IA 2CV0A 3SYTA 3IVGA 3AVVA 1QX4A 3QFTA 3D6UA 3IOEA 3AVTA 1KKUA 3VNVA 1KH3A 3ZC3A 4K1XA 3DV2A 1GLNA 1XJQA 3Q4GA 4RUKA 1OD6A 3FY4A 3CVVA 2CYBA 1JECA 1H3EA 3JQPA 3CMEB 2C77A 1B2RA 3U6BA 1T6XA 2WQ7A 2BM0A 2BMWA 2HDNB 2DETA 1DARA 1KK2A 4JZYA 3NBAA 4WQMA 5KHAA 1VQ5B 1D1NA 3SJZA 4YP7A 1H85A 1NYLA 1WKBA 1GR1A 1ZM3A 3QFRA 1VBNA 2OK8A 1ZUNB 1VQPB 1LI5A 1MRZA 1W2BB 5TEVA 1WDTA 1N2GA 4CDNA 1VQMB 1PFVA 4H9GA 3FDXA 1VQ7B 4ZCRA 4EFKA 1BJKA 2VYQA 3P26A 4LC0A 4G6ZA 1O94C 2DUMA 2XNJA 2WB2A 1G7CA 3AL0C 3CCUB 1LI7A 2PZ8A 4MW0A 2XRZA 4MUHA 1O96A 3WBJA 2ZUFA 4DDHA 4MWDA 4PC7A 4Q16A 1KP3A 2DY1A 5TGTA 1QH0A 1VQ9B 2J08A 4ZCIA 2VTBB 3AGPA 1N1DA 2DCUA 3FI0A 3AVWA 4NAUA 5HUJA 1A8PA 1KTVA 4CQNA 3H9BA 2J07A 3UC5A 4E1AA 4EG5A 2YY5A 4J76A 3DLAA 2RC5A 4FN5A 3QSYA 4Y9UA 1YJ9B 3ZXSA 1F4LA 3LCJA 4TMZA 2QA4B 3NBKA 1EFCA 1EP3B 4OUDA 2B7CA 3K32A 1QNFA 2J4DA 3VU8A 3KT0A 3G71B 4KR6A 4PBRA 1KQOA 1QVGB 1WXIA 3C8ZA 2PZBA 3JXEA 2QN6A 3ZZ0A 1OWPA 3IOBA 3PNYA 3CVXA 4AF6A 1ZH6A 1HYBA 1N2IA 3TNJA 4H3SA 4LBZA 3CPWB 3P27A 4NAHA 3WBKA 1E63A 4NBSA 3H05A 3VRHA 1QUFA 5EMNA 1F9AA 1NUSA 2VNHA 1WJGA 3JQRA 4ZT5A 4ZT4A 4AS1A 2X1MA 4R2MA 2ZUEA 2CFOA 4JFAA 4EH1A 1E64A 3FOCA 4RJLA 1OWOA 4PC1A 4PY2A 5KCMA 1EUQA 4U8HA 2IP1A 1N2EA 3MXTA 2A1UA 4MVXA 2YWBA 4MWCA 1S72B 1F20A 1GO2A 4RD2A 1KORA 2QJTA 3P0JA 3CCMB 1YI8A 2X1LA 4L2IA 3MMPA 1N0VC 2BN4A 1PG2A 4MWBA 3VMFA 4S1OA 4R2LA 1QU3A 3G59A 3P0IA 5DK4A 3WYAA 4TS1A 1I6LA 2AHOA 1XE1A 3OZWA 5J59A 3HZRA 3IDFA 4G5FA 3INNA 5IHXA 3A4IA 4DJAA 3KT6A 2O5RA 1R5NA 3FG9A 4MAFA 3RBAA 4U9UA 1TEZA 2HZ7A 4R71A 3SEQA 4Q93A 1YJNB 1WOYA 4EG8A 1QFJA 5TEWA 3OJWA 3KFLA 1H3NA 3ZXIA 5EKDA 2NZ2A 1J70A 1QGZA 3N2YA 4NZPA 3SDBA 3X1JA 1N2JA 3AG5A 1Q82D 4A91A 1F7VA 4QREA 3OTWA 4Y9RA 1IHOA 5JBNA 1KQNA 3QTBA 4ZV4A 1CNEA 2AZXA 5TY0A 1G8FA 1BX0A 1K9MD 3OJXA 1JZQA 2PG3A 2YWCA 3MLBA 3TZLA 1Q7YD 1GVHA 1V8FA 4U63A 1IVSA 4ZT3A 5HUHA 5J58A 1QRTA 4RD1A 1O6BA 2YWFA 4DNXA 1I2DA 3CVWA 3OZUA 2EIXA 1HA3A 5H5JA 1QVFB 1YIDA 4ARIA 2D13A 2E0IA 2NPFA 1J20A 1MAWA 1NUUA 4MUJA 4PBSA 2QUIA 4UAJA 1EFTA 1T6ZA 3FH0A 3W5UA 4YHBA 1N2OA 3CC4B 2R5WA 4J75A 3QTTA 2AKEA 1EFPB 1VQLB 2GOYA 3D6VA 1ZM9A 3WNBA 4X0EA 2HCJB 2JANA 3ZGZA 4XFDA 4ZT7A 1JIIA 4RCZA 1MOPA 1KP2A 1ELOA 4PC6A 1WZ2A 1JJ2B 4QRDA 1O95D 3CXCB 1M8PA 3CW2A 3BL5A 2OQ2A 3CLTC 4MUIA 3RK0A 2CSXA 2QDXA 2JAXA 1K4KA 4LBWA 5JBQA 1K92A 4DE5A 2C5SA 3AVUA 3P52A 3G6EB 3B78A 1NSYA 1Q15A 4JYZA 5GV8A 1VQ6B 1T6YA 3CMAB 1JGTA 2YWGA 4YAFA 3E27A 1OB5A 1CQXA 3ILVA 4HJRA 4FZJA 1AIPA 2BVNA 1FFYA 4JXXA 4M1KA 2E18A 1KK0A 3IUBA 4MVCA 4G1BA 3LE8A 1A8HA 1ZUNA 1TTTA 3X1KA 4RD4A 1YJWB
chains in the Genus database with same CATH superfamily
1ZRHA 4AY3A 3EEBA 1NJFA 3FRHA 2F6RA 2O5VA 2HSZA 2QT9A 1RLOA 3BUSA 3HVKA 4ZIRA 4IIJA 4WOPA 4LUCA 3OLZA 5LOVB 4CKZA 4RDHA 3U3OA 3C3XA 2K2MA 3RU7A 3V7YA 5A6SB 2BHSA 3HB9A 2XCUA 1ENOA 4D6PA 4YIHA 5JAHA 3GH1A 2FVUA 1M2VB 2WIKA 4CKEB 1A2QA 3IQIX 3ZJ5A 5DYGA 3EK2A 2P2YA 1U1FA 1Z5VA 2ZDGA 5FL3A 4R8MA 4DMGA 2NXNA 5JY1A 5AWFC 1U2EA 3IUEA 1VKJA 2YDXA 2I1VB 5D3MB 2V8BA 3OZCA 3RRMA 4QNMA 2ZETA 4MGIR 4H4EA 4B5LA 2PVPA 4IS3A 1YUMA 2D2VA 4HWTA 1A8UA 1L1RA 2AN4A 3VKVA 2EJVA 5IK2D 1PK8A 2DFKB 1M75A 3PBKA 3NDBB 1WY7A 3M4ZA 3ZY5A 5EP1A 1GPLA 2D5CA 4XB1A 2I2FA 6GPBA 4O63O 3DKIA 1SBTA 3AG6A 1Y42X 1OOTA 4JS5A 2QX9A 1X1CA 2AA3A 2Z2YA 2FG0A 1PFUA 2H57A 2VQ6A 2QEXQ 1Q21A 3MW8A 3KJEA 1ZM4A 1ACMB 1MCZA 1XTUA 3A6EA 2ZIGA 4Z2YA 5F4JA 3TLGB 1VJRA 2AG5A 2Y1LA 1NIPA 3NV7A 5FWBA 1RCUA 4DSAA 4J16C 3MTIA 1DOAA 4MRSA 4LDRA 3EUWA 3L7CA 1CUUA 4TMWA 3E1YE 1IEXA 3K4HA 3K8QA 3CO5A 5M34A 3R5XA 1NVTA 2H2IA 4IUYA 3H9GA 3H8WA 1X7YB 3SS7X 4GXNA 2BW0A 4RCCA 2OY0A 3CCVB 4LDQA 1EFRA 2UZAA 1QIMA 2M9UA 4RZ2A 1T9KA 4OUDB 8ABPA 4XLEA 5HUQA 4PSKA 4OXXA 4PLPA 1OFVA 4Z4EA 3DB1A 3H83A 4G4SO 1SBNE 3PHLA 4N47A 4PQRA 4BFYA 2KVOA 1OTXA 1EZ4A 5JEDA 1MQAA 3ZDYB 1A9OA 3U9SA 4IUCS 1ISFA 3EAGA 9ATCA 1GEEA 3UQZA 1AZGB 1XB2A 2KPOA 2GBFA 5K9ZA 1U1SA 4L6CA 1U7DA 1GJRA 1OB0A 1N75A 3DBHA 2OBNA 1JRIA 1RKBA 4KYVA 4YRFA 4XWYA 3D81A 1V1RB 4MZPA 4OMNA 3SG0A 3VS2A 2ZKIA 2VAWA 3QRWA 4CQLA 2X4YA 2I7TA 3RVPA 4L9AA 2COUA 1G3YA 4NBVA 4Y6RA 3ZGOA 4OO3A 1I4LD 3IAEA 1T8WA 2EU8A 3DFZA 3JSXA 1TS9A 1J8VA 1AXEA 4UTVA 2PZFA 3VPGA 4TV9F 2Q41A 4JR2A 4HQOA 1JH9A 2J08A 3U1TA 3K2IA 2VAMA 5KU7A 4ZTFA 3OQHA 4GBMA 1E6WA 4LOLA 1LPLA 2Q5FA 3DMPA 3ZK9A 3FKQA 1OYVA 3GEIA 4G1UC 4U3JB 2F17A 4GPEA 4LBZA 1XV5A 3DZFA 1NP6A 1I8DA 4BDYA 2HCBA 2Y66A 2IGTA 3HEMA 3TD9A 3PQEA 3AERA 3FB9A 2X6QA 4IXWA 2DBKA 3KTDA 4AUEA 3J7AC 2Q6IA 3OPQA 2UUCB 2FQ1A 3L4SO 4MKIA 3I42A 3NDRA 2CKDA 4MKHA 1UFKA 2FUEA 3AG5A 4C92B 1Q0ZA 3H19A 1NLYA 2P2DA 5CITA 1PNVA 3AFNA 3MWKA 1GVHA 3HCWA 5TF0A 2K5IA 4CL8A 2NVBA 2ROTA 1UKBA 4CG2A 3CPHA 5C1OA 1ZU4A 4IGAA 3CX4A 1GV0A 2H7XA 5EWLA 1FFSA 3ZLVA 2ZYGA 1QOPB 2JAWA 3MYYA 4QJ5A 3BE3A 1Y3DE 1T4DA 3R74A 4MV7A 3PNMA 1JB1A 2ZFUA 2VTEA 1XTPA 5LL6S 5IM5A 4DCCA 3AHJA 1ZWLA 3CE6A 1CY0A 2WHRA 3ZDAA 2AWOA 2WICA 3T6KA 4A4KA 2C2MA 4LF8B 5GGYA 4JLPA 2WT4A 4IH1A 1JR2A 1F8UA 1E8DA 1Z5OA 3SIWA 4J4BA 2C2GA 3WK5A 2GTHA 3G2NA 1I7NA 3SQOA 2QTXA 3AW9A 3ZE2B 4Q01A 1H2BA 2CDCA 2HBQA 2PX6A 3VSCA 1HT3A 3OURA 3W2FA 1B6TA 2X3UA 3P20A 1HT2E 1LNXA 1L1EA 3KJGA 1T5EA 1RNLA 1GAQA 1E4YA 2AG1A 2IHTA 4ZVMA 4HNHA 2LT4A 3EVGA 2HLDA 4LJ9A 2IIMA 3GEEA 1JEOA 4K3VA 121PA 5DASA 2GBLA 5IYZB 1S8FA 4JEHA 1RXVA 1PD0A 2NO1A 3VAAA 1L1QA 3JZDA 2XMZA 4AJNA 3A3GA 4FGSA 4QDTA 1XTVA 5CXXA 1JAHA 1JE1A 1D4AA 3EZ6A 2PJRA 3PDCA 2VOEA 3ABSB 4LRSB 4HOYA 1UGQB 1EAYA 2J09A 2DWPA 3EZXA 1FDUA 1QE3A 2G4VA 4KL8S 1MR3F 3VR3A 5KMGA 5EP3A 1YIJB 2CXRA 2KYMA 3H4IA 3RKRA 1P1BA 2GPSA 1GQYA 3CGGA 1SH7A 2Q27A 1G7SA 2W90A 1DJ7B 3R5TA 1H1TA 4ZMRA 4PPYA 1CK4A 1WM1A 1IBMB 2OGWA 1G6Q1 3W5DA 3Q0IA 1O96B 5K4GA 2W2LD 5IHKA 4L5YA 2R84A 4BRWA 1OBVA 4Z0NA 3JALB 2WTNA 2NPIA 4TTVA 4KIJA 3SC4A 3Q85A 5DB4A 4R41A 2J1LA 1QBGA 1FSFA 1PZGA 1OFHA 3PNSA 3KR1A 1HZZC 4KZKA 3CG0A 3BE8A 2B30A 1XEXB 4LPSA 1DTSA 2QX4A 3I2FA 1H42A 4P7JA 1IXRC 1RYFA 2HU2A 2XDAA 3QPHA 1LNSA 4RH3A 2HRDA 1Z7YA 2FR8A 4ZCQA 4M1QA 1XZKA 3WRVA 3A04A 3F9CA 2GREA 2DC1A 4WCIA 2REQA 2YKGA 2ZUTA 5HF5A 4L8YA 4FCYA 1NLUA 2BWJA 3AOEC 2D0DA 4QYSA 4F97A 3VYVA 3E70C 1N8RU 2O7QA 2WVGA 5A06A 1W4CA 3AMVA 1I3LA 1UDBA 2AZTA 1GGNA 4FOLA 3NWJA 4N6OA 2X0FA 3HQ4O 2HA4A 4O4HB 3CS3A 1NULA 4RK6A 4AG1C 3Q6RA 1XNQB 3TD2A 2VBTA 2B8NA 4QQGA 4FYPA 4OLJA 4JUVA 5CDGA 2PKXA 4ABTA 3CC7T 3G13A 3VS5A 1SC6A 1L7PA 2HL6A 4G0VA 1QVGB 5D85A 3VYUB 1S96A 3UCEA 1E3WB 5KNBD 1P3JA 3HN6A 1U28A 3IIMA 4MVJI 2ZTMA 3FYTA 4RD2A 2K2VA 4KBGA 5KTSA 2LX7A 4R8RA 1W0JA 3HZRA 2QBYA 2QAGA 1MNAA 3OX1A 4BNYA 3HACA 1YC5A 4WFQA 2ZSUA 3OCVA 2DFTA 3TLYA 3G49A 4O59O 4YXFA 3NKVA 1C0MA 1OU0A 2VUIB 3TKAA 4I8XA 1JKJB 1XQBA 3MRSA 1J20A 2QPAA 1G3WA 4H4CA 3IA7A 2G70A 1M0EA 5C7YA 1TM3E 1ST3A 1PBNA 4YTLA 3SU8A 2I4OA 3N6VA 3FHTA 2W5UA 2BFBA 2YZMA 1BMFA 2IPAB 1C3JA 3V1LA 1U8YA 3NJ4A 2FYTA 4FS8A 4LEIA 2BHLA 1C7ZA 3P9SA 2LVBA 1P5FA 2CLHB 3DEFA 4DPKA 4EJ2A 3W1EA 2WI8A 5F5NA 5J39A 4C3VA 1KR2A 3HKCA 1L9KA 5GV7A 1FSSA 1BCSB 1ZH0A 5E95A 5SY6A 3OE1A 1M34E 4YN3A 1UQTA 1PCXA 3K6RA 2E41A 5C8VA 3NNNA 3QVOA 3R0ZA 3A1SA 2LIVA 3CSSA 3I6BA 3ZI7A 1WVGA 2I4RA 2WNIA 4MKZA 3EIEA 3FCOA 3ZE1B 4KX5A 2QU8A 2BONA 3PA6A 3C3DA 4R16A 1WCYA 3T7TA 3N2NA 1IEWA 1X7HA 2C31A 4UQLA 4M1TA 3SVZA 5JAOA 2Y2UA 1T4GA 2ASEA 3QMMA 1RXYA 3DZGA 1YF3A 3FNEA 4B6OA 5CP8A 2WSMA 1RAIB 2WJGA 4LJRA 2HBPA 1ZJ6A 3D5QA 4A92A 1N2BA 1ZSGA 4BP8A 4JASB 1KYTA 3PUWA 3CCVQ 1HE3A 4HMPA 4M77A 5B4UA 1CRZA 2X4GA 5CT8A 1LF5A 5IW8A 1BD4A 3A9RA 2JASA 4JRPA 1R6XA 1SKYB 3PC3A 2DD4A 5M29A 1M9SA 3OWHA 2H4XA 1G5IA 4DABA 1Z4NA 3CTPA 4OHUA 1VQOQ 1A8QA 1BO6A 2I22A 4B7CA 2RAPA 1LFAA 3BGIA 4EX7A 3SQDA 3WHPA 5TX7A 1O77A 1SC4A 1DG3A 3P8ZA 3OEHA 4YNBA 3HPRA 4M55A 3GSIA 4FE4A 4IHQA 1V29B 4TV8B 2JTEA 1SQ5A 1Z0ZA 1M6NA 1C4XA 2HF2A 2GFQA 4AJKA 4FMCF 1L5HB 4GLMA 3U3DA 3M8KA 2CP7A 3CUKA 3EWSA 2V4ZA 5JXJA 2W2XA 1AVZC 4QTYA 4HDRA 4XGQA 4IIJF 1M90D 2IV3A 2CUDA 4HAVA 4D80A 1YJNT 3TZQA 1RI9A 2LXNA 2RHCA 3C16C 2F3TA 4QIHA 2PUHA 3U3KA 2YRFA 2EDAA 4BTEA 4OHOA 4RPGA 2R8OA 5ICSA 1LRLA 2GA8A 3ESAA 2OHOA 5CTJA 2NSDA 2CNDA 1XPOA 3ILXA 2BCEA 2IF2A 2OZEA 2QRHA 4X00A 3RJ5A 2SICE 3WL6A 2EGEA 4I1RA 2VQDA 5KDDA 2V3WA 4FDAA 4MB0A 3IP7A 4QFCA 4Z4GA 3ABZA 1WXHA 1PD1A 4TLEA 1M8KA 3D1LA 2HD4A 1KJJA 4M86A 3N2ZB 1F0PA 4P3OA 2ADMA 1ZVVA 4J9BA 2AHRA 3FOWA 2SRCA 4BO0A 3D5EA 2OORC 2FXIA 1P8JA 1G2OA 1ZA2A 1VOMA 1AQNA 2IYZA 3GA0A 3VH4A 2E6UX 4RXMA 4PGMA 2O2IA 4CHGA 2ZTUA 1JVBA 2BMJA 5IFLA 4ALNA 2ZOSA 5E2IA 1TUEA 4LF6B 1VIEA 4KDEA 2OBXA 3G9TA 5KYUB 2Z5FA 4II7A 3CCUB 2JFNA 4HAWA 3QIVA 5KI6A 5JAPA 4KPEC 3ZDRA 3R9XB 1SOUA 1WIEA 2ZZKA 2AR0A 2W2TA 2QL6A 1NMSA 3VZCA 3CC8A 3Q3VA 2B5VA 3OMWA 4GX5A 1I32A 5JQGF 3TTVA 5ETJA 2X6YA 1Z25A 2MHCA 5JATA 3F0TA 3VKWA 3FLGA 4U2EA 4HTAA 3AUSA 1RRPA 3C5CA 2WJPA 2XCQA 1G20E 3DBRA 1X1TA 4MAFA 4E31A 3ANYB 4LF5B 4I0WB 4RLZA 3RU3A 2VUUA 4P7GA 4A91A 2E3IA 2WIGA 5IXYA 4VUBA 1FQKA 1SRRA 5AVKA 5HUHA 2FWIA 1IWPB 3PDHA 3LPDA 3T9DA 3FPCA 2Z6BD 4R2JA 4J75A 1JI3A 4I4TF 3MTDA 1TKBA 2ZSAA 2JMAA 3RGGA 4EDFA 2WTBA 1JEYA 5JNWA 2OILA 1EIWA 3RADC 2HSWA 3Q8KA 3SE7A 3RF6A 3CLHA 1MEOA 3D0OA 4JDPA 3ZR4B 1DO0A 2ISSD 4JXXA 1RPAA 1QHGA 3SF8B 3HWWA 5J4KA 3MJXA 4F14A 4J6EA 5A3SA 4AJIA 2F9MA 4ZAWA 3IDAA 1Z6AA 4Q7EA 4C4SA 1VHQA 1SOVA 2GAAA 4CN8A 2ZS7A 5H3CA 1MBZA 1M1NB 2PT6A 5LR6A 3E9MA 5LA6B 4PLWA 3WK9A 3U17A 4Z8XA 3D7NA 2AEFA 3E9GA 4ORZA 2RJDA 5L8RE 3IVAA 1YIJQ 2BH2A 3M89A 4BNZA 3KJZA 3SP1A 2CK3A 5G1PA 3GHYA 4PINA 3ONWA 1A9SA 1LSUA 2O54A 4F3CA 5JCPA 3DLPX 4KXMA 3KZCA 3WLFA 1N2XA 1JEAA 2HSPA 3PI6A 3TGPA 1HLDA 1WQ4A 4INJA 3FWPA 3GVPA 4XWKA 3SVLA 3EA4A 3RBZA 4JYBA 3Q7QA 2QTHA 3NDPA 4EQ6B 1T3LA 3HJBA 1EIFA 3NGLA 1Y8ZA 4DT1B 4CFYA 1ISPA 3G6ET 4M98A 4V2IA 1GT91 2NU7B 1KAGA 1XHEA 1RQRA 1ZQ9A 3RG8A 4EB0A 4EW3A 1M1KU 4BE1A 4Z86A 2P0PA 5IS2A 2WSBA 3N7TA 5FWYB 2R1UA 2YVUA 4LI3X 2GD2A 4WXHA 3H0CA 4WJKB 2OBMA 4UFOA 4ZTZB 4E2FA 4FBLA 1Y7IA 1EFDN 4RSRA 5IJZA 1M1GA 2IOFA 3AR5A 1ATZA 3F49S 3QTLA 2N0SA 1VJCA 3DBLB 3U13A 2J0UB 5C37A 3RB8A 4Y6OA 3NTRA 2XODA 3TTWA 2W0MA 4BO7A 2ABLA 3VS3A 1TC1A 5KB3A 4C2UA 4EZEA 1QTQA 1QIGA 1QBKC 3DAFA 2GLUA 4JLMA 1PDWA 3CEPB 1Z7GA 1Z4KA 3OYBA 4KQ2A 1WQ3A 1P1CA 2BUDA 2PMBA 1WXBA 3VYTB 5K8TA 2PR2A 1BQ3A 4EIWA 5H9WA 2Z6AA 2J9RA 3HNOA 4HS4A 3D7MA 4NCXA 3RVBA 1PT5A 4UM8B 4BQOA 3DFMA 2OBFA 1OGJA 2BM8A 2HLNA 5I9TA 1J2EA 1SCQA 5BMVB 3V7RA 1U7WA 3QHQA 3NTHA 1UBOS 4EB3A 4GIBA 3S29A 5CB4A 2K7FA 1AZTA 3BSWA 4DDKA 5K20A 1Q82R 4HI0E 2Q0QA 4CR7A 3WMFA 1P4AA 3NIDB 3WNZA 4D46A 1NQUA 3MGBA 3HR7A 3WSWA 1SD1A 1SXJC 1BKSB 1M33A 2AF3C 4L9WA 4JK3A 2EFGA 3GJRA 3E22B 3QK7A 4KX3A 3VNVA 3BCDA 2L42A 16PKA 3E8SA 4UCQA 2HBYA 5JDCC 5G4LA 3E3LA 1GR1A 3QDFA 2CFSA 1J7KA 3CCQA 2GF0A 2QG4A 3LJKA 2DUJA 3MWGA 4UXIA 1Y4ZA 1DUSA 2YIVX 3U0VA 3AGPA 4LGMA 3KXPA 3HDGA 4D9MA 4B46A 1NKTA 2Q3LA 2BHNA 4E21A 4N18A 1EP3B 3AIOA 4RK5A 2BTTA 2VJOA 1ES9A 3TEFA 4M8LA 2Y0CA 1V0EA 4EITA 3A10A 4L78A 1EZZA 4R8LA 3UJ6A 1TADA 4L2IA 1SXJD 4KGXB 2Q6KA 2AOUB 4GLOA 1YMQA 5INTA 3ICQB 3UJ7A 2XAAA 3KTFA 4PZ9A 5DM1A 5HR5A 4RESA 3ZW8A 1QQ6A 1JDPA 1ZIOA 1GFSA 1AHPA 4K9PA 5CVTA 4N40A 3STHA 4PXYA 3FCCA 4Y91A 2QR3A 3WQZA 1X1AA 1R0BG 2V7BA 3EQ8A 3UM9A 2OM2A 4XN0A 4ZAZA 1Q95G 5LZ2A 2Z98A 4MV9A 2XZLA 1MOZA 1OX6A 1RS0A 1YI1A 2YBDA 5IU6A 1XZAA 1IZ8A 4RVSA 2OTCA 4MX8A 4F0JA 2H8GA 4QFDA 1IREB 2QHXA 2VHXA 3MAJA 4DGQA 3REBB 1H2AS 2WKWA 2CSQA 5FOVA 2G71A 1MB3A 1LH0A 3IESA 3GA7A 2I80A 1G59A 4MRAA 1APBA 2IHNA 4U1RA 1E66A 1ETUA 2OV8A 1ORVA 1VMIA 2A0KA 5EQFA 3NTKA 5FROA 1KH2A 2A3RA 4CF6A 3VSAA 2LIPA 2VI5A 3IQGX 4LYFA 4CN9A 3DDWA 1RVV1 1UJBA 4ZYVA 3AZOA 4YALA 1XN1A 2WKQA 5GAOl 1BX1A 3QVXA 3ETEA 3I0NA 4JITA 3R5HA 2X2PA 2FG5A 1DIOB 3QYGB 1VFNA 2Z4TA 2WPDA 1W581 4L85A 4CLEA 2X9LA 3OSUA 2ECOA 4CM5A 2QN7A 1LVUA 1RWBA 4XU0A 2VYCA 4NS4A 1KQFA 4AP5A 5FU6B 1N3YA 5I9SA 3DV0B 3O9MA 1T5DX 2JI6A 4P33A 4O2BA 3KFVA 3INGA 3T5PA 2ZATA 4YR9A 1BN7A 5CDYA 3BFJA 3L7MA 1D6MA 3LMKA 3AIIA 3PFCA 3WK4A 1PFQA 3HCOA 3PUXA 4BL5A 1W0CA 2YRDA 2R7LA 1XT6A 4QVGA 3NFCA 3ZGYA 1CZRA 3AFOA 3B20A 1K5DA 5CK5A 1ULSA 1EUZA 1NTOA 2WUVA 3RVSA 4ARCA 1S8NA 3FSGA 5LLDA 1ZD9A 1SVLA 4MQLA 1ZN9A 3A4TA 3L7IA 3LLSA 5MDHA 5JO9A 2AUTA 5BSXA 2EBHX 4W7HA 1V35A 3ZGXA 5THQA 3GIWA 4QDZA 5FPTA 2CVPA 1YMVA 1X13A 4Q15A 4E0FA 3CCUQ 1PJZA 4AW9A 1U3DA 5I2SA 3SC6A 4XEUA 1QU2A 2VQSA 3JAKB 2IZOA 4PJOF 3SFMA 1G2QA 2AFHE 4NAVA 1E7YA 2PMCA 1RC0A 1QE5A 5GMKm 4KKSA 1E1YA 4OHRA 3C3EA 5EWJB 4EUSA 2Z3VA 4TLLB 5COQA 1RRKA 4EATA 1C81A 3JB9I 5HSGA 5E8RA 1LW7A 4MVWA 2CBGA 1XDBA 1FDSA 2PXHA 3ND6A 2QN9A 4BBJA 5AXDA 4J5YA 3IHWA 5FFNA 2RMOA 3P7MA 1HNNA 3ZWBA 4W9MC 2Z2ZA 1FQWA 3NBAA 4WZAA 2GD1O 4WXPA 1H69A 4HDKB 1BX3A 5BN1A 1T2VA 2WB2A 3I6MA 4M0PA 2FN9A 1ZFNA 4BNKA 3DSRA 5HKCA 3C0CA 1UMCB 2VP0A 2VDQB 4R3WA 4UTRA 1Z16A 1S2NA 4F1KA 2XMGA 4MLDA 1DU4A 4Z4QA 2QN6A 3PEUA 1ESEA 1UBMS 1AN9A 2QK0A 4L16A 2IV7A 1X1DA 2KDSA 2H16A 4IVQA 1XEWY 2O3UA 3EFOA 4P8RA 1HJDA 3IAAA 4J43A 4MKFA 5FU7C 1BPLA 3O92A 4L8GA 2GJPA 2C2ZA 1YS6A 3VR6D 2P4UA 5A7FA 3IDFA 1GPUA 4LJYA 3VHXA 2BFEA 2F55A 4XJVA 1IHOA 3V4OA 1IBRA 3IULA 2NPOA 5GMKh 2QW0X 3I9NA 4F6CA 3G1UA 1VE1A 4P7FA 1I7LA 5BN4A 3CC4B 2L69A 3U80A 3GJSA 2ZR8A 5IEBA 3U4QB 1AQYA 3BMXA 2RGWA 3IURA 4RQTA 3CXCB 3LGLA 3RK0A 2C5SA 1WHSA 1KI2A 1VG1A 3E82A 4BBPA 4F5EA 4UVHA 2GNPA 3O38A 2WU3A 5A3RA 5CLFA 4M7DB 4DANA 3PJGA 4K87A 4MQUA 3X1ZA 5DM0A 1GV1A 1EWTA 4RF4A 4RMIA 2R6DA 1WZUA 4DM3A 5BRAA 3NKFA 4YAUA 2Z09A 3KYIB 1E0JA 1RLQC 3TNFA 3NEYA 4O5AA 2FRWA 4OBBA 1Z45A 2XX3A 3NVAA 4BJ3A 3N2EA 4KREA 1EHIA 3KE9A 3LPAA 1OV4A 4YASA 3A4VA 3QP9A 3P9QA 1GTRA 3H0EA 4ZI7B 3D9QX 1WTHD 3DOIA 3S2UA 4MQBA 1JAIA 3UCFA 1FK8A 2BRUC 1Q7CA 2OAWA 2OBBA 3OZEA 4O1IA 1GD1O 2C94A 5ALNA 4X07A 3HKEB 2EKLA 2P9CA 1NE8A 4BMOB 2ZCFB 2ATXA 2TMKA 4U2DA 3RIEA 4MK4A 1DPFA 2HWUA 1DDIA 4XJSA 4A0SA 3C3YA 3W8NA 1UKYA 2QEXB 1DXOA 3MFQA 1XZIA 3OD1A 4EKDA 1ZCZA 1AKVA 3VZPA 3EXEA 2R1ZA 3J80A 4MOWA 2QUJA 4AL4A 1EFPA 2X4DA 4RG2A 1KSGA 1QHHA 3HJUA 5LMNB 5JNTA 5HX7A 3BWEA 4IS2A 1K0SA 4BNFA 2F3QA 1G83A 1FXUA 4LY3A 1TIPA 4UJ5A 4HQ6A 1NPTO 4YJFB 5I5GA 3HY4A 5I7WA 4FWIB 4XCXA 3DLLA 1W4ZA 1FX0A 5AJUA 4MCHA 5A0FA 1OYYA 4MAAA 5CURA 3PGA1 4B3CA 1XNJA 1UJ5A 4PBTA 5LWQA 4Z54A 4RHTA 4AFSC 1WPRA 2DXIA 3DPSA 4RL4A 3U40A 1X9IA 3UXHA 3B38A 4Y30A 3CBGA 3TQHA 2VOJA 3IODA 1BN6A 1ENYA 3QXXA 1XJCA 4EO4A 5LD2C 4LJ6A 1W94A 1YZVA 2X7HA 2EJBA 4KRFA 2XDQB 4KR2A 2CP2A 5DYNA 5EC8A 1P33A 3BXFA 5CYPA 4KFSA 4KIWA 3W0LB 1J0BA 1CQPA 1T4CA 1MJHA 4ROXA 4K26A 3UA7A 1Z4PX 2V9PA 2X4LA 1HX7A 4MZMA 1UBUS 1YBVA 4FM9A 3CEAA 1TCBA 1C7IA 2WIDA 4JU9A 2E7ZA 2KJQA 4K86A 2XKOC 1D3BB 5L4SA 2ZRJA 1WZCA 2OFPA 4TKUB 5DO9A 2XEDA 4PYRA 2JGKA 1KZ4A 3KFXA 4X20B 4QECA 3CTAA 2Z4RA 4U39A 1F0NA 3I01M 1OZ3A 2EBUA 4ZO9A 2I0FA 5I9LA 1R4MA 1J09A 1T2CA 4JI5B 4DBHA 3QEJA 4ND8B 1ZU5A 1CZKA 3FCEA 3E5RA 2W6JA 4FCWA 3S8YA 3G2LA 3NRCA 4K40A 2B37A 4I5EA 1L8LA 2AJTA 2ODPA 2JGJA 1EK0A 1B2RA 1A04A 4RY2A 4GBJA 2WVJA 2KVQG 3WKCA 4TTPA 1SCNE 2CLCX 2QI9F 2SEMA 4NK4A 1BHSA 3T5BA 3U7RA 3PB3A 3FDXA 1BJKA 2VYQA 1TJ4A 3BTUA 3THRA 3W5JA 4QYXA 1M90U 2JKZA 4CKCB 3UJCA 4RPLA 2ZQYA 1NVAA 3AUFA 2NX2A 1VC2A 2GFAA 3GO4A 1N33B 1AGXA 2G3YA 4QOGA 3WC4A 3H11B 2VNHA 2MSEB 2R4UA 4O4IF 3WICA 3SQMA 2ZRCA 4DEYA 3C6MA 3KVVA 4DC1A 5DNYB 3A1FA 2OTLT 1I2MA 3E9NA 1VYTA 1RAGB 4JL6A 5COAA 4NQZA 4IQFA 4X1VA 1KBOA 4C8QB 3E35A 4CMCA 1FDIA 4QBKA 4RDIA 4U2FA 3VYRB 4MS1A 1YB1A 3OM1A 4DK1A 5FTNA 4U63A 3UFXB 2QYHA 3CVWA 5BRNA 2VBGA 3R77A 4Z9BA 5GAMh 4UAJA 2RMKA 2O1XA 1WORA 3ZGLA 4BQEA 1OFTA 5C7LO 1VHWA 2QP9X 5I7HA 3PTZA 3C4SA 2VP6A 3AI7A 2ZJOA 3L41A 3T56B 3H87A 3W9SA 3IB3A 4JY7A 5JMWA 1TM1E 1IGQA 2FMTA 2V3CC 2A9JA 1I4EB 3B9RA 1HZJA 1AUXA 3JR7A 2GHQA 1U0JA 3OS2A 4CR8A 5LFAA 2PS0A 1DAHA 3C3KA 1W6RA 2CNWA 1K8AC 4LZZA 3NHNA 3ZNOA 4DLLA 1VHEA 3BG5A 1WCXA 1S6YA 3SHFA 4LNUA 3OW7A 3DNFA 1Y7PA 3F5DA 3H65A 4Q19A 4MVJH 4JLDA 1TW2A 3GNLA 2RIRA 3CCMA 1H0SA 3W4JA 3QEAZ 2PK3A 3AKDA 2Q8NA 3NCHA 1XHLA 2Q4BA 3FVWA 4DDVA 5KJCA 4AI6A 1UPFA 5BP7A 3EXHC 3PUIA 2V5UA 1DOHA 3EBOA 3WTBA 1TU3A 1M2OB 2PSSA 4UBOA 4OF4A 2J3IA 4JBNA 1FYDA 3SY8A 2OKGA 1CUHA 1E0AA 3T52A 5KWVA 1NQTA 1AQUA 5EL0A 3G4SQ 3D43A 1SEVA 1EM6A 5KX5B 3KQSA 5BOVA 4PFQA 2R5FA 4L5AA 3ENKA 4XL9A 1PAUA 4BPRA 3K73O 4QTXA 3GMSA 1TCUA 3FPFA 4WOJA 2CKKA 3R76A 2ZCJA 4BGDA 5IZCA 5BNZA 1G21A 5CNKA 4MI9A 4NJEB 5AJHA 1NBEA 4J0JA 3HUEA 1FX1A 4MH0R 3A2MA 3T9CA 3A6JA 1OX8A 1TEVA 3FRNA 2J6FA 3CW9A 3HR8A 4XH9B 1GNVA 2GO1A 5DTJA 2YJ4A 1JYFA 3A1VA 4RVFA 3WADA 3GVHA 5HKAA 2HQSA 5ALZA 4M75B 2DTEA 2RB4A 1JHDA 3REGA 1X1BA 3LUAA 3KVRA 1I4K1 4QLOA 4IO0A 4KGZA 4L8VA 5JROA 3HADA 5HDBB 4EIKA 3OHMA 5I9MA 2NSJA 5L3QA 1P81A 3ZCVA 3U23A 3NEAA 4RY8A 4XN3A 3OPOA 1XXHA 2KLHA 5ERXA 2RJOA 3RUPA 1VE7A 4HQKA 2G1KA 3TN7A 1BMTA 3NHFA 1W47A 4ZVOA 5ADWA 3EE6A 3LFHA 3KCQA 1FYVA 2Q28A 1DX6A 2VHZA 4JODA 4CIYA 2M02A 5AXBA 5ITZB 2VWFA 1H05A 4Q4CA 1XRLA 3BT7A 1RJ9A 2F8MA 3PSAA 2NVUB 1HF3A 4K5QA 3A4LA 4I9UA 4I5FA 3S40A 4M99A 2BISA 2FEWB 2WW8A 3RIRA 3BULA 3CRW1 4NZZA 4WCVA 4PZLA 3P4UA 5K6AC 4ZO6A 1SHFA 3K9NA 5FBRB 3I2YX 2O7SA 3RUDA 4MA0A 2YMMA 3MMZA 2JCBA 1C0PA 3S3NA 3K53A 1FW6A 3CC4Q 1Z3IX 4RO0A 4QUKA 1I5OA 2GEJA 4KHPB 3CT4A 1F6BA 2V1XA 1AU9A 2O19A 1GQSA 1C4OA 3AF6A 3KHSA 3HXMA 3IE1A 4DSTA 1KRXA 4X5OA 3VU8A 3TXXA 4KR6A 4V0OA 4F3KA 3NIFB 2PZBA 4KKUA 5HZGA 3UA6A 3BZWA 2PMFA 3OMXA 5IYQA 2TMDA 4RGYA 3D59A 4NU5A 2HCFA 4Z8AA 2A1UA 2CJXA 1CQZA 1UK7A 2ZM6B 2HHJA 3R23A 2ZL6A 4D44A 4GYYA 4D41A 2HSEB 1SA0B 2E49A 2JIRA 1GKYA 3G71Q 1NBMA 4IDDA 3T1OA 1EFAA 5HZAA 3MGCA 2Q7DA 1T1IA 2ZS8A 4QDKA 2WSEE 4LQDA 1K9MD 2EQUA 4C1BA 2Z0MA 3JWEA 1ADFA 1KRWA 4AROA 1L8OA 3WHKA 1A8SA 4UHJA 1SG5A 3JATB 2QG9A 3ZY4A 1Z68A 3FW1A 3P96A 3G9QA 3EXIA 5CYOA 1QYWA 4GXTA 2WHPB 1OH8A 4LCEA 4D98A 4FYWA 2QTLA 3V9AA 3L02A 3NP9A 4YUWA 3AONB 3UIEA 4PG4A 2HLHA 1JTVA 4DR4B 1FP2A 4ZDJA 3L05A 4Q5IA 4QDOA 5DN6A 1G0NA 2WE8A 4MUFA 3IUQA 4CLRB 3NWBA 1H3ZA 3BXXA 2JCGA 1UXOA 3FN4A 1G3TA 4ES6A 3A6PC 3JCMV 5CYFA 3TUZC 2CL5A 1GZ5A 5DP2A 3RTAA 2W6ZA 4ZDWA 3PEYA 5BSFA 1X77A 3OKCA 4XM3A 1D1TA 2IUSA 4YDHB 3TIVA 1TTHA 1DAIA 4L76A 4NS1A 2O48X 1ZD4A 1CSKA 3QE9Y 1O0SA 3PWKA 5EJ8A 4UUQA 3HB0A 3GUCA 1ZLXA 1N2ZA 5LC1A 1XBTA 3NTUA 3RS0A 4DV5B 4Z7OB 4K03A 3KB8A 4GDFA 3AVPA 1VQOB 1MPXA 1NONA 3NW9A 4NS5A 2CGHA 2MK5A 1PRMC 1ECLA 3DTVB 4ZZ0A 3OYIA 2CF4A 3KYBA 2QD5A 1ZL0A 2XF8A 2I87A 1UDCA 1KSJA 3QHPA 1RZVA 1VQPA 4DBVO 4RTLA 3NTIA 2J9GA 3NWOA 2J4CA 2ZL5A 1JHVA 4XD7D 1PLJA 4E2XA 4YQFA 3VYHB 2VHJA 1ONNA 4PE5B 3S2FA 1FMCA 1QR2A 3EA5A 3QKRB 2MYNA 3W3AD 4X1OA 5FCDA 1DC4A 4TZKA 4OBWA 1F1BB 1NG2A 3LCVB 4PN7A 5KTKA 4RENA 3ME9A 4C7OB 5KWSA 1WSDA 2WG2A 3R41A 4WT7A 1BXGA 1HOXA 1VTKA 1EX7A 1YR7A 4RY9A 4BDTA 1SR8A 1Z2OX 3Q15C 1YBYA 4EL0A 5AQEA 4FDTA 3LUDA 1OWNA 4U7FA 3W3ZB 2DERA 2IDZA 5B30A 3IOYA 1L4MA 1X14A 3EWIA 1IJBA 1IE3A 3LLUA 4Q7QA 2FLKA 4A8HA 3I01A 1OWLA 2UVQA 4D6XA 4N5DA 4U0KA 3G8DA 1ZD3A 3RC9A 1KJ8A 3GT3A 3SZLA 1V5EA 1QGED 2NV2B 4AWXA 1JLLA 3GQBB 4RJJA 3II6X 1VHLA 1FVHA 3KD2A 2BFOA 4D96A 3QFCA 4ON9A 4G0XA 5FBVB 2ORIA 2V7PA 1ECBA 4G84A 4KQXA 4IUQA 3BFKA 1JDUA 1SGWA 4ZU3A 4H6PA 1TLLA 4TVRA 3PXCX 3ASZA 3UWOA 1MRSA 3ADOA 4FDUA 1KKUA 1TCVA 4KK4A 4OEHA 4OVKA 2ZRMA 3E5MA 3NDIA 1BDMA 5AKJA 3JCMh 1FUUA 3JYPA 2K57A 3HRHA 2DL8A 4DOWA 1L4HA 1JP7A 5JDCA 3AVWA 2QTBA 4TLCA 3OBYA 1RAAA 2MCNA 3DL2A 1UGPB 4DWVA 4JOQA 4KQIA 4TL7A 3VZSA 2W4IA 3PPVA 1T1SA 5CPBA 4EH1A 5DLYA 4X6UA 3KEOA 1QDEA 1SZCA 2GEBA 2ZPFB 2I3BA 4R2LA 3UEOA 2VTDA 1U31A 4CUZA 1DX4A 3OYFA 1YV9A 3C1TA 1W25A 3TIIA 3TH5A 1PNQA 1QH1A 3RUIA 3X1DA 4Y18A 3TM4A 5K3FA 2P67A 5I7EA 2E4YA 1A9TA 4RKFA 5T4BA 4FR0A 2X6TA 4U0JA 3KEMA 1O6BA 3TG2A 4MMKA 2FUG6 1L3BA 3O0DA 3ESBA 3BIXA 4RX1A 2PLWA 5AYFA 3ZU2A 5A4DA 2VRNA 3LQ6A 2H1LA 1K4KA 1X80A 4OAPA 2XB6A 1R4NB 4KBYA 3ECSA 3KB2A 3KUUA 3VZDA 4OHWA 1YI0A 4AVYA 1Y0BA 5KO2A 4P22A 2QRJA 5CM2Z 4JNCA 3AB8A 1SPBS 2G6TA 3OE5A 2YXDA 1HYOA 3B5JA 5EJ9A 5GQSA 3QNMA 1VQ9A 1A7UA 1RRGA 5GONA 1FTQA 3ISTA 1YJ9T 4F91B 1V43A 5AH0A 1XU7A 3N2IA 3SWNB 3O1IC 4E14A 4P83A 2FEMA 2FPPB 1GBRA 1DZIA 2ATIA 2L3SA 5BWLA 5JS7A 5KOYA 2VXBA 1H4TA 3ZKWA 1SQSA 1ML3A 1Z8NA 2XTMA 3OE7A 3C7KA 1R1DA 1LNZA 2W6MA 4JLWA 1NVVR 4YJHB 2WJ6A 1W9MA 3T7AA 2OQVA 4RHFA 1E96A 2XE6A 2WUWE 3ADPA 3G5UA 2ZIWB 4HAYA 3WFJA 2O4XA 4PTYA 3PUJA 1YHQQ 3TMYA 4B5KA 2X22A 2NSLA 5DBFA 3FMPB 3K9QO 3ENZA 2WEKA 4B3FX 2ENUA 3NEJA 5BN5B 4FGLA 3NAMA 3GLFA 3PQCA 4UBLA 3HC7A 1OZ2A 4MUGA 1N4AA 3I23A 2PVGB 5ALTA 1HQDA 2H4WA 3MHPA 4FHGA 2H2WA 2FLVA 5A5DA 2PD4A 2VT7A 2ZT6A 3Q6QA 1ULAA 1VQ7T 5EHQA 3HM2A 4YUYA 1XFDA 1YD7A 2IEBA 2IPMA 5EKXA 5IABA 1XYGA 2FA9A 1HTTA 3TW8B 2JJ1A 3DE3X 1TVCA 5ALRA 2FG7C 4KC0A 2X7XA 3JB9J 1QQAA 4X9DA 2QXTA 3ANMA 4MUBA 1ILEA 4QYIB 2HWYA 1K97A 1IZ7A 3QA3E 1UINA 1MDFA 3RHTA 4BFZA 1XVAA 3KQTA 4NJOA 3NHPA 3O82A 4HYQA 1E5QA 3KSMA 4B3GA 3H5NA 2V6JA 2VGMA 1QZXA 3LZCA 2ZB8A 1RRFA 4BB0A 5CK4A 1W52X 1SIWA 5AW2A 5FXMA 1WIWA 4E7KA 4L15A 1A2KC 4ZK6A 4DV4B 4F71A 1NJSA 3C45A 2HPZA 3M6VA 1P5HA 5AHOA 5DWVA 1EWQA 3P32A 4D92A 1R50A 2I6FA 1IXDA 1YJQA 2I7DA 3MRVA 5KSPA 1RMTA 4KIGA 2I66A 5J26A 4JIGA 3LIPA 1G60A 4C0JA 1Y6ZA 4RTWA 4KWTA 4HYYA 3P5BA 1XMJA 2ZITA 2ZROA 3ZBPA 3DKRA 2OFXA 2DR2A 1YB6A 3F9RA 4N82A 1TCCA 1Z0SA 2Z58A 5JSYA 4G85A 1EWVA 1SD2A 5EEHA 1VA5A 3JD3A 3KJQA 4OMUA 2JJ2A 1YP5A 1VRWA 1UXIA 1R8XA 1UR5A 3LGSA 5FEMA 3D6UA 4G4SP 5HCKA 3GMDA 1MRNA 3DWIA 3J81A 1AMNA 3URMA 3WDKA 4NC9A 1Y6FA 1VQ4T 5DSTA 4DIBA 2PDAA 1IL0A 2A57A 2ZT5A 5B1IA 3T9AA 1YVEI 4QOIA 1IZZA 1OPXA 1Y7XA 3FYUB 2XYGA 2VO1A 1BEZA 2FPLA 2VTVA 4PTZA 4NAUA 4KGVA 4KXQA 2VC2B 1IN5A 1GZHB 1SZJG 3RODA 3KHKA 4FMDB 5BV2P 2J4FA 4XD2A 2VTKA 1CJUC 3DL0A 4JEIA 2ZI9A 3KPVA 2XB4A 3VVLA 5AK0A 5AVRA 3O0TA 1BGVA 2BN4A 1M2GA 1XFAA 2QT1A 2FR0A 4RACA 1USUA 1PWYE 1T3GA 4OPMA 1UMDA 4IZHA 1CP2A 4B09A 4KSBA 4MKGA 2H3EB 2WMNB 2WIJA 1WXQA 2RIPA 4FLEA 2AOVA 3SBOA 5G0TA 3JB9H 3DAYA 4MNTA 2WA2A 2NPFA 3RC7A 1K9AA 2AKEA 3A8IA 4GPTA 3I6IA 4Y1EA 4BJ6A 1T0HA 1M90C 2FEXA 4FW8A 4C92D 2A9RA 5A02A 3PHCA 3A4YA 3PXXA 5JXWA 3K4PA 5AW8A 2VHQA 4NE2A 3C4VA 3PC4A 2PTKA 3RYIB 4HJXA 5EZYF 2ZTGA 5CA1A 5FR2A 1VP9A 3CC2B 2ED0A 1JBEA 2XDYA 4L1KA 1OU9A 2EDCA 1TVMA 5JLAA 3KQMA 3EPRA 1FMTA 4IJ6A 1TVKA 3OYCA 3H6KA 2VHEA 4GU5A 5C18A 1PZHA 3R7WB 2I0NA 4NMLA 1RE0A 3KL4A 3RUEA 5JYEA 2B8AA 1ZOLA 3ZW9A 2FKNA 4ZKDA 3QF4A 4RLQA 13PKA 2RBGA 1QGAA 1YA8A 2WUFA 5HXBA 4MSUA 2C3MA 4XI9A 5JCXA 1D5WA 2W8ZA 3JVEA 1O9BA 5IJWA 1DINA 2YVQA 3A2NA 1UJ0A 5DW3A 3QJYA 4C9BA 3PQ4A 2BRUA 2GILA 4O0MA 1NJID 3CUSA 3W04A 3WJ2A 2J33A 2E89A 4C0DC 2R9VA 2VDRB 4B17A 3GCGA 4H18A 1ZZEA 3JYLA 3I1FA 3DBOB 1OLUB 3GZ4A 4DA8A 3QDRB 2GBGA 2B78A 2QXFA 4BAGA 2QZSA 5LZ7A 1TZCA 5DI3A 2H6EA 4DBLC 1MT0A 4R1TA 4CLOB 1CEYA 2AEMA 1ZGJA 1NEBA 2FTKE 1NIJA 4HP8A 3E0QA 4BFUA 1RPJA 2FPDA 1K68A 1OHHD 2QSYA 2IITA 2XBLA 1ISRA 1WI7A 1HE8B 2C9ZA 1YBHA 1KVUA 4YCNA 1JDVA 4Q6BA 4EEKA 3CUTA 5E7QA 3DE6X 2B94A 4G5GA 3NBMA 1O87A 2R66A 4GLLA 1IN1A 2OHIA 4ENTA 2QLFA 2FFQA 4OAOA 1L7QA 4JJFA 5IBQA 2CMHA 2L3PA 2P5YA 3TQIA 4CETA 3PEWA 4BP3A 4ZGGA 1K8AU 3IFSA 3E2IA 2NWQA 3B6KA 3L2VA 3E5HA 5JSFA 1QRRA 5L3SB 2W2KB 3HBNA 3ABRB 3BXPA 5FPPA 3GRFA 5FTKA 4UU0A 3L1UA 4E4RA 4I4IA 3OW2P 2D2IA 4XDZA 4M7AB 3DAHA 3I32A 3K35A 5BW6B 4QRHA 1PR4A 3ASQA 2EQJA 1G8SA 5KJ6A 4FU6A 4Z1MA 2HF7A 1RBYA 3KYCB 4LSZA 1Q1BA 2DX7A 3T3HA 5DGTA 5KVAA 5E7JA 1E4VA 3D8RA 1D6SA 1HYHA 3AHGA 3NOVA 3K0AA 4AJLA 1DAFA 2CMKA 5GMKe 1O03A 4QXQA 2J0SA 1GHTA 2RK6A 4MW0A 1BBZA 5CKDA 1PNTA 2ZAMA 1KP3A 3RRFA 5I3CA 4L57A 3NBZC 2X19A 1RWPA 1PWHA 3UT5A 3MWEA 4JKYA 5CX1B 2NP6A 3CCST 2FW8A 4BFLA 2XB2A 4BUZA 2GM9A 4MA4A 3QYAA 2OLKA 3FCXA 1XDDA 1BLIA 3X2EA 3M34A 2GTIA 5CT9A 4LXGA 1S72B 4D0NA 3PFIA 4Y9TA 1WJSA 5ILGA 4Z53A 3SS9X 5FWCA 4XA8A 1RAEA 4OMPA 1MMAA 2B9EA 5B36A 5ECDA 1ECJA 4XGRA 1VCIA 5IHNA 1J70A 2PQ2A 2F8LA 1G8FA 4H08A 1QZZA 3O75A 3TCNA 4TL6A 2QL9A 4RCBA 2BGLA 4ARSA 1F4VA 3FNGA 1D04A 4EA7A 5AESA 1PR1A 4KXLA 4ECEA 5DNEA 1YR3A 3P9IA 3UAXA 1PJCA 1RTTA 1K9VF 2QAZA 4BMCA 3K0FA 1OZAA 3ORFA 2J7PD 1JVSA 5H80A 1VKZA 3H0FA 4YI5A 3UK7A 3L6RA 1FDOA 2VDVE 1E2PA 1G8GA 2VRWA 4HH1A 5BSHA 1YCGA 1XPRA 3IQZA 1RKXA 3K5HA 3T3OA 1ZW1A 1LCIA 4GYKA 3LS2A 2HWKA 1F60A 1E89A 4RLSA 3GLUA 2QRKA 4GMDA 2GZ3A 4RFVA 1UJYA 3N7UA 4F6LA 1W6XA 5IUKC 3TTYA 2J9FA 8AT1A 2DLCX 2IW1A 1KK1A 1PIWA 1KY5A 3NV9A 2AD5A 5AT1A 3JCZA 2IYAA 3CB2A 3COSA 1VZ2A 4RV4A 4BE0A 2BGWA 3JVDA 1K9MU 1ZNZA 1M7HA 1MH9A 3O3NB 2Y0PA 3SM3A 3R7LA 5CFZA 4YJ2A 4MHOA 3SFTA 4JR1A 4ZOLB 4H7DA 2ESWA 1I8FA 1AOXA 5I4KA 4BIMA 3PXBA 4BQIA 4MWSA 5DBIA 4UKDA 1XZGA 1JEEA 2A30A 3GNGA 4ID3A 2E65A 1NZJA 4Q05A 1Q16A 5IZ4A 4UC0A 5K99A 5HJ5A 1JHUA 1BCOA 3IJPA 2WZNA 5FWDA 2LE0A 2GAOA 2HQBA 2A2ZA 3CPWP 4DWWA 4H17A 5HK3A 1N5JA 2L19A 4MV5A 1W5FA 4R5HA 1HE4A 2B4AA 4BKPA 2FRVA 4FHEA 1V6AA 1OXMA 3W5AA 4ZV9A 3QVKA 4YJKA 5F52A 3KL2A 4IGEA 3M4YA 4LDVA 1N5OX 3L8ZA 3H9CA 1US8A 1JHAA 3T99A 4P80A 1TM7E 1TVEA 1K6IA 1N06A 5EXEA 3VR5H 4L3WA 5FADA 3ZV3A 2V45A 4GOMD 2HK7A 5F73A 2V5AA 4EY3A 2F9FA 3L6EA 4PJMA 3I58A 1JPJA 5HZHA 3CC7Q 5K6RA 4RJ2A 1U8XX 1IPFA 4EMKA 4XTWA 1PI3A 1JMYA 5GVSA 3BRCA 3WISA 3WB1A 1F1JA 1YE5A 4P26A 2I33A 2QVYX 1P0QA 3SXPA 5LQDA 2WP8J 2XY4A 3AFHA 3X3HA 1Z5UA 1HE2A 3AUJB 2OEPA 1T5OA 1S2MA 2LC4A 4HZIA 3HZZA 1YITT 5E2AA 5AXAA 1G55A 4NENB 2CCJA 4RKUE 3RRJA 3MNFA 5A8AA 2XE8A 4GGOA 1E3JA 4MS4A 1QKJA 5I01A 1QV6A 1WDTA 5K6AA 4Z99A 4K3UA 3MPUA 4M1MA 4R4JA 4EGSA 1ZUYA 2I8AA 3MJ4A 2VTBB 1VLOA 3BAZA 5IK2A 3U62A 2JGDB 3IIJA 4HNQA 1ZESA 2QA4B 2H1IA 2PTHA 2Q9UA 2W11A 3OSZA 3S81A 4BGVA 1FSZA 4PC1A 2RA2A 3CC2Q 4GE3A 2B2CA 1CJCA 3VMFA 2IP4A 4FYIA 3T53B 1UECA 4WTOA 3OLCX 2CUTA 4H7HA 5AVOA 3PR2B 2ZAIA 1MGQA 1Y3FE 4I55B 4D4MA 1HNXB 1D9XA 2QRQA 2TRSB 3A36A 4RTQA 2W8BA 1REQB 1WE2A 3KUXA 2Y71A 5C81A 3CQTA 4DQ0A 1XTIA 4K05A 2BLNA 2PV0A 2WNHA 1SCDA 4FYYB 1UAYA 3BX1A 2B4QA 4INAA 1Q7RA 3U44A 3UWKA 1C7QA 1L0BA 3HCAA 1WZ2A 5C1PA 3UMJA 3OIVA 4KLAA 3O2JA 2EP5A 3GEDA 1GGKA 3B8EA 3GDOA 2ZIXB 1KFCB 3K9LA 5COBA 1N92A 3LRXA 2XHZA 5EJFA 2X8KA 4MW2A 2M5SA 2Y2VA 3SZGA 3ID6C 4WFKA 3K9FC 2MR6A 1MO2A 2VN8A 4I8DA 3S8MA 4YAGA 3KQUA 1G2IA 4B81A 1U11A 3SYRA 2GFIA 4Z4VA 2C57A 1OFUX 4F7WA 3U6KA 2W37A 1GZ3A 4Q7KA 3IEVA 1GPBA 3T3GA 2AIRB 4J16A 2GN6A 3NOOA 2WZBA 5T41A 1K63A 1XN4A 3CCFA 3TFWA 2YWRA 3FZYA 3ECAA 2D5BA 1PZNA 3LCMA 4W1QA 3G4SB 1P92A 1X15A 2FSHA 5FFMA 4UC4A 1JQEA 1VRCA 3AH8A 2NU6B 4KKVA 1TK2A 3RSCA 1P6UA 3DB3A 3P45A 4FFBA 3X25B 1I7PA 1W73A 2JEZA 5MN5A 2OT3B 1BI1A 5JZVA 2CC2A 1ZY2A 1XNGA 3IKJA 1NKVA 1L7RA 3C7CB 2VT3A 1HLGA 1UMBA 3TFOA 1MZVA 3QYJA 3KZNA 5ICMA 1KJWA 2VRCD 7AT1A 3F3MA 1QAOA 2IG0A 4FJ0A 2BGUA 5BYAA 4AJ1A 4PG6A 5ALIA 3QXCA 3RFTA 1KMCA 3I76A 1NLOC 4CCSA 2QX8A 4HHEA 3RS8A 4TMVA 4HH0A 4M77F 2WWXA 1GCPA 4L02A 4UFNA 3KLOA 4JKOA 3WQRA 4HADA 4MO2A 1ZJZA 3RHSA 1CT9A 2I3AA 4OQPA 4TLMB 4EKIA 4IZOA 2VBCA 4CLXA 3T3IA 5B1DA 1CQIA 2WYWA 2QRVA 1TAHA 4RDLA 2QUAA 4JLBA 1J24A 3H9EO 3R09A 4RHUA 3GVIA 2JAPA 1LDGA 4CEHB 1Q11A 2XTZA 3UAZA 3S2ZA 4N0MA 1LS1A 1J1IA 4A4FA 1G63A 3Q9LA 1AC5A 2AVDA 4D45A 2X40A 2C3OA 2GESA 2HMYB 4QKQA 3CCLA 4G9BA 3QXSA 3WNQA 1JTFA 2XD9A 4LE1A 3KBGA 1JG7A 1N6PA 5DKFA 1T29A 3H5TA 5K2MA 1NLFA 2OMKA 4DQLA 2FP4A 3A6KA 4OMCA 3L6UA 5KAMA 3NPFA 3AUUA 3KUKA 3PQ6A 3H1TA 2GXAA 4G5XA 4DGSA 4KE8A 4L6IA 2XRYA 3H5VA 2KY9A 4F7UA 2ZUSA 2MMPA 1M1YB 4LYEA 3VS6A 1NI4B 4FYXB 1S72Q 1ATIA 4R2WA 5DCYA 1P1JA 1AKMA 1N32B 4DHEA 2Z0WA 3R9IA 5AYVA 2X4XA 1BHJA 4X41A 4X8MA 4DQXA 3QPBA 4FB4A 3FDFA 2Z5LA 2EX0A 1HYQA 1TW3A 1Y1PA 3DM5A 3DV2A 1XKLA 2IPOA 3PEEA 1IZ6A 3CD6A 2C77A 4PYMA 1ZJYA 2XB8A 1BU5A 5CXQA 2C99A 3CH5A 3RUCA 2HQXA 2OK8A 2ZRPA 4IIFA 4GFDA 1VYHA 2C42A 3BXGA 3QVLA 1NG1A 2PE3A 4GQAA 4JNKA 3LPNA 1WCIB 1PDOA 3ON5A 3EC1A 1PP4A 3LUKA 3DNMA 4RYLA 2VBSA 1KZ7B 4EG5A 3WK6A 5JD5A 4Y9UA 2P5SA 4B0OA 2I34A 1W85A 4F2WA 3G71B 3EIWA 1V25A 5C7IO 3ZHOA 3UOGA 3AYXB 3ESCA 1WJGA 2XI4A 2HY7A 4PLFA 1XA0A 1U1DA 1TF2A 3MMPA 3T7JA 1TF5A 4MGYR 4TS1A 3N1UA 2H1WA 4AFZC 4WFJA 3ZXYA 4UNQA 4DJAA 1C9KA 2VUBA 4HXYA 1ZKMA 4YQZA 4PAMA 5ALXA 4BVLA 2R6GA 3D3WA 1SC3A 4PLTA 2QGFB 3A32A 1GCQC 3SSOA 3GVKA 4D4JA 4JXKA 4GOND 1CB0A 4DNXA 1I2DA 7REQB 4UVGA 4Z3KA 4Z3OA 3PVLA 3WNBA 3D6FA 3DTTA 1WPYA 4A6DA 2DF6A 3T0GA 4IUUA 3Q87B 4ALKA 7GPBA 3NNDA 4AKEA 3UHOA 4NP6A 5I48A 4DG5A 1OXKB 1T5LA 3KO8A 2E64A 1KK0A 1OILA 2ZAGA 3K5IA 3AF1A 3ONYA 1VQMA 1PS9A 5F5XA 5IUNC 3RABA 3LXRA 4TTTS 4RWEA 1I8TA 2IBMA 3ZHXA 3UMCA 3LDUA 1O6CA 3K1AA 1ZK2A 1U06A 2EW1A 2BEVA 1SNYA 5JMOA 5BWOA 5EMLA 2LR0A 1VE6A 1SCBA 3C5EA 1ZX1A 2YHSA 4JCCA 3T7RA 5C53B 1WHTA 2YHIB 4TYMA 5A2GA 1CHDA 3CM0A 4HCZA 1HEIA 1JDZA 4GL2A 2DPLA 3IO5A 5HKLA 3ED1A 3L5OA 4B47A 4QRIA 1J00A 1KXJA 3L07A 1TU0B 2N9UA 4Y1GA 2VYND 1OKKD 2XUJA 3UJ9A 3TTTA 5I9BA 1Y0YA 1CUAA 1G5TA 2C5FA 621PA 1WA7A 1UODA 2OAUA 3V76A 1L4BA 4YBRA 4LW8A 3P2KA 1WXEA 3GDGA 2XNDD 2D0NA 1QVFA 1L4EA 1N5IA 3OMLA 4ZTJA 1QQ7A 3AM4A 1JB9A 1RKVA 1AT1A 4AY4A 1HZZA 1U3CA 3DEJA 4YS6A 1QP0A 3HKDB 2GVDC 4HPWA 5LP6B 4KRTA 2A28A 2KE9A 2YUPA 1M8JA 1JILA 4S2UA 4I50A 4G0YA 5JG7A 4GMKA 1NXSA 1JEQB 3EEFA 3EQ2A 3IERA 3MJEA 3E7PA 4XR6A 2D2FA 4D8UA 4WNIA 3PRJA 1SQFA 5DBHX 2KAFA 1OV6A 1XZ8A 4JV5B 4HWGA 2DFUA 2OYNA 3DDYA 4F17A 1TJNA 4Y7CA 4LDAA 5LZ8A 3MJHA 4O29A 3AOEA 2Q5HA 5ULLA 1NW9B 2JATA 3CF6R 3H97A 3JASA 5HKKA 3KALA 1K1EA 3N2KA 2YNMD 1WWKA 3OW2S 4BX0A 4OYHA 4QU0A 4RPKA 4CG3A 3OJOA 2J06A 2NU8A 1RBQA 2G7MC 3MQFA 4EHNA 4EAQA 4P7BA 1IQ0A 3M53A 3JCMb 1UBFA 2PQ0A 2VEOA 4YMIA 4LDPA 3JCMe 4FQ5A 3USCS 1KD1R 2E2WA 4Q12A 3V8RA 1NWHA 4OQQA 2QROA 1NR5A 2C03A 1TIKA 1DQYA 3NFRA 1X8XA 4KRYA 2RHIA 3THOA 4R2KA 4R1NA 1DBIA 3NG1A 4HLUC 4OPVA 2A1IA 3DM9B 2QA4Q 3ONFA 3BK7A 3H84A 4BNMA 4Q9IA 4GDMA 3FOFC 2AZSA 3P1JA 1ZWKA 3DUFB 2O01E 3QLTA 3PT9A 5TR9A 5DW0A 3IPYA 3JCMW 4M0MA 4PHHA 1FX7A 2ZRHA 4Q4AB 5A9SA 3QSUA 5CB4F 1E5VA 4C0BA 5HXAA 3KQPA 2Y1FA 5EN4A 1KVSA 2DH6A 2RGAA 4DMUB 3B1FA 2I9PA 5GGXA 4DCNA 2WUEA 4RF3A 3MS4A 3S1AB 2H5IA 2ZDQA 1Q1NA 1C9YA 4ZVUA 3H94A 2EJWA 1ZMRA 3TTSA 3CEYA 4E46A 2LQ8A 1ZH6A 3K0CC 1CYEA 3FOZA 1G6OA 5SY4A 1EUQA 1J07A 2C88A 3FUCA 1JAZA 2Q6VA 1B00A 2EKDA 2FU5C 2ZSEA 4D9CA 4RS4A 3NTXA 1T0UA 2NG1A 1HT1E 5T57A 4D8WA 3IUYA 2BDEA 2PGJA 4V39A 2ZPEB 3OZUA 1P7CA 1BIFA 2DZ9A 3MILA 2FSGA 3BRSA 3ASYA 2XG8D 3VS4A 4RPCA 1RHMA 5CBPA 3H3JA 3RR2A 3EB9A 3U7QB 4ZT7A 3IUMA 4YRNA 1Y98A 2E5LB 1R88A 3KR2A 4Q47A 2P30A 3D8SA 4F2HA 3GZNA 3ZZMA 4P36A 4PYIA 2J3EA 1XLTC 4ITUA 1RLPC 3W2EA 1ZR2A 3GJQA 5GAOq 5F5LA 1I2BA 1X42A 1CRWG 4EW2A 2QTTA 4Z2AA 1J5XA 3NALA 1ZICA 4MW1A 2BR5A 3QPDA 1P80A 4TM7A 4M7DD 4ETWA 4II3A 4CC7A 1X3LA 4RTKA 1AV7A 2K7ZA 1UE9A 4HXEB 2BM1A 1YHQB 1WMEA 3IH5A 4JUAA 1JMKC 3R5FA 2GZAA 3RHZA 2BV3A 3AP3A 3N28A 1I2CA 1GTL1 3C48A 4GMGA 4YROA 5K0ZA 4YUAA 5K0EA 1XCLA 3MP8A 2J3QA 4OKNA 2WDZA 3F67A 4N3AA 5DTRA 1CUYA 1E2MA 4J91A 3GIBA 4C5AA 4ZCSA 2B6HA 2I8CA 3UTDA 4I6EA 2CLLB 2LNDA 1IY2A 4PJOG 2LCLA 2WVHA 3PFSA 4W1SA 3IP6A 4QUJA 5IMSA 2DOKA 1HDXA 1Z82A 3C14C 2R86A 5DP1A 1GCGA 3DEZA 3AL2A 2QMUA 5BV0A 1H23A 2JIZD 2VK2A 2J6KA 4N3GA 2P9JA 3WIDA 1J8DA 3RLIA 3MMXA 3CCJT 3WLEA 1G291 2JGMA 3MT9A 4QJ4A 2PRYA 3TSOA 3BDVA 3RSOA 4JBLA 1FVOA 5JNUA 1ODJA 1QAMA 2D5IA 3OT4A 3RTEA 5KYNA 1WMSA 3K72B 2B61A 3KM0A 1TQ6A 3AVXA 1E5LA 2J5KA 3OCWA 3ROEA 3M9LA 5DHQA 2GXQA 3CR8A 4N6GA 1K9MC 4O2BF 4BKMA 2OORA 1YQQA 2H0RA 2COYA 1BGWA 1S2LA 3HABA 3VNRA 2IZ5A 4IR7A 4IDAA 4P53A 2ZJ4A 3B9QA 4R1SA 1T0PA 2YHAA 2JS7A 3GU3A 4WH0A 2FWBA 3L6CA 3DMNA 2O8DA 2H00A 5IG2A 4B80A 3EZ9A 5FLEX 3PFNA 1VE9A 4ITRC 1NQWA 2AQIA 4AMGA 5H68A 4Z9YA 3JS5A 5JSUA 1NLZA 1SUIA 4BY6B 1KBQA 4DNOA 1RPZA 3SQLA 1PGOA 2UYOA 1LTHR 4HDSA 1DVRA 4G7WA 2EW2A 2WWFA 1LZKA 2BZ0A 2PA3A 4F96A 4S04A 1QCFA 1IIBA 1KPGA 4OP7A 2E12A 4UPEA 2PGLA 2XKJE 2CXPA 3UJAA 4H3KB 3RYCA 3ZDFA 1LB1B 5CG2A 1X1SA 1YB7A 1EVQA 2OV6A 3KDAA 5GANh 2YOHA 1N9GB 4AX8A 5KVSA 1RRMA 1Z6QA 4K11A 1WPQA 1IG0A 3ZDXB 4U7WA 4QBTA 5DEOA 1N6IA 5CJJA 3LZDA 3CFYA 1BW9A 1NQVA 2QAIA 2G5TA 2Q62A 5H4GA 4WZBB 3EQ7A 1U7HA 2AXQA 2CWWA 4N7BA 3UMYA 4OX9Y 2LX9A 5EHIA 2F2VA 5JISA 5K3BA 2W2NA 4B82A 3ZOKA 1JU4A 1SIUA 4Z7JA 1HC7A 1QHNA 3MWDB 4DCMA 4K7JA 1O6ZA 4H15A 3THKA 4HQNA 4LWZA 4MKRA 3T4EA 2WSFE 1FDTA 4NCJA 3RKWA 1BWQA 1MC5A 1WXIA 1HORA 4DLUA 3FEOA 3CUEF 1RXSA 4M78C 2J9YB 2CFOA 4HUJA 2XGOA 2FMIA 2WKPA 2YHTA 2BUCA 1G66A 5L8VA 4Z4SA 1QFSA 1Q50A 4KO2S 3W2TA 5IPFA 2NAFA 5F12A 1LS6A 2W98A 1W44A 3WJ1A 3PX3A 1YRLA 2LPMA 3W9YA 2GN8A 3K94A 2O31A 3DKMA 5HA5A 5TPWB 2DK3A 4JUIA 2OQRA 5T67A 5TPZA 1L5OA 5B58T 4ZV4A 2NUTB 3ELYA 4BB6A 1XTZA 3U4GA 1MAWA 1KS2A 5LMCA 1V8DA 3GUYA 3IDQA 5DCWA 3I09A 4C8QD 5KNCH 1SHZA 4QRDA 1WS6A 2NOAA 1HM5A 5FW9A 4FS3A 2CNNA 4F9GA 4V38A 2LNHB 3LY9A 3MWLA 4S0ZA 3J7AF 2QMEA 4M78D 1XRQA 4I99A 4P0PB 4HDOB 2ZIEA 4DDWA 1EM8B 2XB9A 2OCLA 4NQRA 5KQSA 2Q07A 1ORRA 4FE3A 5MGNA 4WCFB 2B9VA 2ZUUA 4J7FA 2VKNA 2VJBA 1S2IA 1WB9A 1MABB 4FNMA 1QCDA 3TE6A 4X7DA 1XZCA 1X27A 3WLLA 1FLNA 3DR5A 1KI6B 3CKYA 1KKLA 5J4VA 1BYUA 4GX0A 1KQGA 2FE1A 1M3SA 4N0DA 4OHPA 1Z0AA 1THTA 4RF5A 5JS6A 1ZGGA 1NI3A 2DJQA 1Z2NX 3H2YA 1Z0UA 4HSGA 3AR2A 3EG9A 4GP9A 4HB4A 3B70A 1GU1A 1CS0A 1P0IA 2F67A 2HQEA 3RVOA 1N0UA 1OY1A 4XWTA 2P2ZA 1II9A 3TPCA 3M5AA 4H31A 4YV2A 2X4IA 2VDUE 3O83A 3PEVA 5E6SB 2CJWA 1T1GA 3QEMB 2P35A 4OREX 3CMAT 2NYVA 4JVOA 3N8GA 4JYCA 3BF7A 1WR8A 2JOYA 5F1KA 2A0YA 3S3OA 3DXYA 2WIAA 3ASPA 2CXTA 2OB2A 1SBZA 4GEGA 1PFGA 1QM5A 1T3TA 2AFIB 1D2NA 1V1JA 4CKWB 3B13B 1P18A 5FP0A 4I6GA 1Z73A 2GLXA 3ASUA 2HMWA 1PF7E 1SKUB 3R24A 2I2BA 3DMGA 1SXJA 4IICA 3OB9A 4AY2A 2OTJT 1EIZA 1CUSA 3JCMX 4M46A 3VZQA 2Z3WA 4PZCA 3FNQA 1TQDA 5E9WA 2ID7A 2ON6A 1KGDA 3FZNA 3TR0A 2NQTA 1X7WA 3ZCSA 1A8IA 3T3EA 4I5GA 5BSWA 4YCLA 1RAHB 4F4FA 2Y0DA 3IR5A 1DQNA 4PO1A 4PM4A 3MQ2A 3V8PA 4LSMA 1KAQA 3ZHYA 4PPNA 4XWWA 3DDOA 4MV4A 4A6XA 2K6GA 2ZP1A 1UJ2A 4HD8A 3H13A 5K03A 4M75D 3W5VA 1GKIA 1QDLB 3OH8A 4P2BA 5D5PA 3PFHA 4PXSA 2FEOA 1F6WA 1TUGA 5EZQA 4R0KA 2ENWA 5NLLA 3HKBA 1VLHA 1RBMA 4MXDA 1FFAA 2JGLA 1KQ3A 2DT8A 4ETMA 4PONA 1NL3A 2E4WA 3PWTA 1G8YA 1E18A 4G1CA 4IEIA 3ENVA 5F4OA 3DWEX 1AZEA 4XGKA 1AVTA 4UMDA 1YFKA 3QHSA 2MMCA 3VU3C 2QE7D 3WNVA 4U6SA 3O8OB 2EJCA 4ND2A 3OIDA 1FFXB 5JCJD 3LYLA 1V76A 3IHKA 4O1HA 1CY8A 2DHCA 3O9VA 3H9NA 3FOEC 2IS2A 2WQ7A 1KK7A 5J43A 2WY2D 5FKJA 2DBRA 3NYIA 4X7BA 3L8MA 1T2EA 3LZ6A 3F97A 3RMSA 3SQWA 5TEVA 2R00C 1RZ3A 5HRUA 5AI4A 2CL7X 5HIIA 1AEYA 2H59A 1EBUA 1AK2A 4I50F 4F45A 1NNUA 3AU9A 2XZOA 4OHYA 2RAUA 5AVZA 3K32A 2X23A 2G1AA 4BO9A 3V2UA 4B3JA 4MLCA 1UPTA 1PK9A 5FOQA 3PFFA 2MCFA 1MO4A 2BI8A 3O8BA 3E9CA 2D8AA 5KWIA 1GKKA 5FWXB 4ID9A 2IHJA 4D79A 1N0HA 5K0NA 3TOZA 1OW3B 3LUPA 3GHHA 1KI9A 5EWMB 4KXWA 1AKWA 1QHIA 3GJXC 2X8AA 3QG1A 5FDFA 1KZYC 4UHDA 2Q5IA 2O07A 4JXJA 5J58A 4TSKA 5JWHA 3ZD9A 5FUMA 3N5CA 2XK0A 4BO2A 2X8JB 1EFTA 1YTLA 3FH0A 5PNTA 3KSRA 1JR3E 4Z88A 3OY2A 4DILA 1UQUA 4WACA 1UEIA 3VVMA 1IUNA 5LKRA 2HA5A 2NVOA 2HU5A 3DT6A 2BIVA 1VQ5T 1SBQA 3DE2X 5A4FS 3G2IA 3C7DB 2OXFA 4DZTA 2ZVQX 5BOSA 4CDMA 2VNSA 2QZ4A 1UT8A 3B2NA 1SK9A 1EFHA 2LZ0A 4E5KA 3WAJA 1BVUA 2RJ3A 2W0ZA 1P4JA 2C00A 1NN0A 4YRTA 5GAN3 1IBCA 5H16A 2WM9B 4FC7A 5I7UA 4S2EA 2RI6A 2G0TA 4K6KA 2EATA 3H1BA 4FDMA 2H3JA 3WQSB 5JSZA 3KRTA 3U4CA 3ER8A 3ILHA 2BBTA 5CLQA 3OZRA 4HNUA 3VKIA 1PLLA 1KS9A 2X41A 3PDJA 2XYPA 4LA4A 1CR6A 1EXMA 4W5JA 4KP7A 4BO4A 4DRXA 3GGOA 3HU5A 4RSHA 2VDJA 4MTCA 2RH9B 1Y8QA 4GX2A 3CPEA 5LQMA 3UV6A 4YY3B 4HXJA 2PSEA 5CA0A 3LC1O 3E81A 5C5IA 4HNSA 1IXKA 3G05A 1T8PA 3BB1A 5JXIA 3D7KA 4MV8A 1XAIA 3T0FA 1LDYA 1VQNQ 3FZQA 3KBOA 4HVAA 1JW9B 3WWPA 3DTVD 2ZZFA 1A76A 2V7GA 5EXPA 4QV2A 2FUKA 5TNXA 3TM5A 2PQMA 5DTMA 3NIBA 1RU3A 3BPSA 4UW9A 1ZVKA 2LT1A 4FKMA 4G1VA 3RR6A 1W5EA 2P2SA 2R1VA 4NH4A 4MW9A 1GCIA 4R5MA 2IY7A 3QO3A 2EL7A 1QG6A 2GSDA 4LTMA 5HM8A 4FFOA 1OX4A 1ODIA 4RPIA 1NVEA 4CMJA 2RHZA 4C92C 5J9FA 1RHUA 4AXBA 4KH0A 4MRMB 3WWZA 4DMKA 3WO1A 3CC7B 5EIOA 3OY9A 2FSFA 3G5AA 1Z18A 1IAVA 4W5NA 3K6SA 3JQBC 3T3MB 3QVSA 1MX9A 3I9FA 1KHTA 5DHUA 3REQB 5K4AA 4WOBA