2DETA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the pre-reaction state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
365
structure length
365
Chain Sequence
TAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 85
structure length 365
sequence length 365
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2detA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2detA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2detA01
3G59A 1N2GA 2BGIA 1O97C 3FG9A 3E27A 3WY9A 5DK4A 4DDMA 4CDNA 1NUTA 1WXFA 3RBAA 4MULA 4NDAA 3OZUA 4ZCRA 4CQNA 1EP2B 1M1ZA 2XEXA 2HCJB 4ZT2A 1W87A 3MUEA 4MLPA 3SDBA 4K0RA 4Q7JB 1J1UA 1QQTA 4DDKA 1GAXA 1EP3B 4Y9UA 1MBZA 2E0IA 2QUKA 4JYZA 1CNFA 1KQSB 5TEWA 3SZGA 1GTSA 3DPIA 2VNIA 2VZLA 5THXA 1OWLA 3TQOA 3CLTC 4I6GA 3W2FA 5IHXA 1YJNB 2B7CA 1NUQA 2D5BA 1JIJA 1O5TA 1VL2A 1Q77A 2O8VA 1IQUA 4ND7A 1G7SA 1R6UA 4DQKA 1QH0A 3WYAA 2J08A 2I1LA 4MUNA 4Q16A 4MW6A 2CV0A 4ZV4A 1GPMA 1OB5A 4K03A 4ARCA 2A88A 3E1YE 4M0LA 1M90D 1U2RA 3SP1A 3COZA 1D8TA 3ZZUA 1I7PA 2R6HA 2AHOA 3JQQA 1LI7A 2DPLA 1YJWB 4ZGQB 4YAFA 1OBHA 3OTWA 2PZAA 5H16A 3U1VA 2A84A 1EE1A 3FNRA 4DE5A 2OK7A 2ZP1A 1ZM2A 3CD6B 3IMEA 2CYAA 1IHOA 2QJOA 4GU5A 2RC5A 4RD1A 1ELOA 4PBSA 3JQRA 1M8PA 2A1UB 3OJWA 3CXCB 1GR1A 4XFDA 5FA6A 3W2EA 4NX2A 4EGAA 4NZPA 2EL7A 2A1TR 3H05A 3W5HA 1K4KA 1N75A 2BM1A 5KCMA 1KRHA 1WXGA 1TYCA 1OWNA 1GN8A 3D6UA 4YP7A 3TZLA 2GM3A 3CVVA 1CNEA 1WQ4A 4P6VF 1DDIA 3RHSA 1NUUA 2PXHA 3WBJA 1JGTA 3CCVB 1X8XA 4M53A 2WQ7A 4M2LA 1MAWA 3VGJA 1QGYA 4B3XA 4RD4A 5FO1A 3MXTA 1QTQA 1G8GA 3HL4A 3SJZA 1TYAE 3I05A 4YAOA 4FZJA 1QRTA 2Z09A 1F7VA 4QBTA 4LBYA 1KK1A 1H3FA 2GOYA 2D74A 1KQNA 3QFCA 1NJID 4AF7A 1ZM9A 1COZA 1VBMA 3OZVA 3CW2A 3SEQA 4UAJA 2X0KA 1N2BA 1ULHA 3CVUA 5TY0A 2QEXB 5KWVA 3VNUA 5H5JA 1GAQA 2DCUA 1PFYA 3MCAA 1M8GA 2TS1A 3F3MA 3N9IA 3IVXA 1W34A 5FNZA 5JBNA 1VQ6B 3WBKA 4B47A 2J4DA 1PG0A 1IQRA 5J5AA 3OW2B 4ZT3A 2OQ2A 2H29A 2QUJA 1AIPA 2GQFA 4HE5A 3ZZ0A 3IVCA 4R2LA 5H59A 4F7DA 1OWPA 1VQ8B 1NDHA 3CCUB 2VXOA 1TTTA 1KC8D 1N2IA 4ZCIA 1QUFA 1YIAA 2JANA 2DETA 3CVYA 1TEZA 1KJZA 4P3YA 4KPUB 1YJ9B 4YMIA 5FO0A 1OGIA 3FOCA 1ZM4A 1VQ9B 4UZFA 2ZITA 4WQMA 1TUIA 5IJXA 1FYDA 4YP5A 3FETA 4NATA 4P2BA 1N2EA 3IODA 3FDXA 2VNKA 1YULA 1M1KD 1YIJB 2QDXA 4X0EA 1KQOA 3DV2A 1JEDA 2YWCA 2A1TS 1O94C 3G5AA 3CCEB 3FY4A 1VQ5B 5K0SA 2YXNA 1JILA 1G8FA 1ZUNB 1SM4A 4YALA 2Z3VA 4KR7A 2D54A 2PMDA 4QREA 1KK3A 1KORA 3H97A 3ND5A 1A8HA 3UOWA 3AVWA 5KSWB 1TYDE 1PG2A 5DB4A 1EUYA 3ZXSA 1VQNB 4C43A 1U3DA 5TEVA 2R5WA 3PNVA 1UFVA 1XNJA 2QA4B 2BN4A 3UC5A 1R5NA 1M8JA 1IFXA 3N2YA 3PRHA 1BX1A 1EXDA 1JIKA 2VNHA 3U6BA 2YWHA 2C5SA 1QRUA 1J09A 2EIXA 1K8AD 1JMVA 2QTRA 2DXIA 4EG4A 1ILEA 3VMFA 1QG0A 1M83A 4M1KA 2WSIA 3GMIA 3CVWA 4AQ7A 3OJXA 2IP1A 4HPWA 1QGZA 4Y7CA 3I55B 2HZ7A 5GV7A 1GAWA 1NYLA 1EFVA 4EG8A 4G1BA 4AC9A 3CRZA 1CQXA 2HDNB 1WJGA 3AKZA 2C78A 2RC6A 4EG3A 1NUSA 1N2JA 1QVGB 2HGZA 4NBSA 2PFSA 3G6KA 2EJCA 4FN5A 4N3NA 1B23P 3CCMB 1QFJA 2XNJA 3G4SB 1K97A 4RD0A 1O96B 1GJRA 1TYBE 1YUNA 1IJFA 2QUHA 2CSXA 3CCRB 1AMOA 3H99A 4MWCA 3HV0A 1QNFA 2RD2A 3KT0A 3X1KA 4MW1A 3BL5A 4OUDB 4AS1A 2VTBA 3A4IA 4RCZA 1PFWA 1EFTA 3FWKA 2J7KA 1KK0A 3AG5A 3AG6A 3P0IA 3CC7B 4ACBA 4R0NA 3ZIUA 1NSYA 3E20A 1NUPA 2DR2A 4ZCSA 1B6TA 1JA1A 3ILVA 1XJQA 4I6EA 4DNXA 3GUZA 4B44A 2YWGA 3IMGA 2QUIA 1VQ4B 1KK2A 3COVA 1EFPA 1S4MA 1A8PA 1D1NA 1KKUA 3P27A 1JHDA 2J09A 5EMNA 2CYBA 3CLRC 3MMXA 4KKVA 4OJMX 2BSAA 1Q86D 3QE4A 2DLCX 1VQKB 1KAQA 3HZRA 2WQ6A 1TFUA 1G59A 1O6BA 1Q11A 2E18A 3KT3A 1J20A 1O95D 3MLBA 1I6MA 3WNBA 1P7PA 1VBNA 1X6VA 3FJOA 5LFAA 1WXIA 4KR6A 1CT9A 1O0CA 4MW4A 1J1ZA 1K4MA 3CLSC 4ZGNB 2B7BA 3A2KA 3AVXA 1NZJA 1OWOA 4DLPA 3CLTD 2YWEA 4PC3A 1V8FA 2X1MA 3QFTA 2B7LA 1FRQA 3DLAA 1EFVB 1N8RD 2PLFA 5DASA 4CDMA 5TV2A 1FNBA 4NAHA 2D13A 1EWYA 4L2IA 4RD2A 4PC2A 2BV3A 1KD1D 3QTBA 1N78A 1IVSA 4HK4A 4MVWA 1KR2A 3OP1A 2A4MA 4YBRA 3AGQA 1I2DA 1T9GS 5HXBA 4MQ6A 3CCSB 2HMAA 1TLLA 2A1UA 1FNCA 2BM0A 1SKQA 3CMEB 4OUDA 3MMPA 2VTBB 5KHAA 1YITB 1WY5A 4J0QA 4RCYA 1JEEA 1H42A 1E62A 3CA8A 4A91A 1O96A 2OTJB 3KT6A 2PZBA 3ND6A 1Q15A 2EFGA 2FX3A 2BMWA 4NCNA 2DUMA 4G1VA 2NPFA 1IH8A 1FFYA 1ZH6A 1DDGA 3N05A 3CMAB 3L93A 4RD3A 2VYQA 1KQPA 2E1RA 4IW3B 3MHPA 3ZBUA 3PNBA 3ND7A 2QJTA 4MVXA 2CNDA 3KFLA 1NURA 3A04A 3FI0A 1S72B 4MUIA 2BVNA 1RQGA 4U7JA 4WSOA 5LLTA 1DARA 1SURA 3KT8A 2BPOA 1F60A 1O94D 2IELA 1N3LA 2OK8A 3HMQA 3K9WA 4RUKA 3VO2A 1N1DA 1OD6A 1QFZA 5K0TA 3FHJA 4RPIA 5J58A 1QGAA 4H9GA 3W5VA 2VNJA 4EG5A 3RK0A 1W35A 3VU8A 3RK1A 5TS2A 2OTLB 3LOQA 3CPWB 4ZT4A 2QTLA 3B82A 3RFFA 1QVFB 1BJKA 3D6VA 1VQMB 4U63A 4HJRA 4EFKA 1JECA 4ZCTA 1QX4A 2V0GA 4K1XA 4J76A 1G7RA 3LE8A 1GLNA 1H3EA 3AVUA 2ZUEA 4YHBA 1TQ8A 4B48A 4TN1A 3NBAA 2J5BA 1QJCA 4ARIA 4M4SA 2QN6A 4PY2A 1H1TA 1XNHA 3TNJA 4CT0A 3LCJA 2GPJA 3CLUD 3LVBA 1GVHA 3ISJA 1XB2A 1F4LA 1IQ0A 3SZ3A 3ZBTA 3LO8A 1FDRA 1E63A 4Q93A 4N3GA 3INNA 1IRXA 1OBCA 1F9AA 2BF4A 3B78A 4QFMA 1DNPA 4TMWA 2X3FA 3ZJUA 1UMKA 4DQLA 4MAFA 1R5OA 2A86A 4F4HA 5H7XA 3CLUC 3J81k 4EG7A 4FK8A 3CCLB 1KH1A 3W2HA 1WDTA 3X1MA 4TMTA 3VNVA 2NZ2A 1YI8A 3HGMA 1YUMA 3CC2B 4EF6A 2H2AA 4I6JA 3COYA 3Q10A 1VLHA 4BWVA 1EFUA 3A05A 1BQEA 1MOPA 3QTTA 3UK2A 1MB2A 2RE8A 3AIIA 1H85A 1U0BB 1N0VC 1OB2A 4HE6A 2XRYA 1EFPB 4MW2A 2YWFA 4J75A 3WXMA 2AG6A 1M8KA 3CVXA 3CB4A 1EFCA 3NV7A 4G5FA 1BX0A 5F23A 4MUHA 2CYCA 3GLVA 2AZXA 1JB9A 2J07A 2E21A 1QFYA 1G7CA 5AHWA 1Q7YD 1WQ3A 2DEUA 5TGTA 2XRZA 1T6YA 3OZWA 1U7DA 4JZYA 1G8HA 1NI5A 3ZUGA 1IJEA 3TS1A 1R5BA 1ZM3A 3U2QA 1T6XA 4C0SA 1J70A 4MUGA 1KH2A 1N2HA 4MWBA 3P26A 3QFRA 4ND6A 4YP6A 3P0JA 3SEZA 4ZCPA 1MB9A 5HG0A 1D2EA 4LBWA 3N8HA 5HUJA 2PG3A 1KP2A 3AGPA 5DSZA 4L2IB 1KH3A 5AN9A 4GRIA 3UY4A 1LW7A 5EKDA 4MW5A 1T6ZA 3G6EB 1KTVA 4ZT5A 3Q12A 2PIAA 4FWTA 4LBVA 1YI2B 3ZJVA 2CRVA 5HUHA 1XE1A 3FPKA 2CV2A 4HJXA 2B5OA 3M5WA 3S3TA 1S0UA 4TMZA 4B4DA 1K9MD 3AVYA 4U9UA 2QTNA 4G5GA 4Y9RA 4F3RA 1QRSA 3W2IA 1ZUNA 1FRNA 1OGJA 1GO2A 2BGJA 3B8HA 2IJGX 3IOCA 4MUJA 4MWDA 4ZT6A 3ZXIA 4PC6A 3H9BA 2WB2A 3ZJTA 1GZUA 4ZCMA 1MC1A 5BNZA 1R6TA 1U7XA 2YY5A 4JXXA 4JXZA 1WXHA 3CC4B 3PXUA 1E64A 3DO8A 1QUEA 4MYTA 1JZQA 2A7XA 1N2OA 2V0CA 3IOEA 3IMCA 3AVTA 1K73D 3IUEA 4LBZA 4KR9A 1EP1B 3ZGZA 5TR9A 3W5UA 1H3NA 1J9ZA 1LI5A 3P0HA 4MW0A 1F20A 1EXMA 1NP7A 4B43A 3WNCA 4YAUA 1VQ7B 3UMVA 4EG1A 3QSYA 1PFUA 1W2BB 1HA3A 3IOBA 4MUKA 2BYTA 1U3CA 1F7UA 2OV4A 3I1FA 5JBQA 1J21A 4LC0A 1O95C 3IVGA 4RJLA 1PFVA 2AKEA 3I56B 3IDFA 4KPUA 4ZT7A 4XFJA 4PC1A 1G7TA 3W2GA 4MYUA 1EUQA 3PENA 2CV1A 4EH1A 4MW7A 2BTEA 3QE2A 1ZH0A 1MAUA 1N77A 4AF6A 4MVCA 2QTMA 3L92A 3SYTA 3VO1A 1V47A 4PBRA 4QRDA 2JAXA 5GV8A 4G5YA 3FIUA 1EJ2A 1T9GR 1WKBA 4G6ZA 4U8HA 4MVYA 2DERA 2CFOA 4QHYA 1R6XA 3H9CA 2ZUFA 1IB0A 1BS2A 1VQLB 3NBKA 1I6KA 3JXEA 1JNYA 2XNCA 1KAMA 3PNYA 2O5RA 4MUEA 2CUZA 4DJAA 1WXEA 3TQIA 1TVCA 2DY1A 1K92A 4JFAA 1O0BA 4XSVA 1XNGA 1FNMA 5LM3A 3Q4GA 2X3UA 3JQPA 3AVVA 3K32A 1FNDA 4BPRA 1QU2A 2QTZA 4RD6A 3CCQB 1Q82D 1JJ2B 1VQPB 1MJHA 2QMUA 3VRHA 1JIIA 2Z08A 5J59A 4TMVA 2QJFA 4PBTA 3P52A 2X1LA 3AL0C 1YIDA 3CCJB 2E89A 1ZJWA 3RJZA 3U6KA 3G71B 4ZCLA 4DDHA 3IUBA 1MRZA 1QU3A 1Q81D 1KP3A 3TZEA 3ZZTA 4PC7A 1OWMA 4TMXA 2NSYA 4R71A 1GTRA 3AFHA 1M8FA 1VQOB 3CLRD 4H3SA 3MLAA 2PIDA 1DG1G 1I6LA 3COWA 4MUFA 4UZEA 1JZSA 1VBKA 1O97D 4E1AA 3CR8A 4EG6A 2CT8A 1WZ2A 3QFSA 4PGOA 4MWEA 1YHQB 3FH0A 4ACAA 1D2RA 4WNYA 3V76A 1JA0A 1Y42X 2JA2A 3ELBA 3C8ZA 4MW9A 3ZC3A 3CLSD 1HYBA 1WOYA 4NAUA 4ZCQA 4TS1A 2PZ8A 1B2RA 4YAWA 1N0UA 3WNDA 3ES9A 2YWBA 5DEOA 2C77A 2G36A 3HFJA 4R2MA 3X1JA 1Q19A 3IH5A 4S1OA 2GKSA
chains in the Genus database with same CATH superfamily
4R56A 2FEWB 4BNLA 3OEEA 2FPGA 4BU1A 4DDMA 1XFOA 4M83A 2OO5A 3R9XB 4GMXA 3UUFA 3GLIA 1KK7A 2HCJB 1LRJA 3OMWA 2J9XB 4UHEA 9ABPA 1QH1B 2OTCA 1UH5A 5KQSA 5CCAA 1Y5NA 3O9ZA 4CLRA 4TN5A 3SXPA 2AMYA 4C0QC 2AFHE 4MZTA 2OXTA 4EWLA 1Y3DE 2ZJOA 4K6OA 1YLOA 2E10A 3IQGX 2GZ3A 3TTUA 1TUDA 3HGTA 1QF9A 1B6GA 1QYCA 3OSZA 6REQA 3FLMA 3HP1A 3EJ6A 5DNDA 1Y33E 4F9EA 2DLNA 3EQ6A 1T8RA 5TARA 4CTMA 5EEHA 5IHXA 4KUGA 1OH7A 1S96A 5C8YF 1K66A 5FADA 2C5GA 3JAWB 4O0MA 2I67A 4YLYA 2VHUA 3HZZA 3GFFA 2R8RA 4M0MA 4NZZA 2PUEA 1RLQC 1WABA 2JATA 2ZPFB 3BHMA 5GJWC 5H83A 3NUQA 2F64A 2FPGB 3IIJA 4LY9A 4FFOA 3NT5A 2I1LA 2GH1A 4MGHA 5AKZA 1BD4A 5ICGA 2NO0A 4ZV4A 2NV0A 4UUPA 3N76A 1EUDA 3T9NA 4AFSC 2R8PA 3FWHA 3O75A 1K7FB 2CB0A 2GRJA 4GEKA 3FLAA 1PS8A 3MMSA 3TBKA 2YWDA 1RVV1 4IHQA 2DPLA 2FHSA 1K9MU 3G02A 1L4YA 1OBHA 1D2CA 3B6MA 1UWCA 3CUVA 3GLKA 3LQ1A 4R8KA 2A84A 3U1VA 4D8KA 2JIZD 4BFVA 3ZVKA 2I2DA 5TJHA 1DAIA 2XKBA 1H6BA 2PKQO 2V9PA 3FJ1A 3ZDBA 1WRBA 3LVFO 5IZ4A 3ZDZB 5EE9A 3Q7SA 3A9CA 4LHYA 2X9NA 5AH0A 5DSXA 4K9QA 1NFQA 1QXSA 2ZT7A 4I2VA 5FA6A 4ZIRB 1I1OA 1N05A 1GNQA 4EGAA 1FXWA 2Q4RA 3BY1A 3W5HA 1TMGE 4FYWB 1N75A 1YIOA 2I2WA 2VEDA 4HVUA 3CVJA 1GG5A 2JI6A 2DQZA 4JCOA 3TVYA 3LPDA 4CCYA 1BOFA 2Z1NA 5FNVA 4WZ6A 3ONEA 4BB6A 3FPBA 3TLAA 1JGTA 3H9NA 2JEOA 1PJSA 2JGRA 3C16C 4M2LA 1GL5A 1P1FA 3I5MA 4INZA 4NH4A 3WYCA 5EIEA 1G5FA 3ZWQA 1IEQA 2O8FA 4WN9A 1T4DA 3MS7A 3UICA 3RMQA 6AT1A 3FUCA 2QQEA 2V0NA 4N8DA 4B6QA 3JCMc 3I05A 4QJ3A 1SVIA 1ZK2A 2GOYA 4DBHA 1Z2EA 1K9AA 5FI5A 3V97A 4DMKA 1ETUA 1AT1A 3E6AA 1HDIA 4JOBA 1E2PA 1E20A 1H2AS 1ULHA 3VC2A 1T13A 1H65A 2PCJA 1AUOA 3VI4B 4EYSA 3MKDA 4OQLA 3FTQA 3P9XA 4IRUB 1CUBA 1L8QA 2YHIB 5TT1A 1EZ1A 4P12A 1QK4A 1IEVA 4K6FA 3KSZO 1BKBA 1UEIA 2WSEE 1A9PA 4L9AA 4UHCA 5JBNA 2V8BA 3NDBB 3M59A 1JXQA 1RXIA 5A9TA 4ZC8A 2WNHA 2G1PA 1Q1BA 2CJFA 2CVZA 3CRQA 1TAGA 2V59A 3O3OB 1XU9A 2KWIA 4LI3X 1RE0A 3ANXA 1H3ZA 1VHOA 3CKKA 3EWSA 2DYKA 4J91A 1UODA 2GQIA 1OWPA 2IKSA 4D8DA 2D5AA 1DXYA 2WM3A 3F5SA 1RZRA 3RRJA 3EBPA 3MD0A 3FPLA 1TC1A 5CLHA 4E11A 1UOOA 3H8SA 4NBLA 2A0UA 2WG2A 3TKAA 4RTLA 1KJZA 1NMEA 4CIVA 2QRGA 3C41J 1QO7A 2XJ4A 2HNBA 1M1KU 4UZFA 3LP6A 3LUGA 4R7ZA 5ARCA 3W5CA 1A2KC 1ZK4A 4ERNA 1LDNA 2BFWA 4M9XA 4M75A 3K4QA 2XICA 4KMRA 1CV2A 3II6X 3LWDA 4HDRB 4YI3A 2O5VA 5D5PA 2ENMA 3CR7A 4BX3A 3SVTA 2YWCA 2GD0A 2C2GA 3JB9F 1OLXA 2A0XA 3DZGA 3Q5GA 1QM5A 5F73A 4QE3A 2IPAB 3K1AB 4F7UG 2BJVA 3QKUA 4OVAA 4QXMA 2VAVA 2VH5R 4BDZA 2DH5A 3EC7A 1VYUA 4MRMB 5LZ8A 1HSZA 3RSGA 4EX7A 5EC7A 3EZ6A 5IK2D 2IS1A 3QENA 5FW9A 3Q0IA 1K0SA 4TT3D 4KH0B 3EUFA 1VQNB 1FDTA 1X9IA 2BFNA 3KAKA 3V7RA 5HCUA 3STUA 3ZCUA 2HQRA 4M1SA 2VJPA 2H16A 3I55T 2JLAA 3QEBZ 2ES4A 3VDNB 4TPKA 4EP1A 2YWHA 4BOYA 2P2NA 2EIXA 3TG2A 5JPDA 5JE8A 2O3SA 3UB2A 1S7GA 1WOSA 3PUMA 3GAFA 4TQGA 3KSDO 3V3TA 3AP2A 4HPWA 4Y7CA 3M56A 4CMJA 1THZA 2IHZA 1MX9A 3OPXA 1ZZEA 1ZIYA 2H63A 3BWMA 1J9GA 3NO4A 4RMJA 3FVVA 1QCCA 2FZVA 3D8TA 1JMYA 4Z9BA 4YIKA 3BMQB 3X2EA 5T8KC 4G0PA 2DR3A 5CAEA 2AT1B 1O96B 4MICA 3A6PC 4UUNA 3GZJA 2AR0A 1L4NA 1NYGA 1TEXA 4KKXB 3TU4K 1Y0BA 3GJSA 3ROZA 4BAZA 4H77A 1TMYA 1HURA 2CJYA 1DC5A 4OUDB 4TL6A 1WI7A 2JFFA 4BKQA 1PFWA 1H2HA 3CCST 2D2VA 3DOEA 4RDXA 2XKAA 3OKXA 4IHJB 4QA9A 2C8JA 5JHHB 3NB0A 3TW8B 3ANYB 3ASTA 1Z0SA 5G3YA 2YXBA 2GK6A 3DMRA 2VRNA 4P0QB 2I2CA 4G8BA 4JUIA 3EGDB 1XJQA 2VDKB 5LN1A 2OT3B 2ADOA 1X7ZB 3HP7A 3A8IA 3CH6A 1GYRA 2OZVA 2P79A 5KREA 4LDQA 3BK7A 2IHJA 3T0GA 3KYJB 4QU9A 2X0FA 2BSAA 3RS8A 3RVSA 1T2FA 4DTCA 1D0XA 1XDZA 3NWOA 3K9NA 1M1FA 3ZVLA 3M34A 1P4SA 1P7PA 1RQ7A 2FF5A 2OBLA 5DM70 1IWBB 3JQ8B 3B1FA 1W4BA 3D2AA 4DREA 2AK2A 1G9TA 2D00A 1MB4A 1AF4A 3JZDA 3ROXA 4DMCA 1CT9A 1WIWA 2BT4A 2P6OA 4M75B 4ECAA 1YB6A 4U2CA 1EFHA 1VQOQ 1SULA 2FUG1 2FSIA 2YWEA 1U6JA 1WDLA 2XDAA 4HQ0A 3B3QA 5E9WA 2JFBA 1PKSA 3DLAA 2ZRHA 3BREA 5GONB 4P86A 1OTXA 1GQSA 1USWA 1XTPA 3ZHQA 5A03A 3IT2A 4NAHA 2YRCA 3HY6A 5C1OA 1LV7A 3STXA 3L7BA 4A6DA 5KNDD 1V2GA 4ZKEA 1CRPA 2XF8A 2H2DA 3D81A 1HFJA 1E3LA 1F0KA 2AD5A 2FQ1A 1CB0A 1P0PA 2ZSFA 3NYQA 3ZDQA 1KMHA 3VPAA 2D8HA 2P4SA 4LK2A 2A4MA 2Y93A 3SZUA 1Q0HA 3H4VA 5EPOA 3GJ4A 4H1VA 3ZHRA 1Z0ZA 3F8SA 1J23A 1GILA 2YFQA 4UTOA 4AS2A 2I7DA 4GRDA 1SBQA 2A1UA 4QOHA 1KZ6A 5IWAB 1HMYA 1TW3A 2HPAA 3RS3A 3QKTA 1H42A 1FJHA 1GEGA 1NBAA 3H2YA 3HKCB 2EQKA 3I35A 2ZU0C 5DCWA 2G0AA 2OTJB 1KEPA 4YWHA 4XD7A 1CDOA 2IYZA 1NQVA 4KRYA 4DBZA 4X62B 3H04A 4WCDA 2AEEA 4RACA 1M5RA 2K5FA 4RMHA 2YDLA 3F6PA 2KDSA 2DFDA 1XK7A 2JIQA 4RKFA 3A8JA 3ODPA 3VR0A 2CDBA 1TB4A 2A9FA 4LAFA 1UUEA 1OCEA 4FE3A 4K6MA 5CLGA 5CB4A 1DPFA 2QLTA 4AY4A 2Z4SA 3FVWA 1I1JA 1P7YA 2RGUA 4BXOA 1CR6A 1PJ3A 3MINA 2VSNA 1NMZA 4MRVA 4HEQA 1DV1A 5HIIA 3HMQA 4EYGA 3FTCA 4BI3A 2EFDB 1QR2A 3WP0A 4QGHA 3DDOA 2EATA 5YASA 4D97A 2H4WA 3W6UA 1Z3CA 2NWQA 4LJ4A 1Z6QA 5DI3B 4BJ5A 5LBTA 1QPZA 4M7DD 4CFZA 4M36A 4BLRA 1ISIA 1NULA 1ZUIA 3QVXA 4DQ0A 5A5GA 1NVEA 3URKA 2XZPA 1FLNA 3BCSA 3D6VA 2Q99A 3WL6A 5IVKA 5EMLA 3RVBA 2XQFA 1VPWA 4RLQA 1J39A 3AJ8A 3U7HB 4RK1A 1I81A 1XTKA 1Z4KA 1DC3A 1HZEA 1Q0UA 1DDOA 1UBOS 4F16A 4PAOA 1P6UA 2DFNA 2VF4X 1FMFA 2CZ7B 4J9IA 2PZKA 4KO2S 4E5KA 5TE9A 4DA0A 4LXCA 1RRGA 4MGZR 1KAEA 2VJIA 1SCJA 1X27A 5K0GA 1FA9A 4L9WA 1YBVA 2X8LA 1XB2A 4RVDA 5LJ5h 1YJQA 1U80A 4YY3B 4PFZA 1D6MA 1IBLB 2P0QA 3V7YA 3NHZA 2L69A 2YIMA 3NIFB 1U9YA 2OFWA 2WSYB 3SOZA 3ZYZA 7REQB 1Z4JA 3P1JA 4YCSA 4A4GA 1RAFA 1RI3A 1XVVA 4J6FA 4ZVLA 4ZVMA 4O3FA 2QRVA 3ECSA 3VOTA 1O95A 4JVNA 3DT6A 3H5WA 2GBLA 4K46A 3WA6A 4FIZA 1WEKA 4BDTA 4F4HA 3FJYA 4HGNA 2OD9A 3LXMA 3B5EA 1DBQA 3CZRA 4FFMA 2Q7OE 4JLAA 1F1BB 2NZ2A 4IHJF 5IUKC 1Y7XA 2IHBA 3UATA 2OO3A 3AHIA 4JB0A 4KXMA 4MS3B 4FSXA 4KV9A 1VLHA 3EOZA 4DV6B 4RKYA 1JLRA 3SBOA 4J2TA 4M1ZA 3AIIA 3INZA 3L8GA 3ZFJA 1IXSB 1U9IA 1B8VA 3LQ4A 2XIJA 3MW8A 4GS5A 2Q41A 3LQ6A 3CVXA 4MK4A 4CLXA 3DFUA 1T2AA 1KZGB 3AEUA 4TS1A 4F7WA 3GLVA 1EM8B 4Q6BA 1NL3A 1J4AA 5AHWA 4U7GA 2JKVA 1PJ2A 1PJ7A 2QXTA 3V4LA 1XI2A 3VSAA 2F00A 1K1EA 3L4BC 2R84A 4OHCA 4AMUA 1Y8ZA 2IXEA 1UMBA 3F0TA 3TMKA 4HVWA 5FI3A 1PL0A 3KSAC 1NN1A 4LCBA 3DA8A 3K9GA 1IJEA 1WR8A 4TMYA 1PJAA 2FGJA 4Q4AB 3SJ7A 4FB4A 2AH5A 3E7FA 4YP6A 1N8KA 1MG5A 4CUJA 4QPDA 1MO4A 2GRUA 3FAKA 4KXXA 4EJ0A 1DBPA 2VUSA 3QU2A 2DHEA 2XDQB 5HCKA 1XEXA 2BGRA 4BFTA 1PSFA 2VC8A 1A8IA 4GRIA 1U8EA 2WBLC 3L6UA 5LC1A 3T6KA 5IASA 3U44B 2P1DA 2JLYA 1WLYA 4OHVA 4PHCA 2VDOB 4M77F 1GKYA 1QGUA 3ZU3A 4Z49A 5HUHA 3OOEA 5FQNA 3NJ4A 3W6PA 4ARZA 4EB6A 5FH9A 2PVPA 4M77G 3PR3A 3A6HA 3WLHA 1LSSA 2GK7A 4GP9A 4RLSA 2XVXA 121PA 1S8NA 5JS2A 3OZTA 4MCJA 7GPBA 3CBOA 3RAEC 4J8OA 2FXVA 3DOOA 2F8SA 2WTUA 1P7VA 1ST2A 5DYNA 4BLVA 4E2FA 4NULA 2O1SA 3GF5A 2QX7A 4ZCMA 2YV2A 1W36D 2E87A 5ISMA 2VXCA 3PYLA 4PF1A 2SBTA 3P8HA 3L6RA 3G7UA 1ECLA 4NYJR 5FUVA 3VJMA 1ZH4A 5SV2A 4K5QA 5E9AA 3Q3IA 4GBQA 1NT2A 4AXXA 2WZQA 3PVCA 1H1LB 3CG4A 3NETA 4K86A 2BI7A 3D6JA 1LDGA 1HA3A 1Q44A 5ECYA 1ZWKA 1ZISA 5JSYA 4MLDA 3UXHA 4Q1FA 4ZEXA 3EC1A 3R1IA 5DK6A 3K9FC 2GHTA 3WQQA 3GEBA 4QEDA 2IS4A 1AURA 1FEZA 1TJ5A 1U1FA 3IDFA 1SSHA 1VQOA 1VKOA 4M7DC 1QX3A 3SC2A 3WBBA 1Q7GA 3KUKA 1V26A 2EGHA 5LQDA 3ONUA 1QSGA 1E69A 4M78D 2WABA 3B2NA 4L3VA 1V47A 2Z5GA 421PA 3SIPA 4INJA 1ZHHA 1IN7A 1RW4A 1QKKA 1DWUA 5AI0A 3QVGA 4JENA 5EIFA 3FLEA 3FLGA 1ZS9A 1JEYB 2PUOB 3T38A 3S2SA 2FN4A 3QHAA 2WD9A 4MYHA 5IP5A 1NW9B 2HSZA 2NSDA 4BVLA 2PUAA 2Q1TA 2AVDA 3O1HB 3HCWA 1HFEL 3UOAB 3SF0A 2O20A 1JNYA 3FNEA 3QLEA 4KACA 4NZYA 1I3OA 3VX4A 5KS2A 3EGEA 1GA6A 3IHWA 3OUZA 4QUBA 3RSZA 4BP9A 2R2AA 2EGEA 2ZJ5A 2VYFA 3ENNA 3QEMA 1EYZA 4QD3A 1UBNA 3ZLBA 1ZCZA 4HCJA 3NWBA 3U4QB 2J06A 2NWMA 4MRAA 4R1PA 3LKDA 4C92G 2A9RA 1G8KA 2C0TA 5SY4A 4JELA 3KDAA 3NEPX 2FKNA 1VXRA 1T3LA 2ZPIB 1MOZA 5ED0A 5A2GA 5BWBA 1YR7A 1Z5NA 3N28A 4H0FA 4KH0A 3U39A 5CFMA 2FZGA 1YIDA 3X26B 3MK31 5IULC 4LS3A 1DBRA 4PJOC 4UREA 2HF7A 5DGIA 3ENVA 4CUKA 3IEVA 5I8ZA 3BBLA 1TKAA 5CB6A 1XMSA 2YJ5A 4Y1FA 3OOWA 1Y96A 3S70A 3CZAA 3K1AA 2PANA 4LJ9A 1YACA 1OWMA 3A9VA 1G2OA 1EM8A 5D1HA 1KD1C 5CNMA 2YJ6A 2ZSKA 1DAGA 2D0QB 2DXCA 1NB9A 1I6LA 2L2QA 2I71A 3PWZA 4W7HA 5HJEA 3JQBC 3N0TA 3T7AA 2ISCA 1ZW1A 3BIOA 4PZYA 2J05A 3U49A 1K3FA 1SQFA 3CC2Q 2AF3C 1ULTA 3TTWA 3CCFA 3OJ0A 1NQOA 1LLFA 1Q0TA 1KI6A 4NNOA 4G6IA 3BH7A 2P2GA 2PZ8A 2W6NA 5FORA 1U81A 4BRZA 4C0FA 3IAFA 1U6IA 3K6JA 3AESB 2GLTA 2IIBA 2YIJA 1UHCA 4LECA 4NBRA 1IGQA 1O5OA 4TV9F 1ORTA 3B38A 1Y3AA 4REQA 1YZKA 4M0KA 4RYDA 3MVEA 1WXFA 1M74A 3ORFA 3V8EA 1Q81U 3JD2A 3OC0A 2KNBB 1E3WA 1WE2A 1TWBA 3H3XA 2YVLA 2ZYAA 2EC5A 4RTWA 4OQFA 4Q9NA 3BXPA 3V00A 3MTAA 2XRFA 3I5SA 3RSFA 3JB9I 1U3FA 1E9EA 3W5BA 2ORYA 2Q5QA 3U3JA 2GSDA 3EVEA 4IMIB 1EP3B 2YHUA 4KAAA 1EHIA 1CQIA 4PZ0A 4QU5A 5FV7A 4F7UA 4EEZA 5JY1A 4E5YA 1XQXA 4O59O 3WMEA 1AT1B 2EP5A 4MV5A 4FL6A 1BI2A 1OYOA 1U2EA 2A0WA 2BY4A 3P32A 2RNAA 4XFKA 4D6XA 1U8XX 4GOLD 4ZK6A 5ITWA 3VYWA 1J8VA 4G0MA 3SZMA 3KXDA 3HCNA 1R0CA 4Z4WA 4NP6A 5JMPA 2RJEA 3RAFC 3IAM1 1DRVA 1KOFA 2DUNA 2GNPA 1D4AA 2V6BA 3HYTA 5L3SB 3VS1A 1YK1A 3DTVD 4WFJA 3WB2A 2IUSA 1LWOA 1ZJYA 2XUZA 3I3SR 3BRWD 1MNDA 1SU4A 3GVLA 4FCWA 2QA5A 4MIYA 4MV1A 4V0NA 5EWMB 5GAN3 1J7KA 3R8CA 4K03A 3VNSA 5EJ8A 4HLDA 2F3UA 5KHOC 3T5DA 3SP1A 1RE1A 1Z07A 2IKQA 4OGWA 7ADHA 3CF0A 5LQRA 4OAOA 4R1NA 5HQ3A 1Q21A 2MSWA 4YAFA 2GCNA 3RBBB 3OTWA 2ONZA 3PD7A 4OI2A 2GZRA 4QFDA 1USVA 3ZJYA 2Q0XA 3U80A 4EJ2A 4GSYA 2CVFA 3PQ6A 3ADKA 3FRIA 1X7WA 5DRTA 3NRBA 4PBSA 2W2QA 2DOKA 4G1FA 2AG5A 1OHHA 3AH8A 3IFSA 3EVFA 3COSA 3GDGA 3T35A 1AE1A 1CXZA 1DC6A 1UXIA 1LQUA 1VIMA 2E49A 2WYWA 4OQMA 1AK9A 2BRUA 4XTZA 1U0RA 2DJZA 2H3HA 3H05A 2Q4EA 2BP7A 2ISSD 4J0JA 1KRHA 3W3AD 3E53A 4BKMA 1VE6A 2CFRA 3SQWA 2HD4A 9MHTA 3R0XA 1Z13A 4HNSA 4HCKA 2D5CA 1Z3IX 1F4PA 3NPFA 1F6BA 2G40A 2P9GA 1MNQA 2FDRA 3AI2A 4WXRA 4Z5XA 1U65A 2I33A 1GCGA 3CCVB 3QPWA 4M53A 1JKIA 4WKGA 1UJMA 1RLIA 3VGJA 3AUUA 3O5ZA 2BEJA 1QHXA 1XCPA 2QQSA 1X6OA 2A35A 3B5IA 3PBKA 3KR9A 3HL4A 4FGKA 4JEMA 4JVOA 1WP9A 1M4ZA 1TA0A 1ZOIA 3AEUB 5IVPA 4JOSA 2GTPA 2GPTA 3SAJA 1TI7A 3E82A 2FVGA 4IXDA 2WUEA 1KQNA 1IONA 2C9OA 2J7IA 3OPYA 4ADSG 1UOEA 4TGLA 3RARA 1T36B 2ABWA 2CUTA 2I2AA 3ASVA 3E18A 2REOA 4YK7A 3DWFA 2ZATA 1VDMA 3CVUA 4P58A 1NBEB 2BFMA 3JV3A 5G4KA 3TQ7P 1ZOOA 5CA0F 1GTL1 1HDOA 1DMSA 2DOGA 3KBBA 4RH3A 5FPYA 4J5YA 3GT3A 3WR5A 3M49A 4EPRA 4ENRA 4DK1A 1JVNA 2MU1A 3OQBA 1YJXA 3JQ8A 4BZXA 1P2DA 2GGSA 1RMTA 3PGLA 1NPRA 2AOWA 2CXPA 1TH7A 3AR7A 1Q6YA 4YQYA 2ZDHA 4XVRA 3OW2B 5KJFA 2OQ2A 4DBLC 4ORZA 4A4KA 2QUJA 2VSXA 2WFLB 4A0QA 5AW2A 2BE7A 3DPSA 7REQA 3EZXA 2AMLA 5JFTA 1FNNA 1Q84A 2I6XA 4J7AA 6NULA 2WHXA 3ABSB 1Z18A 4CU2A 2H8KA 1LC3A 2E12A 5FRNA 4G0OA 4I1UA 1C8VB 3X20B 1HK9A 1VKJA 4NZMA 1WUJS 3ANNA 3KEOA 3CCUQ 5HF5A 2A9VA 3BRCA 3V8LA 4PPGA 2NPOA 5LA6A 5IAAA 1FX0A 1C3JA 3ZLUA 1Q95G 4PNHA 1QKXA 1FMVA 1N2ZA 4W9NA 1SKYE 1ARZA 4QUEA 3TB4A 5A2QA 4O4IB 1NVKA 1KQOA 2GPSA 2LTOA 4QQFA 1ZG3A 2AFIB 2FPFA 1E3QA 4RFVA 1JILA 1SQGA 2OGTA 5GMKj 1WCWA 1PN3A 2DQKA 2ZB8A 4TV9B 3DTVA 4MUAA 5D01A 2O8CB 1HOTA 3H2BA 4GY5A 1I07A 1KK3A 4PGHA 4TSRA 2IEYA 5TMDA 1ID8A 2I78A 3DDCA 4PRLA 3NHNA 4PIVA 3SEAA 4PYKA 1EUYA 3CZQA 5FLXE 1W9HA 2AN9A 3BDAA 2JIBA 3GGGA 4PNPA 3LH0A 5TEVA 4C04A 1UFVA 4CM7A 4D6PA 1Z9ZA 1BRTA 3AUJB 3O0TA 4YP7A 4EYQA 1IFXA 1ZIPA 4A0RA 1BX1A 3GLFB 3Q8WA 2GD1O 4CEIA 1R9JA 4M8SA 4FQ5A 1WCIA 2B0CA 4YACA 3VAYA 4ARAA 1AM4D 4EG4A 3H0EA 4AY2A 3JALA 1OFGA 4H1HA 2QV7A 4Y6QA 1X0XA 4OTZA 1MZVA 4BCCA 3MYYA 3G0CA 1MEJA 2I4RA 4DLUA 5FWNA 3OYNA 1IPEA 1YV9A 2ZI7A 4AYTA 5FV4A 3JRZA 2E4HA 1Y6QA 4N3NA 3CCMB 1QFJA 2XNJA 3E9EA 4NS1A 3FJPA 4ZGDB 1RACB 2JFNA 1E1YA 2NO5A 3QU5A 4DC9A 5FKJA 5C1PA 1AMOA 1F8YA 1YRYE 3GFSA 1YJNA 3H99A 3MLEA 5AXCA 5I4IA 1Y7IA 4BQRA 2O8NA 1MTOA 3IQEA 1R74A 3V32A 4AS1A 4LFBB 1CK4A 1NIJA 3EW9A 5E2AA 2JAWA 1K08A 4HFMA 2G28A 2QRZA 3D3WB 2CK3A 3I0NA 4ONEA 3RYHB 3PPXA 3P20A 3PVSA 5FBWB 3EIWA 2WWWA 2UDPA 1PHTA 4HDKA 4WK2B 2QROA 4FGLA 2QY6A 3BRSA 3EXIA 5EHQA 2UUCB 3F1KA 4C06A 5HCIA 4W7SA 2HOQA 1KI1A 1J8MF 2WFAA 1GY8A 3A1NA 4LZJA 4I6EA 4YUVA 3WO1A 5C1BA 4AMZA 5JC8A 1IY9A 2PQWA 3K1ZA 1GGEA 3CCJT 1U1EA 2R6GA 1AD5A 3UJHA 1G98A 4UNRA 5CCXA 4F86A 3PC3A 4GH5A 5IM4A 3N8IA 2QBYA 2CXQA 4AD8A 2HBZA 4OHYA 2J45A 4Z4TA 2DE0X 4NFLA 3AW8A 2V6MA 5EHZA 1W0CA 3AFNA 2FW6A 3H65A 4MVJE 4P32A 1BKYA 3R6JA 1ZMOA 2DPYA 2C04A 3T34A 3W8DA 1ACMA 2NTVA 1F48A 3E23A 4BNIA 5JRZA 2UYCA 1MJ5A 1P44A 5LLDA 4JVLA 2D1FA 4ARSA 1UIMA 5INTA 2DL8A 1ZGBA 2ACEA 4ZVKA 1LGYA 4GBGA 4GD3Q 2DUJA 4HQKA 3O4RA 3KYBA 3FB1A 1H2ZA 1V8FA 1JP7A 2XDDA 1ZGHA 2YR0A 2O01E 3G85A 3PHCA 4WZBB 1OH6A 3VKWA 1YUBA 1GL9B 2WQZA 4KQ6A 4KJZA 4AROA 4C8QB 1X6GA 3KWMA 4FZVA 4R6XA 5DXJA 4BQQA 5AESA 2C92A 2OCKA 3HSBA 2BLLA 3HSKA 4HAUA 3OA6A 4XKWA 1RI0A 1IN4A 2ATEA 2IHUA 3DL2A 1SVNA 3V7AA 2B9EA 3IDOA 4IHJA 4B34A 1TW2A 1OT5A 4RS4A 5ILOA 4BB0A 3PEYA 4PFPA 3CCSB 2HEGA 3I2IA 1C1XB 2VCHA 1HUQA 1PHPA 1FNCA 2W2MA 3PK0A 3R3UA 4N4AA 4OUDA 1LC0A 3DW3X 4KN9S 3UJ6A 5IUNC 2O8DA 2YMMA 1N3YA 5HKBA 3F6YA 1EG7A 1E62A 1ZI9A 3NDRA 5BT9A 2DIGA 4KODA 3L6BA 1X2EA 1E9FA 3M4NA 2RK2A 3DD5A 3F4LA 1QVGS 4QQDA 2P9FA 4X8HA 1KNXA 1JMKC 1EP9A 4L3OA 3RVKA 3H5IA 1P0FA 4WIAA 3QUIA 4OPVA 1KQPA 3P71T 4RTUA 3RE1A 3MHPA 3DV0A 4CTNA 4EYKA 3FUVA 5K0BA 1PTJA 2I6QA 3FI0A 2FFAA 3CZPA 4NJMA 4B35A 1U0LA 5A06A 1D9XA 4N0PA 2AYXA 4FCVA 4A73A 1NQ5A 3U3OA 5IEJA 1Y7HA 3K94A 3OYLA 4O6VA 1E1LA 3O1IC 9ATCA 5HIKA 2QTXA 2ZIVB 2V03A 2R2GA 2PA0A 2RGNC 1KYIA 1WJQA 1RAIA 3BFPA 3HCEA 3NX4A 2VP3A 3QXGA 1PJTA 4HB2A 5DO9A 1GTZA 4BB9A 3E8MA 3F2VA 1SIBE 3VV3A 3L18A 3NQ41 1CRWG 1M6YA 1TVKA 2C2HA 4J16A 4LCEA 4S1WA 2KY9A 3C70A 1YR2A 4EG5A 3P96A 2JF0A 5BRJA 5TS2A 4ZT4A 3RFFA 1NE8A 1JQ5A 5GMKe 2BKVA 2X8JA 4HF7A 2TECE 2ZWPA 4WKOA 1JG7A 3Q3JB 2QHXA 4FR0A 4DDKA 3GP8A 2IYRA 4LZNA 2NQTA 4FDTA 1SVUA 4HVLA 5KDDA 3WMXA 6REQB 3NBAA 2HQ1A 8AT1B 1W0JD 1JYSA 1JRIA 4FW9A 4DCGA 2POCA 1ZD5A 2PWPA 1ZN8A 2XGMA 3VR5H 5EL0A 1VI6A 3U7QA 5BYJA 5C8YA 2DY0A 4MI1A 1ZC4A 3OOSA 3OYKA 1IQ0A 2RGDA 3I09A 2IH2A 2QQRA 4QW2A 2M9MA 2XOEA 1VQ7A 4Y67A 4Q3DA 1XRJA 4MGEA 1L4BA 2X2FA 2BF4A 1IN8A 1LY1A 3GH3A 3OA0A 4LVUA 3KQNA 4X8LA 3K7EA 4B81A 1ADBA 2GM9A 1S01A 2J67A 4B6PA 5J1SB 2VSFA 4ESVA 1WUKS 2VR1A 2H0AA 1QNLA 3AYZB 3GPDG 4ZRMA 2F3QA 1PK7A 1XEWX 4B3CA 3A26A 4EPTA 4FK8A 2HQSA 1CTQA 2ZPTX 3BM5A 3L02A 4FEAA 2P4TA 1WBBA 3VNVA 4QDZA 5BWMA 4L28A 3K6SA 4EATA 1JWAB 1YGPA 2X6RA 1V43A 5L3ZA 4L4UA 3C2QA 3DDWA 2J5KA 2VJYA 4QHSA 2BKLA 1N0VC 5FUBA 2KEAA 3C6YA 1G20B 4RTYA 1LPAB 4PJOG 1WNTA 3CB4A 1EFCA 2JBAB 3HBFA 4MUHA 4M1TA 4C5GA 1D1QA 1ZU5A 4TL8A 3UPUA 4AWXA 5LUAA 1E3MA 1ZI8A 4KGXB 3KKKA 1ZHIA 4XWYA 1RKUA 2JK1A 4Z4VA 3VV2A 5CT9A 2XRZA 1PWTA 5G40A 3TXXA 1SXGA 1WBJB 2PO7A 3QVWA 1SNYA 4YBZA 1K0XA 4Y2SA 2CFCA 4PLGA 4A3SA 3TS1A 4AJJA 1O77A 1YB2A 3AYXB 1TM5E 1J70A 3LGAA 4A5SA 3RANA 4DCJA 4D9EA 1KH2A 3A36A 3IT3A 3I52A 1ZCJA 2YUIA 3DO6A 1O54A 4E2FB 2W11A 3TTYA 2OC4A 3BRQA 2XBMA 3EFRA 2F1RA 4ZHQF 1JAIA 1ZK3A 5CJPA 1MZPA 3N8HA 2F8TA 2E37A 1JE1A 4GYJA 3IXLA 2ODPA 4P3KA 1YJNT 1MHNA 3KG2A 4OV6B 4US0R 5EE1A 3TGWA 4BQFA 5C7LO 5EKDA 4E1BA 3PUZA 3TQRA 3P9ZA 5FWBA 1HEYA 4DABA 2F67A 1YU9A 1M2JA 2GPYA 4RKRA 4EMUA 4MXDA 5EN4A 2J6FA 2JH3A 2JGDB 3WI7A 3CF2A 4DUPA 3CUEF 2CV2A 2HWUA 5T3YA 3W9UA 2PXAA 4B4DA 1RPZA 1YNOA 2WM8A 2X35A 4U9UA 1PV1A 2ZYUX 3IP7A 2DT8A 4F9FA 5M9OA 4UPEA 3MOGA 2HXSA 2JBHA 3BH0A 1AX9A 3FWNA 3IJEB 4OLBA 2XUQA 2G9VA 3EZGA 2GPAA 4OL0A 4EPXA 1U7XA 3AM1A 1XIVA 2WWXA 4IGKA 3ORRA 3B7PA 1P0CA 3Q88A 4B83A 1EX4A 3GOQA 4BE4A 4PEVA 5COAA 3GAZA 1HXDA 3GUVA 3SKYA 1B93A 1H94A 3SDZA 5EMJA 4RJTA 1FSGA 4CMBA 5DM7R 1NP7A 1P60A 1GYPA 3PNQA 3DDNA 4X93A 2DILA 1WDKA 1P91A 1KFEB 2GR9A 5IAGA 4QNNA 4DOMA 1XZDA 3W1EA 4RMGA 2GLUA 1KZLA 3TNYA 3TSWA 5GAOn 2W2LD 2GXSA 3H13A 4OAQA 3CNEA 3U7QB 1MO2A 4DSUA 4TZ6A 3IPAA 4EA8A 3PHHA 4D99A 3N6XA 1A7AA 4KPUA 2FEIA 3OYGA 3FA2A 3GR6A 3NH6A 4FD3A 4MCHA 1KEVA 5FHRA 1I4K1 4O29A 5D6YA 3ASQA 3BTUA 1CUSA 1Y4DE 5IKOA 3TL3A 1QCFA 4AF6A 1MT0A 1VG9B 1XL0A 2J9FB 5C0MA 2Q9CA 5U4XA 1X69A 4COOA 2P5SA 2YVAA 3OY7A 3VO1A 3KJEA 1J6UA 4U7TB 3D3QA 3FRJA 5KVQA 4NZOA 1JXMA 4XTWA 3M6XA 1SKUB 1PZFA 3U4AA 1GZ4A 1V48A 3VZRA 3TZQA 4J16C 3UMGA 2VK1A 3VS3A 3TX2A 2Q1UA 5JNLA 1HLDA 2GMWA 3R7FA 4M78E 4RTTA 1C1DB 3NBKA 4FCYA 1F2VA 3OPVA 5ETJA 4PS1A 5J4KA 4JL5A 1Y9EA 1G38A 1J0AA 4TTAA 2X4YA 3K05A 3VI3B 1H4QA 2EW2A 2RO0A 4XI9A 4X3CA 2DY1A 2I34A 5B36A 2XUOA 1RYBA 4Q48A 1EGMB 1T4CA 2Y6VA 5HF9A 2J0UA 4XOPA 3FSJX 2RK6A 3LLRA 3CX8A 3PUKA 5BOVA 2GJPA 3VH4A 1Q82D 3ZJ5A 4W1RA 5EXSA 3FTEA 1E9BA 5DHSA 5BQ3A 5ALNA 3PFKA 1JIVA 3VU1A 3D4NA 4JB8A 4KH1A 4ENTA 1LBTA 2DPMA 1A9TA 1P77A 1ZFNA 3LDFA 3L1JA 3AL0C 3BNWA 2XY4A 2LC4A 2ZIFA 1DINA 3RJZA 4ZHQB 4RNCA 2ETVA 3PPYA 5JRDS 4J83A 3DEKA 3WB0A 3RPEA 1W8DA 3GLHA 3IDAA 4EF4A 3QIIA 2P0PA 2QAGA 4Q3NA 1QB7A 2VL7A 5E7MA 1VIVA 5B1YA 4F6CA 3M6IA 1VQOB 3I8SA 3CLRD 3LHIA 4Z0PA 4JUAA 1IHXA 1QH9A 4O2AB 3RFCA 1WZ2A 3DAGA 1JG3A 1KAOA 3H9EO 4KTTE 3A3BA 3BCHA 5FRDA 4QTYA 5AFSA 5BWOA 4YRDA 3THYB 1RXSA 2ZE6A 1YJWA 3R3VA 4GPIB 1T5TA 3HXOA 3UJCA 3QA3E 4P38A 1NZFA 1W36B 1B1CA 1FSFA 4YIHA 1L4MA 3BZWA 3ZU5A 2Q7XA 1ZRMA 3ASRA 5I11A 3AR8A 4N9QA 5IJAA 4YDHB 4CC2A 5IXJA 4LCJA 1QHHB 2YRVA 2AFIE 1QYDA 2HSPA 2DP4E 2PR7A 3L79A 3PQ8A 3TKYA 4S1OA 3VKFA 3CC4A 3FG9A 4UHKA 4L85A 4N0MA 5DK4A 3UAYA 1VHQA 2DG2A 1ZQ9A 2NO1A 4WACA 2G70A 5HS6A 4NDAA 1TC2A 4P1ZA 5ALUA 1M1ZA 1OY1A 3AIMA 3THWB 2F9LA 4R1LA 4HLNA 4HDNA 4PYMA 1R0YA 1FLAA 2RMKA 4UCFA 4GDFA 1J1UA 5FOXA 5K3OA 3NEYA 2IYTA 3V2HA 4LXQA 5GMKl 1R9NA 1WMDA 4X3OA 1MBZA 3EGXB 5JAIA 1CF4A 1OV6A 4H6PA 4LJ6A 2JTMA 3HO6A 2QSZA 3GRVA 1E9SA 4JA0A 5I45A 2O4UX 4E3ZA 2X6TA 3H2GA 1UZAA 4J4HA 4U6QA 1AB6A 3W4JA 5CKFA 3DTNA 4PS0A 3AF5A 4TQUS 2FPPA 1GPH1 1VPVA 3DVAB 4XVHA 1P1BA 1M1GA 5IDWA 2XXAA 1HE8B 1XROA 3D0KA 1NXVA 3B48A 5E6RB 3L8YA 3SFVA 3RSOA 1IHYA 3WRYA 1M72A 1GDDA 3C4VA 3QVVA 5ANRB 3TRFA 4ER3A 4NOYA 1TGVA 4D1YA 4DPLA 5AW6A 2ZOSA 4ZZ2A 2IPLA 1DX9A 3S2ZA 1W2BA 2JIDA 3KJHA 2IBSA 4U39A 3T7TA 1JSZA 3OT5A 3QNMA 4GXNA 4V2UA 3JB9D 2KROA 1ZIDA 1WXTA 3U7IA 1R88A 1KA9H 3DCIA 2WILA 1UHFA 4KXWA 4OO3A 4CN9A 3PQ4A 4KBGA 4ED9A 1VQNQ 3IESA 3OM1A 2VWGA 2IBMA 1UK8A 4XB6B 1NMYA 5FI1B 4X20B 3WAJA 2SRCA 4FT4A 3KOYA 4OFBA 4C6HA 2NUPA 4GPAA 1YS1X 5IN5A 3DNFA 2RIRA 5CKHA 2W6IA 3GRUA 1OQAA 2P78A 3EA4A 3VVLA 5F7XA 1ZU4A 2EJVA 5K2OA 2X6QA 2ZXHA 1P9RA 4XPIA 4AY3A 1YDFA 2JLQA 4KVFA 1W29A 2JC3A 3MSXA 2A9QA 4F17A 1GRRA 1OWNA 1XVUA 2MSKA 1YL5A 2VK4A 4F7UF 4QVJA 2H52A 2O2EA 2AMJA 3HLYA 4NR0A 4CF3A 1V7ZA 1AQYA 4RH1A 3HWSA 1IY1A 4JL6A 4EA7A 3OLQA 3CMEA 5DGTA 3FWZA 2DQ4A 4KXQA 4FHDA 2WQ7A 2Y27A 1MAWA 3K0CC 5LJ5e 4KVAA 3GLHB 4EY8A 2DXTA 1XA4A 3EVGA 3ZGOA 3PF8A 2ALJA 1NM7A 4JS5A 5FO1A 1IUKA 1E1MA 2XMRA 2CB9A 3B36A 3DEYX 1LPSA 4R1SA 1NKSA 4M6WB 4A9AA 4M78A 3WIDA 1RZUA 4Z4YA 1TJNA 1SVOA 3RS9A 4E0FA 3I83A 5GAOr 2IEBA 2AFIA 3DMPA 1CDZA 2E3JA 4FYVB 3CPWS 4DMHA 4Z2AA 5BW5A 3SEQA 1ZMRA 1Z12A 5G3ZA 1NOKA 5TPZA 4PE5B 4UU1A 2LV8A 3DNPA 4QT4A 5A3SA 3K4HA 5AW9A 1NUAA 5LA6B 1MFPA 4KQXA 3BEDA 3TBHA 1V41E 4IDNA 5I9BA 3O8NA 4DS3A 2H7CA 2OJ2A 2A7YA 2SECE 4N4IA 4TRJA 2COWA 2MIOA 1FL9A 1R0WA 3G3EA 4D3XA 4N3CA 4A8PA 2HD0A 4N41A 3UMYA 1YI2T 1V71A 4EG0A 2ECQA 3F90A 3I9MA 1T1EA 1ZXXA 3KXIA 1U2DC 2KS6A 4NK5A 1BYUA 1M1NB 1LQ2A 1SG0A 2ZBDA 3E5RA 3GIDA 3N7AA 4N7MA 4PLVA 4R2LA 1Z0KA 2FYKA 3VS0A 1YD7A 5IM4F 4EPYA 2CDTA 3JCMV 1PWXA 3VDMA 3V1LA 1YVEI 1VG0B 3L4JA 4RK4A 3SE0A 2DETA 1UJ2A 1G8XA 1UXKA 1T5SA 3LBFA 4KPUB 5M04A 1QVFS 4FD2A 2QLMA 1SHTX 4KXFB 3L0DA 2GX6A 2OLJA 2WU4A 4MR9A 1XMXA 5D6WA 1XZ8A 3N87A 4FHGA 1KC1A 4TLEA 3FDXA 4YV0A 4YMVA 3BBPA 1YIJB 4IUTA 4M7AC 3FFTA 3DV2A 3GP5A 5ADVA 2CCKA 4W6ZA 2IZ7A 5DTQA 3GMDA 2P2SA 3F70A 4F5EA 1SM4A 2CKKA 3CTPA 4PTZA 4JI1B 2Q2OA 3Q41A 1U5AA 3H97A 5B1EA 5GMKi 2FW0A 1BC5A 5KSWB 1TYDE 2Q1SA 4KHPB 5DB4A 3RABA 4RDCA 3DCJA 3A1PA 4YRFA 4L8YA 1JLSA 4Q12A 5NULA 3TZLA 4E32A 3JAKB 1YI0A 3VS2A 2CF6A 2DBQA 4JI4B 1JIKA 1ZH8A 5J3BA 4L5BA 4D2IA 1EUZA 4GX0A 4XONA 4MQMA 4XTCS 1L7QA 1RMYA 4OF4A 4Z4CA 4OPOA 1SCBA 1N5DA 1QHGA 1T8SA 2BH9A 2K6GA 3OJXA 4XOTA 1C1HA 1JI3A 2YXLA 4IUPA 1XKLA 3SLNA 1JE0A 1ZOPA 3ANSA 4HZGA 4K1LA 4CYMA 1P8JA 2E2WA 4Y7DA 1AWOA 3QYJA 1YIJA 3CRZA 4E7SA 2WMDA 3WQBA 3ZWCA 2CMKA 2VUHB 4EG3A 5AR1A 3IO5A 2I6FA 3WGMA 1YZGA 2YYSA 4EZIA 2EJCA 3REOA 1OU9A 3VR6D 5FDFA 1F2UB 3D31A 1N9KA 1UMCB 2CSXA 3PA6A 5DZSA 3CCRB 3MTEA 3C45A 2O3JA 4IJWA 3LQFA 2CP2A 4QOGA 4W8HA 2KX7A 3GLFA 2FCAA 3ZU6A 2R7AA 3NT2A 5K4HA 3PFWO 1WV0A 4GPD1 3V4SA 4TYWA 3TLGA 3ZCPA 2AEFA 4B6FA 3DG9A 4UNIA 3HRSA 4JJZA 1LDYA 1UFRA 2OY0A 4DBRA 3HG7A 4I9GA 2D6FA 4NL3A 4KAJA 4KLRA 5EY5B 1DEXA 1TK2A 4LF8B 4R0NA 1WOPA 4KOAA 4HAOA 5EHIA 5KSZA 1IDOA 2R6CA 3O2SB 4K2AA 3GMSA 1GZHB 3S2GA 5DNVA 3ZE1B 2DR2A 5LIPA 4ZIRA 4EHIA 1VQ5A 1XXLA 2YZ2A 4LZAA 4DA6A 3BAFA 1NLUA 3I9V1 2W4IA 3OEED 1RR6A 3K0EA 1Q6ZA 4FINA 3RDVA 1XNIA 2K9GA 3EF0A 2VHXA 4J0KA 3CJQA 3COVA 4GKBA 2PTKA 2P2LA 1JR2A 1M8MA 5SY6A 3T7KA 1L1EA 1E1QA 4MWOA 3A8TA 1AZGB 1U8RA 1G19A 3G2OA 4A2CA 4BKRA 4PYIA 2ZM5A 4JC4A 4JR0A 1G6HA 3PRJA 1RLMA 1ZL2A 5DDIP 3L8MA 1N4AA 2Q8PA 1I6MA 3GL9A 4XQ9A 1XDBA 3P2EA 5AHXA 2R62A 3WDLA 4EO9A 1VQ8A 2JI7A 4RM2A 3SC6A 1SHFA 1Z28A 4NL4H 1SUSA 3UK7A 1E3JA 5KNCH 2KAFA 3DBRB 4PINA 3PQ5A 1J1ZA 2YICA 3NALA 5GAMe 2B4RO 2EP8A 3IUYA 4Z7OB 5JDIA 4Z2YA 3EHQA 5H0IA 1IN6A 1UPUA 4YFVA 1PR3A 5JS1A 4C5AA 3DFFA 3ETJA 3D8BA 1BGVA 1B8PA 4E2WA 3OZSA 1ONPA 4R1TA 5EIWA 1N78A 2C07A 2WIDA 4BUGA 1KR2A 3FCXA 4IKOA 3KSBC 4GUAA 4ABTA 2RQWA 1H4VB 3C7DB 5ERGB 4X66B 2ZL6A 2ZKIA 4CG2A 5GIPE 4BE9A 1YZ3A 2R8OA 2IYYA 3AM3A 2P7IA 3G17A 4UVGA 2J87A 3MMPA 1MC8A 2C3PA 3FGPA 1OFUA 3OPYB 1CYDA 4G86A 3BGIA 3G68A 2Q6VA 3R6GA 4OJKA 3IPRA 1OILA 1M76A 1G5PA 6Q21A 1SXPA 5CG2A 3QUSA 1Q15A 1SVSA 2EW1A 5ALZA 3IIKA 4IJKA 4JL8A 4UEQA 1GTG1 3V4FA 2JNWA 3LC2O 3LT0A 1DIHA 2QRNA 4EK9A 4LK3A 3BICA 1OV4A 3FC3A 1C0MA 2IX9A 3AM5A 3R3XA 5TXGA 2F8MA 4JUCA 3VKUA 5AICA 1H2EA 4R54A 5C3UA 3U4IA 4MVXA 2H8GA 2JHPA 1Z8NA 1KRWA 1IYZA 2G1JA 2BVNA 2Z95A 1VJCA 3ANTA 3QPUA 4ZI7B 4JQCA 1GCPA 1QO0A 1S4QA 2R25B 2X2OA 3Q3EA 2VHQA 4RY2A 4E14A 3OE7D 3U60B 5LZ5A 2RDMA 3VO2A 1BVUA 2XRMA 1JEOA 4I2NA 1QK5A 3UV6A 1ZIOA 3SJUA 1QFZA 4LJ5A 4X3PA 3IDZA 1J2JA 3PD0A 4RVUA 1KOJA 3T7EA 1N2CE 4WWHA 1N9GA 5A1TA 2WYIA 1U9ZA 2MOKA 4UQOA 4BP1A 2WPDD 1KSJA 3IEMA 4M0FA 4BO1A 3D8RA 2FPLA 2P35A 3V7CA 3KPWA 4HXJA 3K0FB 2JFQA 4FMDB 1KAHA 3SE7A 1HT3A 2IRWA 3HMKA 2W2VA 5K09A 4I1IA 1N6RA 4ME7A 1UD2A 4EYOA 3EEBA 2H85A 4K3UA 3BJMA 3QHQA 3CPHA 3MGBA 2HV8A 4BTLA 4DIDA 1VRVA 2G9NA 3VRZA 3LSYA 4NMLA 1M2VB 3JVDA 3FB4A 1TLTA 5TNXA 1X77A 3VHXA 5AUNB 2J0SA 1VQPQ 3MTJA 2BGTA 2IHTA 3EG2A 2LGJA 2I1WA 3DE3X 1SBCA 4ZOAA 2BCEA 1T6NA 1E63A 1CYEA 1KZ4A 4D56A 4X1VA 1IRXA 5M3BA 3T94A 4S24A 1OBCA 5KDLA 4AJOA 2PKCA 5KTYA 3AR9A 5GAMd 4X1IB 3VR4A 3ZTWA 1K5DA 1WB4A 1XQ6A 2R1TB 4DQLA 2X3FA 3VBEA 5JO0A 3CXCP 4M7AE 4A8JC 4MUMA 3U5ZB 4N76A 1NR7A 1T9HA 4KMSA 1GZ5A 3AEQA 2Q28A 4J1SA 4BHTA 4FGUA 2HL5C 1FRZA 1BK2A 1W75A 2FB9A 1UIRA 4WK4B 2QAGB 4B2YA 5BVHB 4B71A 1W1WA 2ZPUA 4R0KA 4O33A 3WZMA 4BDYA 2J5RA 3RCBA 4CM4B 4M1WA 3UKJA 1P9WA 4WOCA 4M0EA 4GLMA 2QENA 1TYZA 4BBPA 3I9LA 4IYJA 2JMAA 2X5OA 1MC5A 1UADA 2VBSA 1DRWA 1WMFA 2CYCA 3CRW1 3C39A 3HKDB 4HFRA 2E21A 4Q82A 4P82A 3T1QA 5IT5A 4J9GA 4B3DA 3JWIA 2A59A 4IKEA 2Z9DA 4R9SA 3E4DA 2MPXC 1Q82U 3PC8C 4Q5IA 3LY8A 1SUCA 2Y3IA 1UE9A 3CXRA 1VLVA 1C7FA 2P4EA 3N75A 4FNOA 2BGWA 4XOUA 4J43A 1P62B 4BGIA 4IY1A 1B74A 4MUGA 4RLFA 2H8HA 1AGPA 4PG8A 1I24A 3L6CA 5JALA 1YJ9T 1KARA 2A1IA 1O6FA 1YMVA 1Z56C 3IRVA 3M6FA 2GNAA 2O8FB 3EG1A 4X71A 4ATNA 3EG5A 3GA0A 3L6EA 2H0RA 3ZGYA 2VDJA 5KYVA 3UEOA 4F14A 3G1WA 4ALJA 2HK8A 5I9IA 2V31A 3PDUA 5JZOA 1HWYA 2WD7B 1APBA 4F5ZA 3G2IA 1E3ZA 1I1HA 1K68A 2KXCA 3GRPA 5E9JA 4CQMB 4N48A 1VQ9Q 4CTJA 2FU5C 4J9FA 3MTDA 4QAJA 4ZAVA 5DGHA 5B58C 1PWZA 2PUDA 1VKHA 4RESA 3LWBA 4XVUA 2QPAA 5B30A 5HZHA 4LQDA 1P2GA 4P31A 1MO3A 4IQ0A 2K57A 4V0QA 1P19A 3W2IA 4XCXA 5G0SA 1A76A 4MWDA 2BFAA 4CEIB 1WSBA 3MTQA 1U8FO 1JB1A 1GPWB 1RBMA 4P93A 5GZ3A 1F1BA 3N5BB 3DDHA 1X1BA 4DWOA 2QMYA 2YDYA 3E2PA 2GD6A 3FCOA 2XVAA 4RK6A 3TR0A 3BL6A 2OCGA 1FMJA 1VE3A 2WTXA 5ARDA 5JARA 1VJ1A 1UB4A 4OB3B 1SUEA 4R8RA 2Y8EA 1PJRA 2ZUUA 3ILYA 1E1NA 2BDUA 2XADA 3HUDA 1JG4A 1C8LA 3FF1A 3GVPA 3NOQA 5GONF 3R7BA 1J9ZA 1WTHD 2ECKA 2UVPB 4KGVA 1JJFA 1L7AA 1U7ZA 4B43A 2AG8A 4OJQA 4D25A 1R4AA 2X2PA 4Q7MB 3K0AB 4Y6SA 4H6WA 4E22A 5D3MA 5KKCA 3BWXA 4A03A 4ID3A 4F4FA 2G67A 1BFUA 3EIXA 3KKMA 1HO3A 1FX7A 1Y5IA 2JGDA 3CO0S 3DAFA 3OESA 3TDMA 1I30A 3WJ2A 4JI8B 3O84A 4XFJA 4BTEA 2IYOA 2CZQA 1BU8A 4F2GA 5C4MA 1GPJA 3GJ7A 3QE2A 4HAIA 4AJ4A 3P2YA 3B3AA 3RVMA 4CWAA 3MB8A 1ZAYA 1EX6A 4FR5A 4NMHA 2J3KA 2OHGA 4G5YA 2G09A 2W2KB 4EBFA 4A36A 1XJWB 5GAMj 1SZJG 2YJTD 3FTNA 1AS3A 3L8FA 4I3GA 2WFLA 3I04A 1JFFA 4IICA 4ZDJA 1XMQB 3EUAA 3RV3A 3B5JA 1UDWA 4G41A 1R6XA 3ASKA 2HA3A 5A4IS 3JB9G 3I5YA 4AVZA 1Z16A 1REQA 2FUCA 4GIBA 2DFLA 4AKHA 3JQ7A 1AKRA 2CUZA 1JHQA 2QAZA 3NTRA 5LP6F 2P0AA 3A3PA 4LDVA 2EBHX 3IUJA 2WJIA 1GUYA 4UM9B 2L18A 1GNPA 2H3EB 2I4MA 2QTGA 2O2DA 4N5IX 4N82A 2DIEA 1OFVA 2VSOA 3N5CA 4O4JA 4OYHA 4RNDB 3RRNA 3HBAA 3CCQB 1RUWA 2PMFA 3ET5A 2VQFB 3KZXA 3VRHA 5DHFA 2HA4A 4C4AA 2V9CA 1C14A 4N01A 3T1TA 4FYXA 1HPLA 1QIGA 1NXQA 3CCJB 2R00C 4CMIA 4MDFA 4QICA 1UDAA 3NHSA 3RWBA 3DLTA 3UWSA 2IYPA 1NVAA 2ZJAA 4JLWA 3ZWBA 1K3TA 4M22A 3LZCA 4CMHA 3CXCA 1VJGA 2NSYA 2XVYA 1ZN2A 4RAQA 1QMGA 4R3UC 5C8XA 1SC9A 1W1FA 3PLRA 2H7YA 1AKUA 1JNXX 4MKHA 4EEXA 2PS3A 3A27A 4UM9D 5DT2A 5K20A 1WX6A 1AVZC 5FBKA 5K0LA 3FH0A 1Z88A 4KL8S 4OI1A 3TRHA 2ZIEA 5HKOA 1M0WA 1YJ9A 1BI3A 1DAPA 1QZUA 3EDQA 1VBFA 3IDQA 2ATIA 3W5DA 1RABB 2C3OA 4LWZA 4TRMA 5AYFA 3SNHA 3JWJA 5J40A 4IH9A 3C1AA 5TMBA 3X1YA 1U0OC 3AHUA 3TSCA 4B74A 1E5QA 3QU4A 2GKSA 4Y28E 1JDVA 4WLVA 5TMPA 1CX9B 3JPYA 3U3KA 5LPNA 5LZ7A 4RTKA 3JCMb 1L5YA 1JPJA 3IQFA 1DXOA 4AN1A 2XCTB 1MHPA 3QBDA 3LWIA 1ORDA 2AX4A 2BEVB 2P9HA 2PR2A 3GEDA 3WWEA 3WQHA 2NTNA 1E99A 4EMHA 521PA 1CZKA 3OCJA 1XEAA 5ALJA 5FNVF 2ODEA 5COBA 4AUMA 5HA5A 3UUEA 4CQJA 1KZYC 5BXQC 1CRZA 2ZR7A 1M1KR 4JYZA 1PKVA 3PJGA 5CVVA 3AETB 3PVQA 4U7WA 1F9EA 3Q6MA 1PR9A 1FXWF 1JX6A 4RVCA 2JJYA 2JFOA 4G85A 4LOJA 3ELDA 3QUBA 3ZGNA 4OY3A 3S6WA 4PYJA 3L4KA 3JQ9C 3ZCXA 3ONNA 1JR3A 3EZ9A 2OBFA 3IXQA 3T9CA 3UWPA 5ABPA 1ZLYA 3RJ5A 3QYGB 5GANe 3THSA 3MO8A 3UWMA 5DLQC 1WZOA 3CX7A 4NE7A 2XSZA 2FNAA 2WD8A 4GWKA 2WE7A 5DW3A 3RODA 5C8ZA 2CJPA 1PR2A 3F9IA 2A88A 2OSVA 4EFNA 3QBEA 2VC2B 1X7DA 2XG8D 4ER7A 2CREA 2B30A 1TZBA 4JQSA 3SG0A 4XTRA 4Y6GB 2AHRA 1ZVQA 3R5TA 3GLSA 5H16A 3QUQA 3UF0A 4FFLA 3WLKX 2FW1A 3FNRA 4RTRA 2OK7A 2OHOA 1EXWA 1H1DA 5DI3A 1W2BS 3PFNA 3LX7A 4ZODA 2IGBA 3KJZA 4OXIA 1O9GA 1ECJA 4DTIA 5LQUA 3KOUA 3LXRA 3UAZA 3OM8A 3TX6A 3C97A 1D4FA 1J2TA 4QQNA 4NJEB 1FVOA 4NJEA 5KE3A 3JCMX 4NNJA 3JRWA 4G0NA 3JSAA 2HC9A 4Y2UA 2YVKA 4B3BA 1WHGA 2V4UA 4KQKA 4YCLA 2V7VA 2VXFA 1KJQA 3IQXA 1XCOA 1C30A 2K3BA 1YH3A 5CMLA 5CP8A 1JEQA 8MHTA 1HL3A 4NKRA 4PM4A 4ZV7A 2BEUA 3SIXA 1GZ7A 3IUMA 1VJ0A 1E77A 3SR4A 4E4TA 1L5WA 1JQEA 1VQ9A 5T4FA 3W3ZB 1TO6A 1QGYA 3WGLA 3FBWA 1OQKA 3SX4A 4W5JA 3W90A 3OPMA 3WJ1A 4EHHA 1EIFA 2O1WA 4MZMA 1TJ4A 4GAEA 5K01A 3H18A 1Y6ZA 3U1TA 1R0LA 1GFDA 2XBLA 4DFDA 1QRTA 4IDOA 4DV1B 2Z09A 2JDIA 3NCTA 1NRKA 4DE5A 2WEKA 5FBZA 1GG9A 4JBXA 4UNSA 3OCVA 3FMOB 3CW2A 3PA2A 4YJFA 2ODBA 1EA5A 2GZDA 1ZOSA 2XKKA 1WUIS 2NUAA 4E6RA 3VNUA 3R4CA 3ZE8A 1JTVA 2GEJA 2C98A 2EFJA 1M8GA 2YZMA 1ZGJA 3F3MA 2VF7A 4OD0A 1ODKA 4DWVA 2GF2A 4YRPA 4EKDA 5CA0A 3VS4A 4PNZA 3BT7A 1QV7A 2NSJA 1L6RA 4I9UA 4V0KA 1GXSB 3U1BA 1W0KA 2QA4T 1WPQA 3NIGB 4BGDA 3QG5A 4MI3A 2IVWA 1WORA 4BNTA 2ZI4A 3R41A 3DE6X 4JS0A 4LV6A 4BAUA 3HVUA 3A8GB 2CBXA 1HJDA 3BC1A 2ZAGA 1QHIA 3GJ6A 2WKWA 4JH0A 5EKUA 5HTKA 4CI0B 4DA9A 4M1YA 4UBIA 2V6IA 2EQMA 3H4TA 1ZSZA 1B76A 3KHKA 2PGNA 3VU3A 3U4HA 1DE0A 1UPXA 2CZ0B 3OM0A 4NZNA 4BN4A 2ZJZA 4D79A 4YMIA 4CV2A 2UXCB 4EY4A 2WKRA 2ZXEA 1K8RA 1Q74A 1I3NA 1JHVA 2WU3A 1GCAA 3HEAA 4XM2A 1XCBA 5E4FA 1NFRA 2Q1WA 5HJ5A 2QI9C 2L19A 3L0YA 2OAGA 4R8LA 3T3EA 4WGGA 4I81A 3QDFA 1R3UA 5BMVA 5KYTA 1GP2A 3THYA 2AG1A 3BEOA 1RJ9A 3IKVA 1VF7A 1PT9A 3O1JC 3D7LA 3CF4G 5TQ2B 4BO2A 2AA3A 2O54A 3H2JA 1Z6YA 5AO9A 2TMGA 1GXIE 3DHNA 2RHGB 2R5WA 4UDOA 1XQYA 3VZDA 2WTMA 5CIUA 4AK9A 4K7JA 4ZZ1A 1KVQA 1WD5A 3PRHA 4KIGA 3QEJA 3PFCA 4ENUA 1PRLC 3MEAA 3U6BA 4MV0A 3R3WA 4RAOA 5KTOA 2ACWA 3WHKA 3EFOA 1NBMA 3BFVA 4M7DE 5CAEB 2PEYA 3V9AA 1M83A 4PHTA 1QLWA 2P9ZA 1E2HA 3CCJA 4F7UE 3KKNA 3WZLA 4CMIB 3META 5DWVA 4NIMA 1D2GA 4RHXA 4WESA 2GQ0A 1XMOB 3L43A 2OGZA 2OZKA 4HSEA 2QPTA 4CNBA 5FU7B 4PQGA 4L8LA 3AKZA 1KQ2A 3B1YA 2VIIA 3GXBA 4ENVA 1HTWA 2PA3A 4FW1A 2PRYA 3G6KA 5K0ZA 4EGFA 1QYWA 2PV0A 3MBIA 3TE7A 4RD0A 3C3AA 3NHLA 5LMUB 4R7GA 3TUZC 3CWZA 4Y2GA 5G0TA 1GGVA 2QEQA 3DBHA 4HGPA 1N1MA 2A92A 4FE7A 2YNMC 4HQLA 3WV5A 4ZTZB 2DHQA 1PG5A 3R8FA 4G5QA 3SEMA 1KK0A 3KZVA 2ID7A 3P0IA 2RHXA 3AUSA 4HR7A 2FPIA 2W93A 3DC7A 3MWDB 3IE0A 3L0CA 4KNYA 1N7IA 3CN7A 4YV2A 1U5BA 3L4SO 4HS4A 1Q1AA 1RTKA 1DAEA 3G2MA 5HKAA 1LJLA 2JG3A 3AY7A 3CCUA 3CCEA 1R50A 1M5UA 2VJDA 3GUZA 4O4HB 1R37A 2PZGA 4R01A 3ZXIA 2RGXA 1M7HA 2OBNA 3J7TA 2P4RA 5I5GA 3HFOA 2DHRA 2W37A 4MQ5A 4UEWA 3NORA 2DLCX 1OLSB 4JT8A 4ITUA 4NV0A 4EA9A 1XV5A 2ZE5A 1QBGA 3HKBB 4N8SA 4ZOLF 3OW7A 5ELMA 4Z0NA 1E0JA 1IHPA 1X1CA 3DBLA 4FX2A 1VM6A 1SXJA 2CP0A 4PJNA 1VE1A 1WXIA 1XPJA 2HJVA 2I6GA 3A6ZA 1Y07A 2VT3A 3AWIA 3IA2A 3LQ2A 1HQKA 4WLEA 4XX0B 1PR0A 3C3WA 3ETDA 5LDHA 2B7BA 3D7KA 3TN7A 3WGUA 4D0SA 1NZJA 3LUBA 4H4CA 4BWFB 4OSEA 1HYGA 2VYVD 1FFHA 3P5BA 5IWCA 2ZM6B 3PUIA 3B70A 1FY2A 5TV2A 3DBRA 2FQWA 1NY6A 4YTLA 2G5CA 2YOFA 3LUHA 1OPKA 2B8EA 2QX6A 1PEDA 4F9GA 1B0AA 2FMFA 4URUR 4POOA 1H0KA 2RH8A 2W8BA 3GZTB 4RVOA 2XKJE 4JP1A 4A0FA 1MU0A 2XUAA 3CINA 1P5FA 1A5BB 1H8ED 1SOVA 3VA7A 1L4KA 4ZEMA 4F93B 3Q85A 3TSZA 2IZ1A 5JVDF 1QIMA 2BM0A 1SKQA 2VJAA 4CIYA 1O5IA 3B8EA 3HPWA 1AZWA 4JROA 3L8DA 2IHKA 3M5PA 4YRLA 5KCOA 2YASA 1ONSA 4RQBA 1TS9A 2JH8A 5EJGA 2IPXA 1EAMA 3MP6A 2FEPA 2WWVD 4NCNA 4G1VA 3UPTA 2QV0A 1BCSA 5JQGF 3QOXA 1DDGA 2OAP1 3KUUA 3N05A 5H3CA 1FSPA 1PSWA 2UXBB 4U5QA 2G9QA 1XN1A 2OD7A 2QX4A 1MRSA 1J90A 2ZAMA 3MP8A 3MAAC 2RJ3A 1K8ZB 5JFOA 3SWNA 4AFQC 2A5JA 2FW8A 3KBOA 3NIWA 1X86B 3TTSA 1KC8R 1S72B 3TLMA 4D96A 1RQGA 1VQPA 4J1TC 4QFBA 1T0BA 4UHDA 5LLTA 3WHLA 1H8HD 4IIJF 5IN4A 2YUOA 1BEUB 3Q0EA 2PUFA 1AKMA 1TTHB 1N3LA 3K9WA 3DCNA 5JEEA 2QD1A 3LDAA 5FEUA 5ARBA 1ZR4A 1BVYF 3LW8A 4OX9B 3NGXA 1E1KA 3DE1X 3M83A 1G20A 3QWIA 4KFTA 4PJJA 4E47A 7MDHA 1S3IA 4FXOA 3A6EA 1OR8A 4ZVNA 4OQNA 4YRGA 3BE3A 5L4LA 4DV4B 2HIHA 4MMLA 2FRYA 1ZA2A 1TDJA 2XTZA 1OI2A 2ENWA 3CLHA 3G5LA 1Z37A 4ICIA 4KO4S 2EKLA 3M3DA 4EY3A 3AT1A 5FBLB 4CL8A 1X1DA 3I2FA 2M6KA 4EHFA 3U4CA 4E7KA 3LCCA 3ZNQA 4IM7A 2CGEA 4B9EA 1QVPA 1XLWA 2MF2A 2CMHA 5AI8A 3IMFA 5HNKA 1YFJA 2Q6IA 3KKQA 4JKOA 1CEXA 2O2IA 3KYDB 2LWIA 5I7SA 2QA4Q 3GLQA 1A72A 4AMGA 2C4TA 1C0KA 1DBVO 4J03A 4U9IS 5EZYB 2WUFA 4P3PA 2HKQB 3G7NA 2QORA 3LJKA 2Q8QA 2ZETA 4ZPXA 1CQJA 3E5MA 2APJA 5E95A 4Q93A 1WVMA 4MLCA 2H59A 2XT6A 3S44A 1W36C 1BVHA 2GESA 2RQTA 5CKDA 4BNGA 4OA5A 1HLPA 1V8BA 3EIQA 5HZGA 2KRSA 2YCLA 5DM4A 1ZGZA 2O2ZA 3JWEA 1D0ZA 4XN3A 2BDTA 1R5OA 1WLPB 4EMKB 1BCRB 3AINA 4M76B 1RQPA 4C2BA 4DLSA 2VCEA 1KNQA 5H7XA 3S55A 3AJEA 4FHZA 2WNSA 5E4JA 3VYHB 2WMNB 3WV4A 4C0ZA 1FOEB 5IZCC 3BUSA 4ER0A 5HM6A 3U7GA 3NTVA 1EFLA 5EJ2A 1QO0D 3W5SA 4YT2A 3CC2T 1LLDA 2ZQYA 2F55A 1N4DA 3KRTA 2AFHB 4JLOA 2W0ZA 5LXTB 4H7JA 5K4GA 3MJXA 3UJ9A 3OYDA 5CDGA 1CZNA 1Z83A 1NI4B 4MW2A 5B5SA 3WXMA 1VPEA 4ID9A 4W1PA 2RARA 2X9QA 4MRPA 2LQ8A 4PTLA 3TE6A 4B3HA 2R5NA 4KUIA 1Z2DA 2IFTA 3OPQA 4ND3A 2LCFA 5HBGA 1I2MA 2OI3A 2TMDA 1UZNA 2OSBA 2IZZA 3GNFB 1O6GA 1CIPA 3NHFA 5SZHB 1CS0B 4MKIA 2AN3A 3NM6B 5E8RA 1CW2B 1G8HA 4RDIA 4FM4B 3OYFA 1TM1E 2ZJ6A 5L7WA 3MJRA 3WXMB 1G55A 3DV0B 3ZE9A 1L7OA 3L49A 4LRQA 1Q1GA 1P7WA 3FYDA 4C6SA 4J94A 1PTJC 4D4HA 4EARA 1E9RA 2P0KA 1NYRA 2R44A 2KR3A 1G60A 1GV0A 4Z3KA 2QVLA 5LJ5g 3BSSA 3ZXUB 1D07A 4MH0R 3T7DA 4HI0E 2AOUB 3A3NA 3EY9A 2CLMB 1V6AA 4YMLA 3VUFA 3GPLA 1KP2A 3B2QA 4LISA 1R1DA 1JS1X 2UV8A 2RAPA 3GRYA 4RH0A 4HUTA 1Z4LA 4A4EA 4OXKA 4TUYF 3TR5A 1ADGA 4WNIA 1TUCA 4FWTA 5REQB 3T1NA 1I18A 1E0KA 2YMLA 3HRKA 3VNBA 4C2TA 4C9BA 3BZUA 5JAZA 4XARA 3RS4A 3T56B 1WHTB 4TMZA 2OGUA 4JLKA 4RHYA 2Q7DA 3G8BA 3S3TA 3EPJA 1ZUNA 2D0IA 1OGJA 3B8HA 4AECA 1MV3A 4ETMA 2IJGX 3OYAA 2J7PD 3CZ9A 2O5EA 4Y1RA 1S1MA 4TROA 3W6OA 2WJ3A 2C8LA 1MC1A 2VRBA 1RI9A 1M5TA 2ZS9A 4GQIA 4B7UA 5ADWA 2BUAA 2BR5A 2A0FB 4BE2A 1N2OA 4IURA 2VS1A 3K0HA 4NEGA 1EKXA 1P1IA 3UWKA 1DQNA 1RFGE 4B6GA 2GTHA 1YB1A 4JQOA 4RUGA 4C5HA 1YVDA 2EBFX 1U3UA 3FFBA 4D26A 4M8IA 1UK9A 4UC4A 2Q6TA 3C4JA 4KTVE 5CX1B 5BYBA 1QHSA 2FGKA 4NDNE 1XHFA 4UUMA 1W2BB 2JAQA 4QJ4A 1WULS 2FAXA 3DTYA 4EGSA 4M55A 2IOFK 4RJ2A 2RHUA 3H5LA 4EB6B 4XLTA 2EARA 1QCOA 3KV3O 4AYXA 1IN1A 1UGSB 5GAMf 1ATZA 1KD1U 2XEDA 3PENA 3DMNA 5K8UA 5FIUA 3NH9A 4YROA 1MT3A 3HM9A 5LBIA 2G80A 2QW0X 1VIFA 1XJ0A 3PI6A 5JXIA 3A3KA 3EWIA 3AXSA 2CLCX 5CB4F 3S3NA 2XODA 4F3TA 4HWSA 3HVKA 4KSCA 3T99A 4C92D 4TTTS 2RGYA 3ZWWA 4L5JA 5DIZA 1GGHA 1FTWA 2CZGA 4EHDA 3D4OA 3L6OO 4ND2A 4QHYA 2I8CA 3H9CA 2G3YA 4G8JA 3WRXA 1UANA 2GKGA 1BS2A 1IY2A 1C9JA 1DQPA 1I6KA 2LIPA 1KVUA 4HFJA 4JB2A 1YJWT 3W7VA 4KFCA 1RACA 4FGJA 1BCSB 3CCRA 2DR0A 3HUFA 4TWIA 4C92A 2UKDA 2WJAA 3DH0A 4F6RA 5BV8A 4H16A 2MYUA 3VR2