2DETA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the pre-reaction state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
365
structure length
365
Chain Sequence
b'TAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
molecule tags Transferase/rna
source organism Escherichia coli
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
total genus 85
structure length 365
sequence length 365
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2detA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2detA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2detA01
2DETA 3MMPA 4B44A 3MUEA 4OUDA 4ZCTA 3ZBTA 1A8HA 3ZZUA 4JYZA 2DPLA 4MQ6A 1H85A 1D2EA 3U2QA 4PC1A 2ZUFA 1Q77A 4ND7A 5J58A 3W2GA 1YI2B 2QTNA 4DDKA 1JECA 1XNHA 2DR2A 2C78A 2PFSA 5EMNA 4G5YA 3G6KA 2O5RA 1G7RA 4KR7A 4MAFA 4RUKA 4NZPA 2HZ7A 1I6KA 1TUIA 1Q82D 1NSYA 1GLNA 1J70A 5F23A 1G8GA 1DDGA 4Q16A 4CDNA 1JB9A 2HCJB 1EE1A 1OWOA 3CLRD 2QUHA 5LLTA 4YALA 3ILVA 1T9GS 4WNYA 5JBNA 1EXDA 3TS1A 1FNBA 4C0SA 1QRUA 1PFYA 1YI8A 4RPIA 1ZJWA 4U9UA 4MWCA 1IQRA 1KTVA 2XEXA 2XNJA 4ND6A 2R6HA 4YAWA 1OWNA 1KP2A 1KC8D 1NZJA 1KQOA 4MVWA 4PY2A 4ZT5A 5TEWA 2DEUA 3GUZA 5HG0A 2DCUA 4MW2A 1VQOB 4RJLA 1XE1A 1NJID 3QFSA 1XJQA 4HE5A 1U2RA 2PXHA 4A91A 2DXIA 1DDIA 1JA0A 1K73D 1G7TA 2CYBA 1Q15A 4U8HA 3U1VA 3CD6B 2X1MA 2PZAA 1R5NA 1EUYA 1DARA 2C77A 3ZC3A 4MW4A 1WQ4A 1J09A 3CW2A 1YIJB 2X0KA 3L92A 2QJTA 1KP3A 5IHXA 1W2BB 3B8HA 2Z08A 4EG4A 3CCVB 4MUFA 5HXBA 3P52A 2D5BA 4LBYA 3G6EB 3TNJA 2A1UB 2X3FA 3VNVA 4FN5A 4UZEA 1OBCA 3UOWA 1QG0A 4RCZA 1J20A 5LFAA 2BGIA 1QUEA 1N2BA 3NBAA 1W87A 2D74A 4JZYA 1OB5A 3ZZ0A 2Z3VA 1OGIA 1O94D 3LVBA 1VQLB 4PBTA 1VQ9B 2QMUA 3IUEA 1K9MD 5H16A 3TZEA 4EGAA 1ZM2A 4G1VA 4YMIA 3AVWA 3FETA 2FX3A 3FH0A 3KT6A 5THXA 1WXIA 3WNBA 4AF7A 1JZQA 3QSYA 2OQ2A 1SM4A 3FDXA 2R5WA 2A86A 1QGZA 2EJCA 3FWKA 1IFXA 3W2EA 2CYAA 2IP1A 1TVCA 2RE8A 2YWGA 1R6XA 1MAUA 1FNDA 1NUUA 1P7PA 4KR6A 5DB4A 1PG2A 1VQ7B 2J4DA 1QFZA 1IH8A 1QFYA 3QFRA 4MWDA 2A1TS 2OK7A 4GU5A 1J9ZA 4WSOA 4L2IA 4MW0A 2XNCA 4F3RA 3OJXA 4QFMA 4B48A 3AVTA 1IHOA 2GM3A 4KPUB 5TGTA 1O96B 2GKSA 1TYBE 2AZXA 1YUNA 1FNMA 3W2FA 2ZUEA 1IB0A 1LI5A 1TTTA 3HMQA 1O0BA 2BMWA 4FK8A 3QE2A 3N9IA 4PBRA 1QRTA 3ZJTA 1OB2A 1Q11A 1N1DA 1TYCA 3FOCA 1DNPA 3IOBA 4I6EA 5TR9A 4EG3A 2HGZA 3VGJA 3W2IA 1TYDE 3N2YA 1MB2A 3TQOA 1KRHA 3ZGZA 4B43A 4RD3A 4MVYA 1OWPA 3W5VA 1PFWA 1F60A 4FWTA 3ND7A 2VTBA 4G6ZA 4YHBA 1KD1D 1H3NA 2YWCA 2DUMA 4ZCSA 4G5GA 1O95C 1WKBA 3RJZA 1O0CA 3KFLA 4ZT2A 3SJZA 1TYAE 2QUKA 5K0SA 1S72B 3E27A 2H29A 4RD0A 1D2RA 2YWFA 3A05A 3H05A 1V8FA 3IUBA 4MW7A 4QRDA 5H7XA 4MUEA 4MYTA 3B78A 1QNFA 1XB2A 4DQKA 1QUFA 1VQ4B 1JIKA 2VZLA 2OV4A 3COWA 3D6VA 1JZSA 3HL4A 3N8HA 4ZT3A 4MUGA 1IJFA 1N3LA 1UMKA 2J7KA 1QTQA 3W5UA 1M90D 1GTSA 4LBVA 1MRZA 3SP1A 1QJCA 3CC7B 3P0JA 1EFTA 4P3YA 2CYCA 3ZUGA 3CB4A 1WXFA 2PMDA 2WSIA 3IODA 4YP5A 1WXGA 1JIJA 2DY1A 2WQ6A 3DLAA 3HZRA 2OTLB 1ZUNB 3FPKA 1XNJA 1CNFA 2G36A 2YY5A 3I05A 3CMAB 1KQSB 4NDAA 1GVHA 4OJMX 2NZ2A 2V0CA 5TEVA 4EG7A 2RC5A 3AG6A 2QUJA 3AIIA 2E21A 2AHOA 2VNJA 4DDHA 4EG8A 4MUJA 3MXTA 3CLSD 1JGTA 1EXMA 4OUDB 1EFPA 3FJOA 4EG1A 4UZFA 1Q81D 2JANA 1IVSA 2BV3A 2QDXA 4UAJA 1K92A 2C5SA 1I7PA 1NUPA 3CCSB 4B4DA 2D54A 2IELA 2PG3A 4E1AA 5FA6A 3RHSA 1WXEA 2X1LA 1OWMA 1DG1G 5J59A 3WYAA 2D13A 4MULA 5JBQA 1I6MA 2BVNA 4ZCLA 1AMOA 3LCJA 4JFAA 3VU8A 3PNYA 1F7VA 4HE6A 4RD2A 1MAWA 2YXNA 4HJXA 1YHQB 2DERA 1E64A 3A04A 3J81k 3IVXA 4PBSA 1R5BA 4LBWA 1CNEA 4CDMA 3QE4A 3VO2A 4RD1A 4MW5A 3GMIA 4R71A 1MB9A 1B6TA 4U7JA 3SEQA 1EFVB 2E18A 3ZZTA 1YUMA 2YWBA 4MVXA 3ZJUA 1ZM4A 3ZJVA 3AVUA 3UMVA 4YAUA 1M8FA 3VO1A 3CCMB 1N2HA 2JA2A 2V0GA 4AC9A 3E20A 1H42A 4MLPA 2EIXA 5EKDA 3U6KA 1E62A 1KK1A 3OJWA 1YJ9B 2J5BA 4CQNA 5AN9A 1XNGA 2BTEA 3CC2B 2A4MA 2XRYA 1MC1A 4PC2A 4TMVA 1TQ8A 3X1JA 2B7BA 3JQRA 4F4HA 1JILA 4TMZA 1OBHA 4MUKA 4MW1A 1F7UA 4ARIA 1G59A 4C43A 1LW7A 5H59A 4ZV4A 1GR1A 2J09A 1QH0A 3ISJA 3INNA 4KR9A 1FDRA 4YAOA 3CVVA 2BYTA 3B82A 4M1KA 4ZT6A 1MBZA 3QTTA 5BNZA 4N3GA 1QVFB 3IMGA 4LC0A 3KT3A 2B7LA 2EFGA 1D1NA 4AF6A 4XFDA 1GN8A 4ZCRA 4BPRA 4ZCIA 4PC3A 1R6UA 3IMEA 1M8KA 3AKZA 1FFYA 1N2EA 3CA8A 3VNUA 1WOYA 1CT9A 4N3NA 3CR8A 3P26A 1QU3A 4MW6A 3CPWB 1U7XA 4TN1A 4AS1A 1K4KA 1KH3A 3CLTC 2BSAA 3FY4A 3PENA 1VQ5B 1BS2A 1NDHA 1EFVA 3OZWA 3U6BA 3A4IA 4EH1A 1K97A 1QQTA 5FO0A 5KCMA 3AVXA 3CVYA 1JHDA 1D8TA 1JJ2B 3G59A 3CRZA 2QTRA 1MJHA 4NBSA 3P0HA 4YP6A 2QJFA 4MUHA 4DLPA 1PFUA 3NV7A 4YBRA 4EF6A 3AFHA 1CQXA 3HFJA 3ZIUA 2NSYA 1WQ3A 3F3MA 2B7CA 1BQEA 3OZVA 1GZUA 4I6GA 2E1RA 1OGJA 1ZH6A 4JXXA 4U63A 1COZA 1HYBA 1O97D 1NURA 3QFCA 3IOCA 3PNVA 4J76A 5J5AA 3UC5A 2GPJA 1ZH0A 1VBKA 1EFUA 1QGAA 5HUJA 4J75A 1H3FA 4TMTA 1O95D 3A2KA 1VQMB 1TLLA 5TV2A 1ZUNA 5H5JA 4TMWA 2VTBB 1YJWB 1VQPB 2CFOA 3DV2A 2Z09A 5GV7A 4B47A 2BM0A 4M53A 1GAXA 5KSWB 3IMCA 3JQPA 1N2JA 2AG6A 1SKQA 1YITB 1QFJA 2BPOA 2H2AA 5TS2A 4Y7CA 3H9CA 5LM3A 2YWHA 1FNCA 2OK8A 2GOYA 1KAMA 1RQGA 2JAXA 4K1XA 1T6YA 3KT0A 4DE5A 1H1TA 2GQFA 2ZITA 5GV8A 1M83A 1NUSA 1TFUA 4KKVA 1VQNB 3CVUA 4RD4A 4KPUA 3L93A 3FG9A 3TQIA 1YIAA 3H97A 5DASA 4NATA 4QREA 2PZBA 5HUHA 4XSVA 1OD6A 3VRHA 2I1LA 1EP1B 2A88A 4XFJA 4ZCPA 1YIDA 1Y42X 3COVA 2O8VA 1H3EA 4NCNA 1UFVA 4R2LA 4MW9A 3CLSC 4RCYA 1S0UA 1EFCA 1GJRA 5FNZA 1R5OA 1J1UA 2OTJB 3MMXA 4NX2A 1WY5A 2VNHA 4ZT7A 4ZCMA 2QUIA 1Q19A 1M1KD 2CNDA 3G71B 1WDTA 1T9GR 3JXEA 1WJGA 2B5OA 4MUIA 1WXHA 3JQQA 4HK4A 4AQ7A 1KORA 4QBTA 4G5FA 1IJEA 2CSXA 4ZGQB 3CXCB 1O94C 1JNYA 1OWLA 3AG5A 3MLBA 1B2RA 4P2BA 3ZXIA 2DLCX 1WZ2A 2CV0A 1QU2A 4L2IB 1K4MA 2E89A 4ACAA 5DK4A 1GTRA 3AGQA 4Q93A 1MOPA 3WNCA 3CLUC 3IOEA 2A1UA 3CCUB 4TS1A 1QVGB 3AVYA 1F9AA 1KH2A 4PGOA 2A84A 1N8RD 3K9WA 1AIPA 3OZUA 4M2LA 1N78A 1N0UA 1G8HA 1KK0A 4FZJA 2NPFA 2QTLA 3CCRB 1B23P 1VBMA 1VLHA 4HPWA 1GO2A 3M5WA 1X8XA 1QX4A 4P6VF 1JMVA 1N2IA 3ZXSA 3V76A 4H3SA 3UY4A 3I56B 4K03A 3FHJA 1M1ZA 3Q4GA 2A7XA 1KJZA 1JIIA 4ZT4A 3SYTA 4CT0A 1NYLA 3S3TA 3OW2B 3HV0A 2CV2A 4LBZA 3X1KA 2BF4A 3CCLB 1FRQA 2YWEA 1O6BA 3LOQA 3I55B 2E0IA 1KK2A 3NBKA 3IH5A 3QFTA 4ZGNB 1ZM3A 4ACBA 2J07A 2QJOA 1KKUA 1ELOA 4M4SA 1PG0A 2VNIA 3WBKA 3I1FA 5DSZA 3ND5A 3PXUA 3CLUD 5K0TA 3WBJA 2WQ7A 4H9GA 3CLRC 3H9BA 4YAFA 2XRZA 4Y9UA 3C8ZA 3H99A 1M8PA 3Q12A 2QN6A 2QTMA 3DO8A 1G8FA 1U3CA 4EG5A 1EWYA 1ILEA 2HDNB 1Q7YD 4R2MA 3TZLA 3DPIA 1NI5A 2QEXB 1VQ6B 3OTWA 1T6ZA 4S1OA 4ARCA 1W35A 3CLTD 2CRVA 3IVCA 1J21A 3FNRA 5DEOA 1N2GA 1N0VC 3G4SB 1I6LA 1R6TA 1T6XA 2RC6A 3RK1A 3SZ3A 3CVWA 3MLAA 3Q10A 5TY0A 3PNBA 1EUQA 4M0LA 4MWBA 1HA3A 1GAWA 3SZGA 4QHYA 1EP2B 2QTZA 3FIUA 1BJKA 4PC7A 4TMXA 1U0BB 3RFFA 1NUQA 1ULHA 1F20A 1K8AD 5KWVA 2BN4A 3GLVA 1E63A 4MUNA 1VL2A 3KT8A 2IJGX 1N77A 1F4LA 4HJRA 3CVXA 1FRNA 3AVVA 1KAQA 2ZP1A 3P0IA 4EG6A 2RD2A 3X1MA 1VQ8B 3SDBA 2CV1A 3OP1A 4F7DA 3IDFA 3LO8A 2HMAA 5AHWA 4JXZA 2BGJA 1KH1A 3AGPA 1J1ZA 1PFVA 1M8JA 1S4MA 2CUZA 4DJAA 1G7SA 4MVCA 4B3XA 4BWVA 1NUTA 2WB2A 1NP7A 1EJ2A 5FO1A 4X0EA 1M8GA 1JEEA 2VNKA 3COZA 4DQLA 3SEZA 1JA1A 3MHPA 1U7DA 3G5AA 1N75A 1VQKB 1SURA 1N2OA 4R0NA 4MYUA 4EFKA 3ND6A 1QGYA 4I6JA 1JEDA 3ES9A 1KQNA 1I2DA 4NAHA 2QA4B 4GRIA 1V47A 1BX0A 3CCQB 2PZ8A 4PC6A 3HGMA 2VYQA 1Q86D 1VBNA 4DDMA 4DNXA 1A8PA 1O97C 2VXOA 2A1TR 3P27A 1O5TA 4NAUA 3K32A 3W2HA 2X3UA 3E1YE 1U3DA 1FYDA 2EL7A 3FI0A 3N05A 3UK2A 3CCEB 2CT8A 1G7CA 1YJNB 1O96A 2PLFA 3VMFA 3AL0C 3D6UA 3BL5A 1TEZA 4RD6A 1QRSA 1LI7A 4IW3B 1GPMA 2AKEA 1ZM9A 3CCJB 5IJXA 1BX1A 4Q7JB 1IQ0A 4MWEA 3COYA 3LE8A 3ELBA 4G1BA 3PRHA 1KK3A 3QTBA 3MCAA 1YULA 3IVGA 3W5HA 2BM1A 3RBAA 4Y9RA 1KR2A 1X6VA 1GAQA 3ZBUA 2J08A 2TS1A 2PIDA 4K0RA 4ZCQA 1IQUA 3WNDA 4J0QA 1EP3B 2PIAA 3CMEB 1IRXA 3WY9A 4YP7A 5KHAA 3RK0A 1W34A 1KQPA 4WQMA 1EFPB 3WXMA 3CC4B
chains in the Genus database with same CATH superfamily
1L4YA 1YIOA 3MUEA 2QF7A 5D8DA 5CB4A 3EF0A 5A0VA 2FLKA 1JQAA 1RVV1 4IHJF 3QE0A 1CCWA 1G5PA 2FZCA 2XDBA 2IHTA 1BQ4A 4ER6A 1IIRA 2AN4A 3BB1A 1BXGA 1MIOB 1K28D 4PAMA 3FPEA 3GJ8A 3TUIC 3JPWA 3VI4B 2WFLB 3H0CA 3ZDYB 4HX2A 4DJ5X 1UJCA 3MHTA 4LI0A 3SKBA 1G19A 2REQB 2CXQA 2VBGA 1RP7A 3OE7D 4J1TA 4O2BB 5EP1A 2E6ZA 4EBBA 5C7YA 2E12A 2J30A 4FC7A 3HYNA 1AGXA 3HB1A 9LDTA 5GJVC 1PNRA 1M76A 1H9CA 4UXJA 3NNSA 5FA5A 2C3OA 5LQJA 4MPTA 1TU0B 3BCDA 2VRBA 4LZLA 3T4PA 3H7AA 4ZGBA 1EXDA 1MOZA 4P6YA 2W8BA 3O8QA 4GLJA 3VYGA 2N3ZA 3H6KA 3CC7Q 4TVOA 5J2TF 4HL6A 2HJ9A 3Q6NA 4RPIA 3L5OA 3EGIA 1YFJA 3GFVA 2AFIA 2V3WA 4G5RA 1HX7A 4N0AA 2XEXA 1XR3A 2AOXA 2BEJA 3IEIA 2FMHA 4KNVA 4ZXPA 3T3DA 4F5DA 2ZWMA 2P5TB 4PY2A 3BC1A 4DJFC 5CFOA 5EHGA 3VDQA 3A8HB 5GPBA 4EEKA 2I6XA 3UF4A 4RJLA 2YSQA 2OAWA 4HE5A 3CMEA 2B78A 1HDZA 3ONFA 4A91A 1EX9A 3VYSB 4PJOF 4IDOA 2RJFA 1P2VA 4OMUA 4C6SA 1QH8B 2HTEA 4A4GA 3ZC3A 3CCST 2YYAA 2OWDA 3PGLA 5ALEA 4F85A 5JFTA 4Z3OA 2AFIB 5LVAA 2P67A 2GN9A 3C4SA 1W2BB 2DFKB 4HQLA 1WXBA 2XYQA 4EG4A 3LPDA 1Q95G 4KP7A 4HNGA 5SYMA 3FX2A 4QVDA 3FCSB 3QKRA 3ZI7A 1P6QA 4EQ6A 2ZM5A 1XELA 2PUDA 3ILHA 1OBCA 5TE9A 1N6NA 8AT1B 3CH5A 3PFHA 3VR4D 1LB1B 5EC7A 4PWYA 3RKRA 2C2KA 4RHEA 1G9XA 3NBAA 4IS3A 4TKUA 5M29A 1XTVA 5LA6F 3SBXA 2WINI 5AT1B 3R0XA 4ILKA 4JJ4A 3TBHA 1VQLB 1C0PA 3BB3A 2C4MA 2RARA 4FCVA 1A9RA 1WL8A 1T3HA 1KVRA 3G1TA 2JFYA 1E6UA 4N39A 5CQXA 3O9MA 3QSYA 1QS0B 1E2JA 3FDXA 1N0HA 3IUQA 4X95A 3L4BA 5JJ5A 4RACA 3MCAB 5AK4A 3RVNA 1NLOC 1K8AR 1QYVA 4JC0A 1QZZA 3ITKA 4FX5A 2QLJA 4JPBW 3WLAA 3IE2A 4V0QA 1YOBA 3REBB 4DT1A 4MV4A 5I7FA 4LFAB 4WY5A 1PG2A 2HCTA 4XU2A 1VI6A 1XDDA 1BPLA 1G0NA 2HF8A 5BSYA 2P91A 3M81A 1J22A 1J7KA 4QUJA 5B4TA 2O8EB 4MPRA 5G0VA 2R68A 3D7SB 2QV0A 5IASA 1FFCA 3OQHA 4PHTA 2E5QA 3DUWA 4RTOA 3ZKWA 1EJ0A 4AECA 2QA4T 2EOAA 4MOWA 2VWGA 1DC8A 1UBGA 1WPQA 3H5OA 4OHRA 4URYR 5FP0A 5I9MA 3OYJA 3F7NA 4OHFA 3OTOB 4QVZA 4P9SA 3KJQA 4KKSA 3S2SA 1Z5NA 2LIPA 4HGNA 2R8BA 2X35A 2CH4W 1KOFA 1E77A 2FQYA 4CC2A 2KQUA 1O03A 1ZIYA 4PBRA 3C43A 2FEKA 1VOTA 4E5KA 3TLEA 1LJUA 2YVQA 5AKLA 2XGOA 1HKUA 4BVHA 4G0UA 2OG2A 2J48A 4QGBA 1XD9A 4RIIA 4ZJYA 2DAQA 2C4HA 1NJIC 4ZN1A 4Z88A 2X42A 4PXYA 5IAJA 4RPBA 1PFWA 1J49A 3IE0A 5F52A 1I3CA 5H0IA 2YWCA 1H3NA 3BREA 3DFUA 5EI5A 4U00A 4Z8YA 3KL4A 4XKJA 1TYAE 1YQ9A 4K3VA 1ND5A 3E61A 4LDUA 5J35A 3Q38A 2Z58A 3GFGA 4MVJD 1PKEA 4IHJA 4XR4A 1ONPA 4H6WA 4MUEA 3E7PA 1PR2A 3ZG6A 3EC7A 5BMVA 5I8WA 3CCET 5CYOA 2B8EA 3ZEHA 1VIEA 4W9NC 3NM4A 1KDVA 3V8JA 4DAOA 2VJDA 4KMMA 1X27A 3W5UA 1NBMD 3AMVA 1ORHA 4KQMA 1Z4NA 2EAYA 2WP0A 3G8YA 4ZA2A 3PUYA 1D0YA 1MX3A 2W83A 3CN7A 4OXQA 3JV3A 2IUUA 2V7BA 4HVUA 4EF5A 1N5JA 5BW4A 1WFWA 4N5DA 4LVCA 2CDTA 1EGAA 1NF2A 1ISGA 3EDQA 3OZIA 3BAFA 3IIIA 4MV0A 3FEOA 1ZUNB 4YJDA 1KR5A 1QF7A 3ZQ6A 4CM8B 3J7AC 4NZZA 2HA5A 2UVQA 3IPLA 1FVHA 3CH7A 2V0CA 2I7TA 3FUUA 1VQ9Q 1CYDA 1P19A 1ZUYA 3HFNA 1WCIB 1YBHA 1WPGA 2K2QB 3CNQS 3I01A 4MEAA 4R98A 1IXKA 4DDHA 4EY7A 4Q4JB 1JGTA 2XADA 5B58T 1W581 5L8RE 1PJBA 5A7HA 5KBYA 3CO0S 4F7UB 5LP6C 2KX7A 3TZKA 1W36D 4PYMA 4CKXA 4D02A 3R3JA 3A1SA 3IHTA 3AB8A 2BZ1A 1G17A 2C2YA 1PT9A 4IIDA 1W4AA 2D54A 1UHCA 3CCSB 2YUTA 2CV1A 1Q82R 2KWIA 2PQWA 5KCOA 2PAFA 4AJ9A 2WHPA 1SVMA 3FB4A 4DR6B 2D9TA 5J59A 4B71A 1P81A 5FPSA 4F17A 4BE2A 1TTQB 2I2FA 3QP9A 4O2LA 5EZSA 3RJ5A 3VU8A 5CA1F 1W48A 5HFNA 1PAUA 2YXNA 5JMOA 1UCFA 3ZWWA 1RM5A 3U4HA 3K53A 5F1YA 1DMSA 1NQTA 4C88A 5ALIA 4EJSA 3IHWA 1NN3A 5TQ2A 3RTGA 5L95A 4AKTA 2GHTA 3OLVA 2G1PA 4MW5A 2HHAA 2JAWA 2JHAA 3S27A 3L8ZA 4BRZA 4ZANA 1NOJA 2XYRA 1NY6A 1XZQA 3C7CB 2CF6A 3QPCA 4FKZA 4NYIQ 5EIHA 2VUTA 3ZS9A 2H65A 5C53B 1U5CA 1QVFS 3IIEA 4RVFA 4IYRA 1TAUA 5DN6A 1J00A 5LBUA 2A0FB 4A8JA 1EVIA 4QARA 2JVKA 2ZYHA 4AG2C 4GPTA 4BACA 3FD8A 5FYQA 4JVLA 1VLOA 3QVWA 3BWYA 2WT9A 1D9ZA 2V8KA 2VUUA 1GOTA 3T51B 2XEDA 3ESRA 3P9YA 3QDFA 1PTJA 3VSBA 3VKWA 2VAXA 4RTQA 3FTPA 3T52A 2OBTA 3JCZA 4UPDA 2WWXA 5B3KA 2J5BA 1VC2A 3GJ0A 4G2NA 4RAOA 3TEMA 3TOCA 1B7TA 4CUKA 3NH9A 3GUHA 5J39A 3UAOA 4LY3A 3W9UA 2JN9A 2Q6TA 3P0EA 2A4MA 5HS6A 1OPKA 3ZCXA 3HDYA 2WJHA 1RYMA 3TCNA 2DJIA 2ONCA 2QTFA 1MTZA 3AEKA 1XAJA 3GT4A 5M34A 1W4RA 3QPBA 1FSFA 3FCCA 3T0IA 2IPOA 2VP0A 4PFOA 3P2IA 4TV8F 1OBHA 3G2MA 3V97A 5LMNB 3WRXA 1KL7A 4QFBA 2J09A 2GXAA 3M1LA 5L3VA 4EMKC 1N1EA 1KI9A 2FMXA 2EGCA 3B6EA 4AZVA 5G53C 2AKAB 2MCNA 4U2DA 3RABA 1BMFD 1S8AA 5JXWA 4AMGA 3KYBA 1YS2X 2GFHA 1N8RR 1JKFA 2RJEA 1FYFA 3EA4A 4LN1A 1YLOA 1JQEA 2XWJI 5EUBA 3KPJA 4QUIA 1F2DA 3UW3A 4KDCA 1L1RA 4OMQA 2ZSDA 4NEGA 3CA8A 3VFDA 1F9EA 3LIIA 2UVPB 3BF7A 3CR8A 4OOFA 3KO8A 3WLKX 4KSYA 1BH6A 1SKUB 2BISA 5E4JA 3SX4A 5LYJF 3KYCB 2A0FA 3D4OA 4BFSA 4RTZA 1VQKQ 3VJMA 2PKYX 1EFVA 2PWPA 3HUUA 2ZR7A 2ZYAA 3NGMA 3L6DA 4TRJA 3B1VA 3GRKA 4GPEA 1AQ6A 4PYRA 1U1SA 2ZLBA 1DC6A 1AT1B 3KUFA 1AK9A 1YCDA 2ZWOA 3BD6A 3PC7A 4UXIA 5HE8A 4DQUA 4E46A 1EHCA 2GK7A 3NV7A 1CW2B 2Q4BA 3L79A 5LJ5g 1AEYA 1V1MB 1XMJA 4RULA 2X5KO 1WQ3A 2YHUA 3D1VA 2E4AA 2UYOA 4GEKA 4B3BA 4R3NA 2R58A 3V4PB 1SHFA 4JL6A 5A02A 4CETA 4L5AA 1GZUA 1J07A 3HBFA 5C2JB 2V4DA 3QKIA 2PV0A 4YRKA 1FUKA 2G82A 4RG8A 4C20A 2AZDA 4R41A 1XL1A 1Q86C 1JVSA 4TWBA 3R1IA 4GMFA 3QOWA 4IGIA 2XIQA 1PL7A 4EMSA 2P5UA 1WS6A 4IMPA 4UVHA 3WYBA 1NC3A 3DEKA 3ZHBA 3DMTA 5AVSA 5IN4A 5CNJA 5KYWB 2BFPA 1BJTA 4HTAA 4N5LA 4BFCA 3HA2A 2R5AA 2FAXA 1DKOA 1FP4A 5TS2A 1SKQA 1P74A 5LDDC 1V3UA 5DLPA 3GRVA 4DM7A 1WO8A 1ZAKA 3JAWB 5EJAA 3MCUA 2J3KA 2B2XA 1ZNQO 3RIYA 1ZUKA 1GTVA 4G67A 2D1XA 4U6NA 1OXSC 4G5HA 1C7IA 1E2EA 1G6KA 1XZIA 2PZJA 2MSWA 2BSXA 3CZQA 1HG0A 1Y9JA 1I5OB 3FPJA 2Q46A 3HJUA 4LMRA 4XWYA 3LHFA 1QIGA 1W0CA 2F67A 1YJ5A 1DT5A 1E2KA 3E22A 4LPSA 4M1ZA 3E3NA 2BDTA 3ROTA 1UPBA 2YXEA 3HU1A 3I12A 4KI0A 3RYFB 1SWVA 2ASVA 1AQJA 1ZRSA 1J0XO 3S2YA 4D9HA 4KAJA 5B1DA 2YQ5A 3ER8A 4MW9A 3CLSC 5KJFA 2FG5A 4WD3A 5HR5A 4LGMA 1BCRA 1NNUA 3SJAA 4GI7A 1U4OA 4PCVA 4JLBA 4MS1B 4F3TA 2HN9A 3Q7TA 1H69A 2QUIA 1EFAA 3PGGA 2D1SA 4JQZA 4L85A 1ZEJA 2CBZA 3M6WA 3ZWPA 1E3JA 4BRUA 1ZIXA 1K9MC 2CLKB 4HK4A 1KORA 2C20A 4G5FA 1BKSB 3EA5A 1PFQA 5EXDA 3O2SB 2GFQA 1VE7A 2O2SA 1NJIU 3M54A 1I3MA 2WUEA 3LFHA 5AM0A 3FPCA 3AEQA 2V4ZA 2CHGA 3B3AA 3HR8A 1GRNA 2D1TA 4TKVB 5EERA 3WADA 3C24A 3VC2A 1G2OA 1LPLA 4PVDA 4EPVA 3CLUC 3K4HA 5SICE 1VQ4A 1W25A 5JANA 2ZBUA 3KOWA 4Q7MB 1ISPA 1UPAA 1AB6A 5CJ2A 1UBMS 5IARA 1QCFA 2Q2QA 2PZEA 1GTZA 2WFMA 3SJUA 3DQQA 2CMKA 4FYYB 4IUDS 3C6YA 3IV9A 2LGJA 1RAIA 4IXMA 4JI6B 5BN1A 1C7RA 1P80A 5IYZA 2QG9A 3DBRA 2ZFUA 1CZOA 3KZVA 4KQ9A 1G6OA 2C8VA 3FZYA 4XMYA 3OQIB 5TQJA 3G85A 5FLEX 2CV2A 3BEOA 4LBZA 2B1QA 2BGUA 3F71A 1AUPA 5LCXA 4YYZA 3KQUA 2RJDA 1GNTA 1KZ1A 4PPFA 4CQJA 3RVMA 4E2YA 2QLBA 2ZBVA 2FEMA 4KV7A 4X91A 3H5VA 4REQB 4YCLA 5C37A 4YXWD 1F5SA 4AKEA 2DVJA 2GVNA 3GJSA 5B1EA 2Q7DA 5FTWA 5KNCH 3WOVA 4Y6LA 4P7GA 2OG1A 1T0UA 2COKA 5TJ9A 2V0NA 1WM1A 2DLDA 4PS0A 3OIFA 4Y2XA 5DCUA 4CL8A 1LBEA 4L07A 4MKHA 3ICVA 4F5EA 4TKUB 4YAGA 4PL6A 3C8ZA 4RMJA 1VQNQ 4OHCA 3V5NA 1BRTA 4RPCA 2FRXA 4ZAGA 1OFUA 3G3EA 4O2AA 1QCNA 5DF1A 5E6UB 1PUXA 2W6OA 4LOKA 3DLIA 3QENA 1JEYA 3M3HA 3BMNB 3CGWA 1WMDA 2PTGA 1S2GA 4TXLA 3B1FA 3D6FA 1L3BA 2AW5A 1LVHA 1T6ZA 1AKVA 1N3IA 4S1OA 5JAUA 1W35A 1G5RA 1MV5A 2IBTA 3MUFA 5DNUA 1J21A 2BI4A 2W48A 5CKFA 1UC8A 1R6TA 1M1GA 1TDJA 1X1CA 2G67A 3GC6A 2LT1A 4L3WA 3THWA 4NIMA 3RDVA 3ZCSA 2ZTLA 1KNQA 3LYLA 4ENSA 4NULA 2BFCB 2IYFA 2J3DA 2HKNA 3DBHA 1JFFB 3K1AA 3L7IA 4UTZA 4O6JA 4A6DA 5LL6P 3GLUA 4RZHA 2V55B 1NG1A 2RO0A 1J2RA 2RHRA 3NIFB 4OQEA 3IQEA 3LHSA 1FWZA 1VL2A 4HFNA 4OQNA 1UMCB 2CWDA 3I04M 1QORA 3L2RA 1CVRA 2VBTA 2JGDA 3DVQX 4K6CA 4I1VA 4F6LA 3EFOB 1L5VA 2PYDA 4HDSA 4MRVA 1YQXA 4WKBA 4BMZA 1FDSA 3E5RA 3HXKA 4GXQA 2PEZA 1TUBB 4QULA 4XCQA 3LDAA 3X2SA 3EZLA 1BXZA 4PU0A 4AWAA 1UD8A 2W8BB 1D2CA 4KULA 3A6HA 4PR0A 4C7VA 3AUJB 3IP5A 4DJAA 4EUFA 5A4JA 1P2GA 4DB2A 4E5DA 1E2HA 2VJOA 3GP8A 1M7HA 4FYXB 4P98A 3H2KA 1CUJA 3KV3O 1UD4A 2CT3A 4Z4SA 1F1JA 3Q7IA 2ZSKA 1U0TA 3R6GA 5GY7A 1WB6A 1RJ9A 1JZTA 5B2EA 3SJPA 3A4VA 2RGYA 3UAVA 1PQ4A 1YI2A 2RK1A 3E2PA 5SYAA 5IYWA 2IZ7A 5FFMA 1PT5A 2W6PA 2OD7A 2RHZA 5IHKA 3AEYA 1WB9A 1QLWA 4Q3AA 4A3SA 2PL5A 1Y1KE 1VBNA 3H1TA 4JVNA 3TW0A 5G41A 4ARAA 4L6V5 2WBLC 1E9BA 3DOCA 2P3MA 1R4ZA 2FSHA 1JR6A 2DHDA 1BDBA 2O4XB 2BGMA 4CZ2A 3WDMA 5E4FA 1Z6PA 5IYZF 1GPAA 4CNBA 1G7CA 5B57C 1N6KA 4LQ4A 3FNHA 4K9DA 4PCLA 1GUZA 4TTJA 2DPYA 3HJCA 3N0XA 2B4KA 3ORSA 5HJ2A 3CCJB 2F3UA 4R0KA 1MT0A 2HIGA 2TRSB 1RQLA 1LEHA 2ZETA 4CN9A 2XDQB 4F93B 4J90A 1GYQA 3QWBA 4OI2A 1STOA 1Q0LA 3RFCA 5BMOA 3OQPA 4PIMA 2UUAB 3PIOA 3MCAA 3KKLA 1LQ2A 1X6BA 1K5HA 3Q0TA 5J2UB 3UB3A 3P9IA 4CF3A 4OY3A 5A2QE 4JJ6A 1LVKA 3UUWA 2YFYA 3KYJB 3PEEA 1VJTA 4LE0A 2VJQA 2WWTA 2O20A 2QXYA 3RQSA 4M9UA 4TTRA 3URMA 2GNAA 3AUKA 5DK6A 1IZ6A 3VS2A 4LDWA 1QZTA 2I7CA 2QL7A 3ENVA 2H3EB 3HSYA 4G7XA 4K9QA 4PXSA 3VGPA 3FUVA 1UXJA 4F04B 2BFAA 3CXCS 1UMDB 1N5DA 2D8MA 3LP8A 4H7PA 2F43B 4JLNA 1DP4A 1SUCA 4C4PA 1X0XA 2C58A 1U63A 3LBAA 1CKBA 2GHQA 3K1TA 1S2DA 1O4WA 3VDNB 1QPGA 4TKLA 2QSYA 4KUDK 3META 1SHZA 3H2SA 1T9AA 4L9RA 4A26A 2QU8A 4G0OA 1YZKA 1A0OA 4DCMA 2W11A 3GMTA 4M1WA 5KNBD 5F12A 3RHZA 1EA5A 3E9GA 4Z02A 1YACA 1FY2A 3UT6A 1TIKA 4LXXA 5K09A 2IYAA 3MTDA 4ASUD 3EZYA 2OUKA 4AZTA 3ESYA 4M77F 4R2KA 5LLSA 5JBNA 2A08A 3MG9A 4MZPA 3GPCA 4DR2B 4PZYA 2HLDD 2UYGA 2YFKA 1HLPA 3C8UA 3RUDA 1HETA 4N1AA 4F12A 5EJ6A 3WYDA 1NVVQ 1S02A 1VRVA 5AJYA 2R6CA 4DNOA 1HSQA 4Y2PA 1KY5A 3QPWA 4PSVA 1TQ4A 2PU9B 4W5OA 3JAKA 2C7VA 4REOA 1N5IA 4Y2UA 3V3TA 1Y1QA 1E6MA 2H4YA 3PIIA 5CDTA 1I1NA 3I55T 2PZAA 2R8EA 2LDBA 1Z83A 2W6NA 3CCJT 2QTXA 2ZUVA 1J09A 4BVLA 1F3LA 3H1PA 2C99A 2I3DA 1D09B 4RSHA 1E0SA 2HK7A 3OKPA 5FNVA 3WR5A 4CCWA 4LC9A 1NVMB 4Y2VA 1WZ2A 2D5BA 3G6EB 4FN5A 3R6NA 1J0AA 1U3UA 3EFOA 2ATCB 3PWKA 1SXJD 1EXWA 1Z4IA 4XCVA 5EN4A 1M73E 1VJRA 4FYVA 3THYA 1FUUA 2O8DA 3UFBA 2B86A 2K7FA 1P7ZA 4A16A 1NQUA 4HGRA 2VTDA 4Q39A 1VLMA 2G04A 4HV4A 2V6MA 4MI1A 1P44A 5JMTA 1SD5A 3HM2A 2LQ8A 1N2CB 1VQ9B 1YNOA 2NZVG 4J3FA 3HFOA 1A2BA 2H1CA 2XGSA 2EYXA 1WXIA 2IXGA 4GXNA 4D3XA 1Z6TA 3PJRA 4BJ5A 4MS1A 3ZCPA 1FFWA 4JUVA 2ZBFA 3WLJA 3KOOA 2PA3A 1MW9X 4TOIA 3UMFA 1JR2A 5I22A 1SBYA 2WHQA 1NUUA 1YJAA 1ZUIA 3M57A 5DBHX 1OH5A 5IXYA 4GR5A 2G08A 2ABWA 4FXPA 3TLCA 2RNAA 2P4UA 1U0GA 3AR5A 4MKRA 3UKDA 4AZ0A 1L7EA 4MW0A 2Y71A 3F2IA 3EULA 4HTFB 3FJPA 4OIMA 4OQQA 4FT4A 5ENVA 4QM6A 1L7VC 1FMVA 5JCZA 1SKMA 3GLTA 1NLFA 3A7DA 4UNPA 1NKVA 1Z7GA 1SQGA 2JAOA 4HGZA 2Z2ZA 3L8YA 2R8PA 4B6MA 1VIYA 4GP6A 2L42A 3VTKA 4FK8A 5CFMA 1DEKA 3D02A 3R7WA 3NMUF 4ABTA 1QYWA 4I6EA 4C0XA 4M78B 5FWBA 3K6KA 4QG3A 2Z5VA 2ZDGA 3Q9UA 4G6IA 2EZ9A 5ICSA 5IFKA 1OHHD 1E8MA 3TQOA 4PIPA 3HJGA 3JD0A 3WMEA 1KRHA 3ZGZA 1NRXA 1RE1A 4RD3A 1PWXA 1KXZA 2BCGY 4JC5A 2VTBA 2PZKA 2VPIA 4ND1A 1K08A 3ZE0B 2W42A 1I51A 4G5GA 2WNSA 3CE6A 4K9SA 4O4IF 4OU4A 3IA7A 3CWCA 1O54A 4HDAA 4NBNA 2CD7A 4WN3A 4UHCA 1SSHA 3ASTA 1CS4C 1KI4A 4RSMA 1RLQC 2D1FA 3S40A 1D2RA 1D7AA 5F1KA 5TQ0A 5MF6A 3SIRA 4D92A 3L82B 4M46A 1Z6YA 5BR4A 2XUPA 4X7EA 1ACMA 4U2BA 3ZU3A 2J9YB 1M10A 4L7QA 1E58A 3CRMA 3TQQA 3ZWNA 3UFXB 3VS3A 1IJFA 3MWDA 4ZJPA 4P0QB 1G4HA 1M6NA 1HNZB 4BDYA 1KRXA 3ZXYA 1T5HX 3ME5A 3U3XA 4EA7A 3S6WA 5PGMA 3JQ9A 1M2NA 4YP5A 3NGPA 2XUGA 4WXYB 1UGVA 3PC3A 4DLAA 3FOZA 2X6XA 3DLAA 1F8UA 2OTLB 3FPKA 2ZRHA 1YHNA 4OYRA 5CCAA 5EWLA 3OQJA 2FN7A 1U2GA 4BNKA 4XAQA 2DVEA 2Y4YA 4GOXA 2H17A 1ZJZA 3D6MA 4G85A 4Z4IA 4Z8XA 4CIXA 4ZYLA 4B85A 1H4TA 3IAEA 4ZAYA 4C4RA 8OHMA 3U1BA 1T91A 3SMQA 4ZI2A 1N9SA 4ZVLA 4AD8A 3PD7A 1PJ4A 4BYGA 1M5Q1 5I4CA 1Q0PA 1U0JA 3U44B 3U4QA 3GPDG 4R9VA 2JANA 3TR0A 4L73A 1UDCA 3RT1A 1MPXA 5ECAA 1N2SA 5KJCA 1FVOA 1D0SA 2EKDA 4LXHA 1CJSA 3IQWA 4F4CA 2WACA 2CLDX 4RL6A 1H2RS 1VQMQ 5KDDA 4RJJA 3QZ9B 3H4IA 3SQMA 2CSQA 2PJRA 4JDPA 2BVNA 1QIKA 3GJYA 3DEIA 3K16A 5IT0A 1WQ7A 4QLAA 5C31A 5IM4A 2ZPFB 5AI9A 3U7QB 1Z5GA 3DKIA 3A8KA 1H0HA 3FGPA 4BIIA 4BQQA 3MGCA 1UP4A 4LSWA 3MMSA 3G4ST 4U2KA 2X9VA 3TQRA 1USKA 2PS3A 3JSCA 3QLTA 4KWIA 4OMOA 4PLCA 1GKYA 4KYTA 5CVTA 4R71A 2M1HA 1OFHA 3A9CA 3K96A 3VU0A 2CVHA 3WDSA 4N76A 1MVOA 5JQGF 1JEAA 3M0QA 1E2FA 1U81A 3IT2A 1A8SA 4G84A 4I7EA 4RZ3A 3PZRA 4TYQA 1DO0A 1L5HA 1K9AA 4ALMA 4BFXA 1H1LA 3OYBA 4GY5A 4W4TA 2UU9B 2ZBRA 2AQKA 5H9WA 1A9QA 4M7AD 2GZAA 2EIXA 2OCXA 3O84A 3I35A 2FE4A 5DN6D 2PJUA 1AUOA 3LLUA 4Q4HA 3ZDDA 4E09A 2VDQB 2X4YA 3DDOA 2PH7A 4P4UA 2QNIA 3ISTA 1DWPA 2EJFA 1BCSA 1VQ4Q 1SUAA 1C1XA 1XF9A 4YRGA 1MB4A 2XCTB 1WU7A 2CVFA 2Q1XA 5JY1A 3WL4A 2I66A 2CKMA 2H8KA 4BQSA 4A8PA 3R6DA 2Z2KA 3EG9B 3CB2A 1IUNA 121PA 3WQSB 3UENA 5CVDA 3V1KA 4BIMA 3DMTC 4HRXA 4KR9A 4INJA 1L8OA 3LC0A 4TX1A 4P0PB 2IEAA 4W5TA 2Y9PB 3JQEA 4FD3A 4LC0A 3LYHA 3OFND 2RH2A 4NLLA 3PJDA 4RVDA 5BT8A 5KX5A 2B5WA 2WTNA 3WHLA 2PVSA 4M21A 4PRKA 4FNGA 3EAFA 3TPZA 1R6UA 1IXSB 2HPZA 3RVBA 1FFBA 3DVRX 1X1TA 1FFYA 3P32A 1CT9A 5A2GA 4C0ZA 4G0WA 3CF6R 1KARA 1HZZA 2Z0WA 4QU9A 3ZI4A 4CV0A 5KU7A 2WOOA 1L4LA 3JWPA 5L40A 1BS1A 3DCYA 5MHTA 2XECA 2DF6A 1R4AA 4Q3NA 2ZIEA 3I55Q 2E55A 3ZH2A 5BQOA 4AWXA 5LDHA 1XBTA 2WAOA 3DOOA 4MZXA 1YNZA 2ECZA 1B41A 1PJCA 3PHIA 2ERCA 2FPRA 3L84A 1TXQA 4RKRA 5D85A 3RRZA 1QYCA 3IURA 4YIHA 3DMNA 4A0SA 3LZDA 2WWIA 4DLPA 2QM0A 3K92A 1Y3IA 2VWHA 3FZGA 4OBBA 1WX6A 3H6ZA 1R18A 3CMCO 1J5PA 1TQ6A 1K98A 2AZXA 5DEIA 3HNPA 2EDAA 5AJXA 3QPVA 4KBFA 3F5MA 4AJNA 3W9YA 1US8A 4M78G 1Z5PA 3NFRA 1KI1A 3O4IA 1R6VA 1OPXA 1TCUA 5ALRA 4TVSA 1TF7A 4J76A 3WSVA 3FHCB 2C97A 5DX1A 4GL4A 1WMEA 1M1YB 3HRHA 1QGAA 4N0MA 5T3YA 2OB2A 2XMQA 4NOLA 2H8HA 1C3EA 1PSEA 2C94A 2CL0X 4PEVA 4C08A 5K0FA 5K3EA 2VIIA 3A10A 4MQ5A 2GEBA 4C8QA 4X44A 2JEZA 3P71T 4B47A 1KU6A 4XUGB 4CR6A 3RD5A 2L5QA 1M2EA 4GSLA 4R7TA 4CU5A 3L6CA 2DL8A 4BYMA 4ZKDA 2Q9UA 1R0BG 1KWGA 1XKXA 4IDBA 1ZA2B 3ICOA 3QV2A 2KRNA 3M4YA 1ISIA 2JCSA 3BRCA 1UP7A 4IIXA 3TAUA 3I56Q 4AY2A 1H1TA 2YWDA 2QEXA 1Z36A 2GJSA 3UT1A 1UXHA 2ORVA 3C5VA 3GG2A 1JDVA 1UBFA 3NTRA 4KWHA 3BMNA 3RREA 5KVCA 3D4NA 5E6TA 2XGJA 3V8LA 2VP6A 1YOVA 4UU7A 4EPTA 2HAXA 1YASA 4PO3X 3H97A 1E18A 3CCSA 4DXAA 4ZDKA 2IKSA 1F0PA 3DR5A 3MOIA 4EB6A 1XEWX 3RS8A 3U7EB 5HUHA 1KNXA 4E2ZA 1VP3A 1Y63A 2HU8A 2IIBA 3BDVA 3DVSX 1QKKA 3EY9A 3MBIA 4UUOA 5DVZA 5FKJA 2JTMA 2V7QA 1DEOA 2RGUA 1JF8A 4HAUA 2ZTMA 4MB0A 4Q4AA 5CKDA 3ACDA 3DMDA 5LZ9A 2VBFA 1AC5A 1QONA 2RONA 1ZZEA 1GJRA 2HRQA 4JMPA 4WZLA 3OBYA 4Z4FA 2PZLA 1FUYB 1JRLA 4M9ZA 1W5FA 1SHTX 4ZT7A 4LXGA 1PO7A 3WYGA 1TKCA 4RTRA 3GJXC 1V39A 1T9GR 2C84A 2B5OA 1K9MR 1N5LA 4BAGA 1IZ9A 4GLOA 3RRYA 4BO1A 1VE1A 4GSKA 3DQPA 1OYYA 4ZGQB 4IQGA 1F17A 3ACCA 4FFBB 5E9JA 5EG2A 3RAJA 2P2ZA 1CUCA 3IALA 3T7SA 3ABQB 4OLAA 1P4SA 2VLBA 3OCJA 2QPLA 4M75F 1K4MA 1Q1QA 4L2IB 1Y6ZA 1OW3B 3Q41A 3PT9A 2RHJA 3DFIA 4ZZ3A 1RMTA 4IVNA 4CLEA 3DHWC 4BVGA 2JIBA 4AO7A 4FYIA 5JDCA 1WSWA 1NV9A 1Y4ZA 1KMQA 4ITUA 3SZ3A 4C5CA 3DDWA 4ME7A 4XTZA 4U3JA 4WIAA 3K70D 1DQZA 1V26A 4ORZA 4WNAB 3WIEA 5FWDA 4F4UA 1KK0A 1CF2O 3I3SR 4OJTA 2JLZA 1V11A 4MO9A 4A0FA 3AEQB 3M5WA 2GRJA 1SULA 3TG2A 2FPGB 3NOQA 1B8VA 5EG5A 3WSWA 1K73R 1MX5A 2XE6A 3BCRA 2VBCA 3CU5A 3AUXA 2QQ5A 3OP4A 3Q4GA 4OQ4A 5A8AA 4QPDA 3I8XA 1OROA 4DIUA 1MQ9A 3SYTA 3GLIB 3OEHD 2YHIB 3E9ZA 2JNGA 4FM9A 1WW8A 2QUAA 4WTOA 3DHNA 4IG9A 1CUSA 5AICA 1BH2A 1U1CA 1W4BA 1Z6AA 1ULSA 4QHSA 1V2HE 2C04A 3O4GA 4FFLA 5E1MA 4F1WA 5IDXA 1KKUA 3KXKA 5CIQA 1ORRA 1SC6A 1HWYA 1PBTA 2ZATA 3KQQA 4KXXA 4DS3A 3WBKA 3AEZA 3CINA 1AO3A 4HVAA 2YIVX 1E0KA 1ZGJA 5EMHA 5IT9E 4H9GA 3GT0A 5HA5A 1NZDA 3PUKA 3OSVA 1U3OA 3V4FA 4HY3A 2AKKA 3EZNA 4F7WA 1BXRA 3ET4A 3ADBA 1SCNE 1VPLA 4NFLA 1GDTA 2H0RA 2EKZA 3WIDA 2BJHA 4BB7A 2JAHA 2VJLA 1JHAA 1ILEA 1JAZA 4B7AA 2G5GX 2ZPAA 5AUOB 3IV6A 4B34A 1F0NA 1I13A 4M87A 1N6LA 2CDCA 2OBXA 3C16C 4P3XA 6ABPA 1GGNA 2CS7A 1AQLA 4CRIA 3EOBI 3PFBA 2C4NA 1R88A 3M83A 3MTGA 1RAHA 1XCJA 4HEJA 3SHOA 4E1BA 5IZCC 3AHHA 3LWIA 1XZPA 4R5HA 3I01M 1N1MA 4GMXA 3L4EA 1HA3A 2QYOA 4I46A 4KB5A 3SZGA 4HLNA 3BSYA 4AP6A 5AKJA 4ZTFA 3LUAA 4FFRA 3QEBZ 2EG9A 2HC9A 4CTKA 1X7ZB 4JZ4A 1YZNA 1QP0A 4ELZC 3VAAA 2R1TB 3UHPA 3WLIA 4F4JA 2OSVA 1FRNA 4HNHA 4QJIA 4XTWA 2RD2A 4ARUA 1IJBA 2Q50A 3D3QA 1HO3A 3AO0B 3E6AA 4FYWA 4GZLA 4S0XA 3TIXB 3CFYA 4RVHA 2IX3A 4JXZA 4FZ3A 1ZD8A 4Z4YA 3CLKA 5LB2A 4E15A 2Z4SA 2I2BA 4K6MA 1WUKS 3R3VA 2C5BA 6ADHA 3THOA 4B81A 5J23A 2X0RA 3LPNA 5HIJA 3RWOA 5JEDA 3D4PA 5LQNA 3THXB 3QY0A 4ITRC 3WIOA 3IQXA 2YYZA 5KE2A 3SEZA 2Y68A 3EXEB 4LGVA 4XQFA 2PSSA 3GB9A 4S2UA 4BJ3A 1USGA 3ES9A 3L6BA 4FW2A 4O4JA 2ZRKA 4RVNA 5DPMA 3TXXA 4GRIA 4J16A 2HTFA 4AQYB 3GMDA 1QVFA 2XE4A 5D1HA 1Y4SA 2RB4A 3HU5A 2M6LA 1UXIA 2H3JA 1PZMA 5B1YA 5LQDA 5AUPB 2D0NA 1IULA 4O4JF 3U7JA 2IEGA 4M8IA 421PA 4DNXA 2I6GA 3M53A 1VBFA 3UH1A 3FM9A 2ISCA 4HB2A 1F51E 3ROPA 3TQFA 2X3UA 4R55A 2WDZA 3QLUA 1OI1A 2VSYA 1UDLA 1FP7A 4RF3A 3Q3EA 4DV1B 2Y90A 1CE8A 2EGHA 2QS9A 5AVYA 4RTWA 3E05A 3KSRA 5LQSA 3TSWA 3TNDA 3KZ1E 1GTG1 2ZYGA 5JPDA 2RHDA 4L6AA 4WXHA 2QQRA 1MF7A 4BX3A 1Y0YA 4WECA 1XWIA 3LZ6A 1HOXA 3RWMB 4A36A 3G1UA 1SCIA 2C2MA 4EI7A 2XUHA 1NR5A 3MTQA 3UTDA 3HL0A 1T2FA 2WE8A 4ED9A 1E79D 1JMKC 2F8TA 6YASA 2MJLA 4RS4A 3RF6A 3INGA 1PIWA 2PUGA 3ZHQA 1MQAA 4RPLA 3TW8B 4WZAE 4BKMA 3W5HA 1RXVA 1CUWA 1PWYE 5K3CA 4B1FA 1QIIA 5IHPA 3DOFA 1DVRA 3IHLA 3WDKA 1Y3HA 4C14A 5AESA 5HKOA 4PNOA 1P0IA 4PE5B 3JV7A 3Q7EA 2PIAA 2FFJA 1DKPA 4MMXB 4DPMA 1D9XA 1IL0A 1SXJE 1U5BB 2EF0A 1LLFA 3FB9A 1K2VN 4GNRA 4E14A 4ARSA 5FTJA 4N4HA 3VISA 3UQZA 4EKNB 5JC8A 4NE9A 2GPTA 5G3YA 2J3QA 3MRTA 4BBJA 1NU8A 3V3KA 4ODIA 4B6FA 1K6XA 1KETA 1RI5A 2ZIZA 5ERYA 1DOAA 3FBTA 3LYIA 1XNHA 1V7CA 4CTJA 4E6PA 4N3CA 2II6A 3AR2A 4DG5A 2ZBDA 5CCXA 1WB4A 4TUYF 2H06A 3S3NA 1ZXLA 3CUWA 4MGEA 2X4WA 4PSDA 2J33A 1RQXA 3M0RA 1V1MA 1Z68A 3OQ5A 2X4GA 2WIJA 5B7GA 1YB1A 4GICA 4R1UA 5CHEA 5DRYA 2FW0A 2ZRIA 3AM4A 4UTPA 1E0DA 1EE1A 3WGNA 1GCIA 4CMBA 1T0HB 2DUNA 4M98A 2ZZKA 5AVTA 3B53X 1BIBA 2NTNA 1TM2A 4RK0A 5THQA 4DA6A 1B8UA 2HYDA 4INZA 3V8KA 4P7BA 5AVXA 1Z7WA 2KMLA 1D3AA 3FPGA 4LTMA 1ZJWA 3DHEA 4JA0A 4W7IA 5JSZB 1KIAA 3PWTA 2X6YA 4NG4A 4ZOBA 5EEGA 4YAWA 1Q7TA 2CHVA 4QUHA 1M9SA 1QW1A 1D2GA 3HPQA 3GLGA 2KY9A 2M9UA 2IIVA 4JJAA 1JJFA 2HV8A 3KWJA 2XQFA 4ZNXA 1VLJA 4FMDF 3EIOA 5JAIA 5FI1B 3QU7A 3N1UA 3TTVA 4N4GA 1KGDA 2AN1A 1NJID 2GK6A 4HNTA 4V02A 2EV9A 1B0UA 2E4VA 3ZK7A 1PU2A 4MPJA 2DJQA 3OYKA 1W44A 3OOWA 2FPEA 4K9MA 2Q28A 4E7IA 4X97A 2A30A 4Z7OB 6AT1A 2C07A 3JCMb 3W1EA 5A4KA 2GSDA 2PSHA 2V98A 3DD5A 2ZEJA 1SMKA 1L9KA 2HM7A 3V8VA 3TI7A 2JK0A 4E7HA 1NJIR 3ASQA 2DFDA 2ZSAA 3NAZA 2D3LA 4MAMA 4E94A 2QTVA 1V16B 1G6HA 2VLIA 3CEPB 2HD4A 4R1TA 1KRWA 1IRIA 1E89A 3N6XA 3HVKA 1XD2A 4F91B 2R3SA 1V5GA 2ZQZA 2ZYIA 4JI0B 3A26A 1GZVA 5L7TA 2CVZA 4A4DA 2X1VA 1OB5A 3I9V6 1BE1A 1DIRA 2PZ1A 3NWBA 2O2HA 4LF8B 1FP1D 3CHYA 3TM4A 3W4JA 1HD3A 3HG7A 3BBLA 2C2WA 4YMIA 1JS1X 2P4EA 5HZMA 5FRDA 1T8TA 5JZVA 2H31A 4BX2A 1SM4A 1EA7A 4ALIA 1OI7A 5JSZA 2FZVA 3EGOA 1XZCA 5CCEA 4PFKA 1H05A 1JBEA 3MS4A 3LK6A 3PE3A 4HF7A 4C01A 1ZHOA 1BMQA 4K5QA 5CA0B 4NONA 1N2CA 2WHEA 3L6RA 1QP3A 3QUSA 2JFVA 2VATA 1ZRMA 3D6TB 4OPVA 4B6QA 6REQA 4IM7A 3NDJA 4L72A 3CNBA 2DFPA 2JLBA 2QVXX 3QWFA 3QFRA 1WULS 1I81A 4D8DA 1NVVR 3I52A 1DV2A 2YUOA 1XCOA 2OBLA 3CP8A 1H22A 3OBIA 4WSOA 1K3FA 3B2EA 3S99A 4QFMA 4ENRA 2HU5A 1SC9A 4AIIA 3E4DA 2JGNA 2NVUA 5EIFA 3VDXA 1X70A 3RLFA 3QXEB 1LPAB 1TYBE 1YUNA 1WXTA 2H7CA 4UBOA 1KE1A 5I48A 2H5JA 3N9IA 3KKPA 2K5IA 2QTCA 3DA8A 2WJAA 1LPSA 1C7FA 2WKRA 5DIZA 5KHLB 5KYUB 1YBYA 1RMQA 3C0CA 1DJ7B 2VDWA 4OAPA 4X1KA 1JQQA 2V8IA 5CAEB 1T0JB 5LD2C 2HQXA 2PTKA 2W43A 2VEDA 3OLZA 5A5DA 1HE5A 2GK3A 1ENOA 1CQJB 1T0IA 1VYHA 2I2XB 3WL7A 1RW4A 3G71A 2DNUA 3CKLA 4CTMA 5CA1B 1MKYA 4TWRA 2VZ0A 2YIJA 1MV0B 1PQYA 1QR2A 4ZT2A 5LU9A 2X4IA 3DG9A 2CHQA 2JBWA 4ARZA 4GYWA 2BE7D 4EUHA 2DC1A 2QXUA 4Y0AA 4EEZA 1QIDA 2MSKA 2OM2A 2W2LD 4HKTA 5T4HA 3FOEC 4DQKA 1ZD5A 1JIVA 1GL9B 2EBUA 4J0FA 4B75A 4MVCA 1T35A 4PPQA 4G5OA 4MUGA 5DWQA 5KAMA 3GY0A 3TRIA 2NYSA 4LDYA 1GTSA 2E64A 3L4BC 1P9OA 4D9MA 1DRWA 4L3VA 2HIHA 3F8WA 4NEQA 4P5DA 3DEFA 3OYGA 2JN0A 2NACA 4WGFA 2RHOA 2ZPHB 2XVZA 1M1YE 1RC0A 1XCGB 4NV3A 1NJ2A 2J6BA 2BFFA 2MHCA 3IPYA 4ONEA 5AW3A 3EIQA 1B00A 1XWWA 1ZGZA 1KQSB 3FSRA 3PCXA 4HH4A 3CMEQ 1KA9H 4C6TA 4OVAA 1XPJA 2ACKA 2HCRA 4O25A 1CR6A 1UBLS 4P08A 4WKCA 4M77A 3ASRA 1NY5A 2BIFA 2G25A 1F8YA 2G06A 3O21A 3PJEA 5KKAA 1RT9A 5CYGA 3TU4K 3TMYA 4B2IA 3RYIA 4PJNA 3OQMA 1EUDA 1HZEA 2QW1A 5J3OA 1HDIA 4HHEA 4TN5A 3RFTA 4P32A 3T3MB 3N2KB 3B20A 4Q7QA 3ZD8A 3V4ZA 3IKTA 2PNIA 3DSRA 3OESA 4EIKA 4KHZA 1F4VA 3EHEA 3L01A 1OAOC 2AT1B 2YZ2A 2C0PA 2W2KA 3LF2A 4L3OA 1U0OC 3MJTA 3OZFA 2D3WA 1WLPB 1DIGA 2H2GA 4KUIA 3PXEA 2CXOA 3GF5A 5I01A 1ZLYA 4YCAA 2ZRBA 1X77A 7AT1B 1OKKD 3L7AA 3O2NA 2DFUA 3WMRA 4LX8A 3NWOA 2TMYA 2X14A 1ZR4A 3PV0A 2I6TA 4V2SA 4QKUA 1DPFA 5LJ5e 1Y9EA 2FYTA 1OBVA 3E03A 3H3FA 4LXTA 2W4IA 3PYLA 5ALMA 4C1BA 4Q3LA 4BY6C 2FCAA 1B3RA 1AKWA 4BQIA 3WBFA 1AZGB 3QX7A 4KWEA 4KQ2A 1IHPA 2JJ2D 4U7JA 1W1IA 5C1PA 5HK9A 3MO8A 2Y1EA 3DFFA 4UJ3A 2SHKA 4QTZA 4C0DB 3FWNA 5CT4A 1AGPA 3UK1A 3RARA 5JFGA 1AA6A 2Q5QA 3P2KA 3ZJVA 3FRIA 4RTVA 1Q0HA 3M5DA 5B6IA 1ILWA 3R5XA 2J4FA 4FGWA 3ROZA 4ND4A 4ZVUA 3F73A 3UO8B 4B0PA 1G2BA 1XMOB 2Q3HA 2IZOA 1E62A 1JPJA 4XLLA 1R4NA 1WDKA 4KKUA 3MERA 5EZQA 1XNGA 1W2BS 3QE3A 4LYGA 3ZFJA 2QDYB 4KO4S 2RAFA 4TLDA 1UWKA 2AN5A 4OFZA 1JU4A 4YQFA 5KVAA 1KJ8A 5DBOA 3V33A 3ILXA 2AMLA 4DUGA 2JFFA 2NYAA 1OIXA 1XRNA 5HSGA 2KDSA 2DPMA 1U5SA 3BH7A 2XI9A 3AI1A 3MCZA 5C1OA 1JILA 2IUYA 4G81A 1AKUA 3WGLA 4IF6A 3NGLA 3H8VA 1Q9SA 4J0JA 1QWFA 2Z57A 1UBEA 1HFWA 3MWLA 4I9FA 1M1FA 2GEJA 4OL0A 4YRCA 3FYUA 2SEMA 1YXMA 3M6VA 2ORED 4O5OA 3KM0A 1ZUUA 4RTXA 1DKNA 2QXTA 3OECA 4CM4B 1CR4A 4DQ2A 4ICIA 3IIKA 3IMEA 4UD6A 2F3RA 3OE1A 2W6MA 3OSZA 4UNQA 5FIUA 1LV7A 4RLHA 1YMUA 3VNUA 1WOYA 2CJYA 3VZQA 1BEEA 2CP3A 1OU0A 3RANA 3RGWS 3U5ZB 3I61A 1SOWA 2IC5A 3CPWB 1M30A 1ARZA 1U7WA 2AMVA 2D8JA 2DRKA 4HH0A 3FY4A 1JKJA 4WNAA 1PV4A 5JAHA 1ODCA 4ZOCA 5DTRA 3EQ2A 1EWVA 3IBFA 4BFYA 2OKCA 2J4CA 4UASA 1ABEA 4WN9A 5ALFA 5B5SA 1D09A 1E32A 1XLUA 3LCVB 4B6GA 3R40A 1QXSA 3WA6A 3A2MA 2LJ0A 4JODA 2IRWA 4R16A 4YONB 2J05A 4B73A 2V6BA 3ESZA 3HFJA 3UA4A 5FUWA 4AG3A 5LU8A 2RH5A 1JDNA 3GAZA 3DE3X 1HQDA 2CNWA 2R79A 3CNEA 1EGVB 4XA8A 3WHIA 4EPXA 5JRZA 3I1IA 5EQFA 1ATIA 3T0FA 4DDMA 2NU6A 4HDRB 2QT1A 4FYKA 1ZA2A 4GNKA 1U80A 7ADHA 1SA0A 4F5YA 4IUTA 2OORA 2QN2A 2GFUA 3DXYA 3O47A 3VHQA 3AZOA 3WGTA 1NE2A 4FUTA 2DR0A 4MR9A 3R7SA 1S9DA 1I0LA 2Q5FA 5D7NA 5D5HA 5FWXA 1U2GC 4S04A 5FLXA 3GLKA 1KMHA 3O92A 3WYEA 1ZJYA 2DKOA 2B98A 3TD9A 3FN4A 4H59A 1YITB 1HC7A 4V0MA 4AJLA 1H92A 2ZOSA 1SEMA 5LJ3j 3JB9J 1U9IC 4LDRA 1R2QA 2GOYA 5DP1A 4D5EA 4YCCA 3L1KA 5AOVA 1UM9B 4KL8S 3AM5A 5EY5B 1M83A 2Q4DA 2D00A 1TFUA 1ULUA 1ODTC 1ZINA 3RS4A 3PGXA 4MZMA 2OZLA 3IAAA 1HE8B 5LJ5f 1L7AA 2YH2A 3BK1A 1OKKA 3PXAA 5JWRA 4X20B 2QTHA 3OMCA 3SGLA 2G3YA 3VRHA 3Q85A 1KZ6A 4UW9A 3SC6A 4JJDA 1E6CA 4FTWA 3RK4A 4YDQA 2OAEA 1BS9A 3RBXA 6LDHA 4F2HA 1G4AE 2QA5A 2PGNA 4WASA 4B3CA 2JLAA 3COSA 4R5MA 4B79A 4R1OA 1U8ZA 3KXLA 4NX2A 2C54A 2GT1A 3IPRA 3T7DA 2R751 3DFMA 1YP5A 3I2KA 4IJWA 3OX3A 4WFJA 2VKQA 1NHGA 4U3JB 4AQ7A 1M2VA 3C97A 3DMYA 3GZNA 3CPSA 3KB8A 3PF8A 4QBTA 4UAGA 4XTCS 1P7WA 1Q22A 5EPEA 2EIHA 4LHYA 5E7IA 3VR2D 2WRZA 4BU1A 5K45A 1RS0A 3ZV4A 3FWZA 3LI2A 1SC1A 2I7VA 2W6CX 3CZ9A 1PGQA 4KXLA 1AD2A 3D43A 4GO1A 4QVKA 4RM2A 1AZSC 2JJ1D 3ISVA 1ZX1A 5F3RA 1SRQA 1Z73A 2P9ZA 3HZZA 3IVMA 4LX0A 3SBDA 3HK2A 5EUMA 4Y92A 1F9AA 2YNMC 1QLHA 1B3BA 1KH2A 5BY2A 4ZICA 5AM3A 4LHVA 3EUEA 2NMVA 4RXUA 5DSXA 1X9HA 1JVBA 2CDRA 3BL6A 3O7WA 3CD6T 5EGNA 4F45A 1BHQ1 1XZFA 3CG0A 2AUMA 1SXJB 1KMMA 2BM9A 1QX4A 2YMPA 3ONWA 4PHHA 5CVVA 5DBEX 4DYHA 4EHJA 2BE9A 3RG8A 1YJNT 2W7TA 2FRYA 2LRHA 2PGDA 3MWJA 4IXWA 3EVEA 3JARB 2QY9A 5BYJA 1TK9A 2XG8D 3PUXA 2AZSA 4KMOA 5K2OA 1MD9A 2ZYSA 4N5HX 3UJPA 4QE3A 1UZNA 1WTHD 3L7MA 4Z9FA 3HDQA 7MDHA 3PVLA 1HH4A 1I32A 2DL3A 2G1AA 1M6HA 1G8YA 1ITZA 3QXJA 4RCCA 1FEZA 4ERNA 5IP5A 5H1YA 1SR8A 1S2IA 1AKMA 3FDRA 3ZDAA 1VJCA 4DR4B 3SE0A 2A9QA 2FPIB 2I2CA 3PL1A 4IV8A 4NV0A 3F3YA 1MO4A 5KJ1A 5KYKA 1XDUA 3GOXA 1Y8QA 2VHUA 5D5QA 3A35A 1AT1A 1M75A 2RI1A 1Y0BA 1H2FA 4GGMX 4Q05A 3VI3B 4HQKA 2RBEA 2E85A 5KSOA 3PQ2A 3A8JA 2I67A 1BCOA 2VGMA 1REQB 4MWSA 4Q9KA 4OGFA 2NO5A 1K89A 2PHZA 4OHVA 1N2GA 2OV8A 4YJ3A 5DEOA 1HG1A 2JBAB 3RK1A 1XT6A 4IDPA 4G41A 2X85A 1WKCA 1ZSGA 1BA3A 1BHJA 1SBHA 1VIVA 2C3UA 2P0AA 2VQSA 2PGOA 3BQMB 3ZCUA 5AUNB 7YASA 1SAYA 2ID9A 4ZREA 3W9BA 4AYTA 2L8DA 4YRNA 2WM9B 4BNDB 5SY4A 3O31A 1Z6XA 3T4EA 3GJTA 1THMA 3GLGB 1QIEA 1IBCA 1WHGA 4MUNA 3H3XA 2AD1A 3OY9A 1ZCBA 4PZPA 3QY9A 3TTYA 3UG6A 4C0HA 3QBEA 2ONJA 1KAQA 4DSOA 4DRXB 1KZYC 1VRCA 3GCDA 4G1CA 3OX1A 5I9LA 4QATA 3SDBA 2WA2A 5A62A 2M0OA 1X87A 2GX6A 1NVGA 1TM1E 3UVEA 1A27A 2VDUE 3JWEA 1Z22A 2CBGA 2M5SA 4HNVA 4BBAA 3WJ2A 2PGJA 5ULLA 4S1VA 3COJA 1B6SA 2NVWA 4XB6B 3I5SA 2WJVA 1ML4A 1YZQA 1Z5UA 2A7QA 3C41J 1R8OB 1N75A 3IIMA 4ZI7F 1KPIA 2OBSA 1PWHA 4BS9A 4C06A 5KSYA 1FTNA 5CIUA 1QQ6A 2HRRA 2VXEA 1BWPA 5C0OE 5A4DA 5JI2E 5IH7A 4UCFA 3T3OA 5KX5B 3URGA 1WA7A 4QBKA 5LQCA 3Q87B 5CNMA 4JEIA 2P5SA 2HMVA 1NPPA 4Z4RA 1M54A 4XD7A 1IXRC 1GZ6A 1XTKA 2ZXIA 2PZGA 3DEJA 1ZMBA 3OCZA 3KQTA 1OXVA 5JH7F 3PI7A 4YIKA 5ER6A 5F76A 4XU3A 1MJGA 3K32A 8MHTA 2DFTA 4RE5A 3DDCA 4GBED 5CW2A 3JARA 3UK2A 1YL7A 3CCEB 3TL3A 2REBA 4EAQA 3VMFA 5EHNA 4EJ2A 3FCAA 5AQ1A 3G82C 3HABA 2WZPP 2LQNA 2IGTA 3BL5A 4HNAA 3R9KA 3TSCA 5A06A 5DTEA 4DQVA 4A53A 1W5EA 1SUPA 1PL8A 4C4ZA 1BX1A 2P9GA 3IDZA 1PQWA 1W76A 5DFAA 5ITZA 3REQA 4ER5A 1V9CA 2FFQA 4X1IA 3N5BB 2PVDB 2CE2X 2PMWB 3SIWA 5HBGA 3TZHA 4B35A 3MTIA 5G1NA 1E7MA 3GCWA 1OXXK 4B09A 2RQWA 3F5QA 2BM1A 1JLLA 1TNDA 1L1FA 1GAQA 2DBZA 1I2ZA 2R6DA 5ALOA 1RIIA 1X75C 2F2WA 2CLFB 2JHPA 2ZI6A 2IU4A 1GQSA 4OK6A 4YP7A 5CT9A 4D4MA 1KF0A 2BP7B 1XA3A 1VKJA 1A8HA 3UYKA 3BIOA 3ZZUA 1EQUA 2B1IA 2OC9A 5DCLA 1IUPA 2B4YA 4N4IA 4RF4A 4WK4B 3VC3A 4A9AA 2PUWA 4FU6A 2AZ4A 2TMGA 2RK4A 2K79A 1ZJ6A 4X61A 5K3SA 3W6ZA 2B3TA 5BVHB 4QUGA 2DYIA 4Q3CA 4HBGA 3TNLA 2FOXA 3BSFA 1LXCA 1JNXX 1UBNA 3L1JA 4NZYA 3VNRA 3C15C 3WC4A 2JLWA 1JIXA 1WPRA 2QROA 2DXCA 3F3SA 4X6YA 3LX6A 4P2NA 4P36A 5A04A 1GLNA 1D04A 1Z7YA 2LPMA 2J5XA 1NRKA 2VVTA 2WTBA 2Y1DA 4YMLA 3PWZA 1JR3A 4AKHA 2P40A 4JWKA 3PVCA 2ZZNA 1BXKA 4ZO8A 3NVMB 1EJBA 1J4AA 1XL0A 2DY0A 3CX6A 3KUKA 1WNLA 1R0CB 1BD3A 3MINB 3VNQA 1IBKB 4ZMRA 1FA9A 4JRQA 1XMSA 3FDZA 4L5YA 3SN6A 1OVMA 3LJKA 4FYWB 1M2KA 4FJ2A 4X9XA 3VZBA 4MPDA 1N8RU 1Q74A 2VG8A 3ACBA 1YUBA 3EZ9A 4MV5A 5K3FA 1HPLA 3TI9A 4HSGA 2K6DA 3M49A 5BPFA 3SZOA 4FM4B 4MV6A 2YMQA 1L4FA 3JCMW 1UK9A 2QG6A 2JFOA 5JASA 5JNSA 3ICQB 1W0JD 5FWXB 3QFSA 1PJ6A 2GERA 3LBYA 3KBBA 1KSFX 1HXDA 3FLEA 4MB6A 4QU0A 4YRZA 1T0HA 2CYBA 2V7UA 4FC6A 4BB0A 2BZGA 4QHTA 2KRMA 1JMYA 5SZKB 3HB9A 4EFDA 5DM1A 2BFNA 2R8XA 5L7WA 2OAQ1 1D1TA 1DBQA 2OAGA 4KLAA 3B8HA 1EDZA 1SU8A 4WINA 5IHXA 5IK2A 1M72A 1EQ2A 1DKLA 4CQLB 5K3OA 1NQAO 1AHIA 2R1VA 1SOAA 4Q03A 4LKRA 2AG8A 2E4YA 3M89A 3KEQA 3HJFA 1IPFA 4ER0A 1G16A 2UKDA 1J20A 3LFTA 3HGQA 4KLCA 5IT4A 1OLSB 3LP5A 2QSUA 2QMQA 3MT9A 4XW2A 5TARA 4N0DA 1TQHA 1N06A 1FQOA 3AVOA 4G0MA 3ASSA 1RE0A 2HXSA 4JWTA 4QNMA 4XVHA 5BUQA 5JWOA 2OO7A 2VAPA 4OQXA 3GFTA 3CJTA 4PBTA 1GSHA 3L8HA 5CLHA 3NX4A 1G4UR 3TZEA 4MUYA 2XTNA 3USCS 4OX9Y 3EISA 2J59A 2QGFA 3FH0A 3OX4A 3FNIA 4NCBA 2RGXA 5AJVB 2A5JA 2MYPA 3RADC 1XZNA 2BIVA 4HWRA 3ZXUB 5CB4F 1AD5A 1FMFA 5KYNA 1NJGA 3FWKA 5FAKA 2IHBA 3PFSA 3EAQA 4W5HA 3GOHA 4KUHA 3O1LA 2P9FA 2XVYA 4O4JB 5AJZA 1SBZA 5H9VA 3SKVA 3AVPA 2CY0A 4FKBA 4H15A 1TMGE 2VUSA 1LNQA 3GWGA 3DTVA 2IH5A 5EMMA 3Q6MA 2FEOA 1QFYA 1IHVA 4DVJA 3WGIA 2VB6A 1TO2E 3C95A 2ZXEA 4MICA 4XGQA 3OJXA 4X9CA 4P1VA 1JQBA 1TVMA 3FPLA 4PZZA 2Q7OE 3SYLA 4ENUA 1B0ZA 1T0BA 1O96B 1N5ZA 3N58A 3Q6IA 3ZNOA 1CIVA 2JS2A 5JNLA 1W19A 2X5OA 3UA7A 3X43A 2JD2A 3AILA 3M4JA 4JJFA 3LXRA 2A7YA 2BMWA 4H31A 1T5SA 1WB5A 2CNKA 3OVMA 4WBSA 2H1RA 5GAJA 5FHRA 1O87A 3PQ8A 4RJTA 5LXTA 1Z29A 2PH3A 1XU7A 3RSHA 3PPIA 1VA7A 3ETCA 2IHUA 2M9MA 4G89A 4P4LA 4P4SB 2BRUA 3IJPA 3FMOB 3OPYB 3ZDXB 3SX0A 1ZU4A 5DXJA 3Q5GA 2DUMA 1O95C 3GLFB 1C81A 2C4WA 4JIGA 1GG2A 1ONNA 1W29A 2XRMA 1U90A 2XDYA 1XA4A 4XKWA 5JNWA 2CLIB 2F1OA 2ZYTX 1CRZA 3HFRA 1U4SA 1Y8AA 2VAWA 3PHCA 4RF5A 1A9XA 1OZFA 3CRQA 2J9ZB 3U81A 2GZMA 2OAP1 2Q5JA 4XTUA 1I1JA 1PHPA 1ZMOA 2FR0A 2GCEA 3DWIA 3N8HA 3IESA 1CS0A 1N3LA 2XDPA 3KXTA 4J4HA 3SM3A 4YPFA 4WW0A 1ZBXA 3CY6A 3NIDB 2NUBA 1ODSA 3CCQT 1O5IA 1YFNA 1CRQA 1P9LA 1NVUQ 5A71A 3WLLA 1CF4A 3EZXA 4AAYA 5B36A 3Q0EA 4XIGS 4XEUA 2IVFA 4DC0A 5LYJA 1PR5A 2VJBA 1XNJA 5BQ3A 4FI3C 4HMQA 3UHOA 5JNRA 3GFRA 1SUIA 5AVUA 1C1YA 2HDHA 4UEWA 3EF3A 4G2TA 4CFZA 2QUZA 2RHUA 2SCUB 2YS7A 2WF5A 3ASVA 1WMFA 1IIBA 5WRFA 5EL0A 3ZBDA 2ZB7A 4YRTA 3FLAA 4QUKA 5IEBA 4IGKA 3HR7A 4C0DC 1BN6A 1TA9A 2KQWA 4LECA 5COQA 2O48X 2P0KA 4IFIA 1J33A 1E5VA 2Y4NA 1U0HC 1JJVA 4ZIRB 4UAJA 5J1TB 1XZKA 1JN0A 3CURA 2Y4OA 4TZKA 5IHNA 4KDFA 3RV3A 1FS4A 4ZHQA 1HNXB 5CO7A 1Y34E 2KXCA 5SZIA 2YWRA 3WFZA 2VF2A 3KQVA 5BW5A 1LTQA 1E4OA 1OZ0A 4ZXFA 2Q0XA 3WO0A 3BXGA 3K9LA 4M9QA 1I8DA 4LF4B 1EIWA 5AXCA 5E6UA 1N6IA 3BQJA 1IG0A 1VKHA 2DWUA 5IBQA 4E6EA 4UMVA 3IVXA 1E9RA 2NU7A 1GCGA 3KIPA 4KI7A 2CZGA 5E0KB 1R8XA 3OZ7A 3WDLA 2UXDB 4XN3A 2EBWA 3ETEA 3HXTA 1CJUC 3NAQA 4HR7A 4KLRA 3GLIA 5IDWA 1BYMA 2ZR9A 1QP7A 2IA5A 3G6EQ 4HAYA 3ZZTA 5ESWA 2W6JD 4UTXA 3QHPA 2IHNA 3BWMA 3D0KA 3FDJA 2V1XA 4J9UE 4XOTA 1RRFA 2ZI7A 4PZUA 2WZBA 4OBWA 4C0JA 1THGA 2QRHA 5EIBD 4JEHA 2P1RA 1SF9A 2WKQA 2CWWA 1HE4A 3O1HB 3P9PA 1KC8U 1H42A 4GC9A 2P2YA 1OA1A 2N42A 3EPRA 4KC0A 4P92A 3GLSA 4WZBB 4DMHA 4B3RB 3WA7A 3DBLA 1LK5A 1JLHA 2R6JA 4X62B 1HDXA 1YT5A 1NF3A 5B7NA 2ZKIA 2XRYA 1ZNYA 3EY4A 1V3VA 1U3TA 1WY7A 5CM9C 5JYDA 2CD9A 4LDNA 1UJ6A 3KSZO 4CLHA 1YZYA 1PLJA 3GGGA 3KKNA 3DBIA 4QTXA 2XCQA 2REQA 2ZUTA 3CCVA 3GDWA 2HR1A 1G59A 3VZCA 3WLNA 3HP9A 1Z0FA 4IXNA 4A4KA 4YDHB 2LX9A 3I6QA 4OQDA 3CPWA 3NKVA 1PZGA 2E82A 5E3HA 5C9ZA 4AY6A 4BQFA 1QVGS 1SB9A 1IAQA 4YTLA 1NX9A 3HA5A 3IMGA 4DCTA 1VL1A 1IB8A 1UJMA 3KLBA 1NXQA 3GVXA 1KG1A 2JZCA 1NE8A 1NIJA 2O8BA 2OWEA 3FYDA 4BQPA 2YXLA 3A3OA 3LBHA 4IUYA 4MVJP 3VTAA 1ZESA 3ZLJA 3F70A 4I50F 4X3PA 5LC1A 4WWHA 1VKNA 2AJ8A 1LNZA 1EB9A 1NJ6A 1A98A 1HL3A 3GVIA 3HUDA 4FB5A 3ZHTA 1W5AA 2BSAA 3PENA 1WHTA 5FO0A 1GM5A 2QQ0A 3EDYA 3K2IA 4J0DA 4OB7A 3C4JA 3AVXA 2OLKA 4J7UA 5BV2P 2H2HA 1ORIA 1TUBA 2G7MC 3CVYA 2QTRA 1W2BA 5EKUA 4D4IA 3WVDB 4NBSA 2EWMA 2YVLA 4R7ZA 1I7SB 2KI7A 3EHQA 2PKCA 4WVLA 3UEOA 3BS4A 3ZV5A 3TEEA 1QANA 2K9GA 4QBIA 2KROA 1PGOA 2JCGA 2YQ4A 5DM7R 5IJ0B 5DO9A 5E7JA 3BXEA 1GG8A 5LZ7A 1Z16A 4B3SB 1UP6A 1YE3A 3UJ3X 3JQFA 1GPUA 3D4BA 4MVJE 3RIHA 3V1NA 5K6AC 5J1SB 1OGJA 3GGCA 2H9IA 4DLSA 1A8UA 2GTPA 1NXTA 2QJWA 3PFNA 1G2QA 3UC5A 3UBMA 2IU6A 4ERXA 1QHXA 1NM5A 3QPDA 5BN3A 1M1KU 1YE5A 1EX1A 3AF2A 2MDTA 5DT2A 3ZD9A 1HFJA 1V3TA 4M7PA 4YPOA 4TMWA 4RFSB 4ALJA 1VQOA 4Q15A 2Z09A 3D8SA 2YX1A 1W1FA 1XTIA 1OX9A 5DGCA 5KYXA 1J2EA 4AJEA 4FE7A 1J99A 2BC9A 1U1IA 4BMVA 1MABB 4J2OA 4MGYR 4Y7CA 2R00C 3A8OB 2IE8A 3LHIA 2DPGA 4ZV7A 1QE5A 3MC1A 2NAFA 2X5XA 3OYHA 4ETMA 4A2WA 3INYA 3WE7A 2PGLA 3LLSA 4D26A 3RCBA 3SB2A 1KQSS 1HGXA 3B9PA 4U02A 4RTLA 4EB3A 3V1UA 3PEYA 2NN3C 1VQ5A 3QELB 4Q66C 2KJQA 2AI2A 1WTCA 5ICFA 3L93A 3QLEA 3W7AA 1ARKA 4ZVTA 3QQPA 2AT1A 3CTMA 4JUCA 1LPMA 2ROQA 4TV9A 3N74A 1EP1B 2ZWPA 4TLLB 1DO8A 3IQGX 5HF8A 1BLIA 3SHVA 1U7UA 4S35A 2AEEA 3DNPA 3NKLA 4F2WA 3AM3A 5EQTA 1GGVA 2VTKA 1IB6A 3D2BA 3IUJA 4M0KA 1JDBB 4IIUA 5KO2A 3Q3GE 3BFVA 3Q5EA 5FNZA 1MJGM 2I7DA 1TUEA 3MAAC 4TYPA 1Q17A 1SZDA 4KGDA 3BHNA 1QYRA 3PNWC 4G0QA 3T9CA 3O4FA 4F2PA 1H2HA 3UAGA 1V95A 2WTEA 4KQGA 4KHPB 2PXCA 1LDYA 1IOVA 4FHEA 4PCAA 3UGQA 3PMTA 4E7LA 4AF8A 3JCMQ 1K6JA 3HO6A 2O19A 1WBJB 4UE3S 1EINA 3RBZA 1A4UA 2JW5A 1HT3A 1V3QE 2AGVA 4G86A 3ZXIA 5KX5F 1J23A 3H5NA 4BC0A 3PFCA 3SK0A 3ZX5A 2MIIA 3GPBA 1QU2A 1Q1NA 4KE7A 3AGQA 1M2OA 4TQ9A 2X7XA 4ZOLB 4X7MA 4PRZA 3TZ6A 4F4IA 3KAJA 2PX6A 2HY7A 1QQJA 3NHWA 1N8RD 4OB8A 2RH4A 4XYMA 2V7QD 4HAZA 4OOSA 3UN1A 3PQ6A 4FZJA 2NPFA 2QTLA 3JB9F 4TLMB 1FU8A 1XZAA 5G4KB 4EARA 1LI4A 1ISSA 1JMVA 1ST3A 2IE0A 2Q7XA 2XI4A 2XYVA 1NGSA 3CW8X 2CVPA 3PDCA 1U1FA 2INGX 3RM3A 3WGGA 4YXFA 1RWBA 1BOOA 2QOEA 3SOPA 1M34E 1YI1A 5FWYB 4MNTA 1DAIA 1GV1A 4JU8A 4GM0A 4V39A 5E2BA 2PLAA 1DCFA 1H94A 5H8WA 2EZ4A 3U7FB 3MAJA 1O6BA 4RZ2A 1RWNA 3I9V1 4Y2GA 2XMPA 3WLSA 1XDZA 2DO3A 4R8SA 3TFWA 3JASA 4V0KA 3UJ7A 2X15A 2MOKA 4MWOA 4BDTA 3EFBA 2QJOA 2JJYA 2PMEA 3VOAA 4C92F 2V7PA 1REQA 4CW7A 4EJ0A 1SHUX 2CHFA 3R3HA 2HHCA 5E1BA 3NDBB 4DJEC 1JDTA 4YY3B 2JGMA 4TLAA 3KQLA 5K0TA 4OFWA 3K0CC 1BFUA 4ADSG 4AULA 3CLRC 1EHYA 1N8NA 4J7IA 2WSYB 2OBBA 1E1QA 4CFYA 5J4YA 3RKXA 3MTBA 3SKYA 1OB0A 1F12A 4INPA 5D2CA 1YQUA 3O90A 1XK6A 1XUOA 2RHYA 2NO1A 2P2SA 2R8YA 2HDNB 4I5GA 1BOFA 5CK4A 5GAOl 3MJEA 3A5ZB 2PUTA 2JFHA 4IUQA 3DPUA 3HKBB 4GZ6A 2CB9A 3K15A 2SRCA 3QSGA 1S2NA 1BK2A 3DAGA 3W6NA 5GAN3 4Q1AA 1N6HA 1EUQA 2WM8A 4GOOD 4JUAA 2C9BA 3WGVA 2Q1SA 1P4GA 1RABB 1S3FA 1T3ZA 2WAYA 4NMXB 3ZV7A 1NM7A 3CCJQ 4N0PA 5KVQA 1ESCA 1CY6A 1LZLA 2B0CA 4J6WA 1IO6A 4UE6A 1UADA 1PQUA 4A54A 3BWEA 2UXCB 4BO4A 1EK0A 3BXFA 3G8AA 3MJXA 1E3ZA 2WB4A 1X7XA 3H65A 1TF5A 2VHVA 1WHKA 3L0CA 3OCCA 1NN1A 1DG9A 3EGWA 1HFKA 3GH1A 1NVXQ 5E0OA 3P0IA 4X64B 1JLMA 2BD0A 2NADA 1I1OA 3OP1A 4P81A 4JZ3A 4EHNA 4Z4GA 3QIAA 1DWOA 3ZIAD 3RTCA 4XR6A 2CUZA 3ENKA 1SUFA 5DWVA 1KAHA 1ZH4A 4CEHB