2DETA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the pre-reaction state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
365
structure length
365
Chain Sequence
TAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 85
structure length 365
sequence length 365
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2detA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2detA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2detA01
4PC7A 1VQKB 3AVWA 1EFPA 1OWOA 2JANA 1QQTA 4MW5A 3ZJUA 1IJEA 4I6GA 3RK0A 4YAOA 2RE8A 1GZUA 5J58A 3IVXA 1XNJA 2BPOA 1QFZA 3FOCA 2CV2A 1GTRA 4YAWA 3HL4A 3QE2A 1ZM9A 1W87A 2XNCA 4N3NA 2YWBA 1YJ9B 3MCAA 2DUMA 3F3MA 3CC7B 4MWBA 5TEWA 1QTQA 4K0RA 1E62A 1DDIA 2YWFA 1Q82D 1VQ8B 1U2RA 3IVGA 2A4MA 4MVYA 3OZUA 4BPRA 2B5OA 3FJOA 1J21A 3COYA 3CRZA 5KSWB 3IUBA 1M83A 3BL5A 1WKBA 4MVWA 3CVYA 4R71A 2DXIA 4MW6A 1N3LA 3FETA 1JIIA 1FNBA 3CLTD 4ARIA 4OUDB 2AG6A 3I05A 4MVCA 1FRNA 2R6HA 3LVBA 1N8RD 3SYTA 4LC0A 4U8HA 3AVYA 1ULHA 4EG4A 5AN9A 1EE1A 3Q12A 3G59A 4A91A 3LE8A 1N75A 4DDMA 3TZEA 1EFPB 2O5RA 1VQPB 1DG1G 2PLFA 4B47A 3RHSA 4BWVA 4M1KA 3PENA 1VQ4B 1N0VC 3KT0A 4XFJA 4AQ7A 1IVSA 4MW1A 4KR7A 1EP2B 4DQLA 3OJXA 1YUMA 1TYAE 1JIKA 1S0UA 3W5UA 5HUJA 2YY5A 3SJZA 2YXNA 4HJXA 4HPWA 3QFRA 4Y9RA 1T6XA 1O95D 5DB4A 1GAXA 1JB9A 4TMXA 1QG0A 4C43A 1QJCA 1O0BA 1XNGA 3CC2B 3CVVA 1WXHA 4CDNA 1EP3B 2X0KA 1EXMA 1G7TA 3CA8A 4PBRA 1EFVB 1NDHA 1NZJA 1D8TA 1QUFA 1YI8A 3A4IA 2VXOA 3JQRA 1Q19A 3QFSA 2QA4B 5H16A 3KFLA 5TEVA 1J9ZA 3AIIA 3CLTC 2BN4A 2V0GA 2D54A 4CT0A 4LBVA 1N2IA 3IMGA 1VQNB 2OK8A 2DY1A 3W2EA 1Q11A 4G6ZA 1EWYA 2E89A 3J81k 3IMCA 4TMWA 1SM4A 1T9GR 4EF6A 3JQPA 4PC2A 4I6EA 2J7KA 4XFDA 4ACBA 3W5HA 4KPUB 2VTBA 4EGAA 2BM1A 3E1YE 5THXA 1U0BB 4J76A 3OTWA 1RQGA 1R6TA 3CVUA 4ZGNB 3CCQB 1GVHA 2R5WA 4AC9A 1F20A 3CCUB 3H99A 1FRQA 3QTTA 3IODA 1O95C 4AS1A 3WBKA 3MLBA 4RD2A 4G1VA 1KH2A 2VZLA 4ZGQB 1PFWA 1FYDA 3DV2A 1R5BA 3CPWB 1BJKA 3AVXA 1MB9A 3N8HA 2PIAA 1OB2A 2D5BA 3U1VA 3HV0A 2HMAA 1JJ2B 2DPLA 2QN6A 3ILVA 4ZT6A 1WQ3A 4DDKA 4UAJA 2X3UA 3CLRC 3H05A 3TQOA 1YITB 2CUZA 3MLAA 2QMUA 3NV7A 4RJLA 1O94D 2GM3A 1KH3A 2QTNA 4EG5A 4NDAA 4JYZA 1IJFA 1VQMB 1YIDA 5DEOA 3G5AA 5TY0A 1D2EA 1VQLB 1M8KA 1WOYA 2CFOA 3IOBA 3MXTA 1EJ2A 1OGIA 2O8VA 1O96B 1VQOB 3AG6A 2H2AA 2WQ6A 1O96A 4MULA 2PIDA 4ZCTA 2Z08A 1PFUA 3VU8A 4XSVA 1TYCA 1H85A 4MW0A 2VTBB 3DO8A 3G6EB 2E21A 1N2JA 1QGZA 3TQIA 4PGOA 3CCRB 1G59A 2GPJA 1MAUA 4RUKA 2OK7A 3I1FA 1KR2A 1KQSB 1MBZA 3AVUA 1G8GA 2AKEA 3CVWA 1WXGA 2PZAA 1NUPA 3OJWA 3A2KA 2J5BA 2ZP1A 4ND7A 1JZQA 1KJZA 4B43A 1KK0A 3SEQA 3VRHA 2V0CA 4YP5A 3SP1A 3ZGZA 4HJRA 1GAWA 3ZZ0A 5KCMA 4L2IA 1NJID 3WY9A 5K0TA 5TV2A 2XRZA 2BSAA 1F9AA 3RFFA 2D13A 1KK3A 1NI5A 4NAUA 2OV4A 3IOCA 1ILEA 4ZCRA 2QTLA 1R6UA 1J20A 1A8HA 1JIJA 1YUNA 4ZCMA 2NZ2A 2DLCX 3GUZA 1NUSA 5GV8A 1QFYA 3UMVA 4M2LA 4MQ6A 4TMTA 1G7RA 2RC5A 3ZBTA 4ACAA 1W2BB 2PZBA 4F3RA 3G71B 4MUFA 4DDHA 2AZXA 3FHJA 2B7CA 1KTVA 3ELBA 1K4MA 3AKZA 4R2LA 1OWMA 3B82A 1DDGA 2GKSA 2PG3A 4ZT3A 1QH0A 4MW4A 1QVFB 2X3FA 1E64A 3DLAA 4S1OA 1TLLA 4TMZA 1TTTA 2BGIA 3MHPA 1WXIA 5EKDA 2YWEA 4P6VF 3CCJB 1TEZA 3I56B 4MLPA 2ZITA 2VYQA 3HZRA 1FDRA 3GMIA 1NSYA 3K32A 3SZ3A 2BF4A 1PG0A 1MRZA 3P0IA 5LFAA 4YAFA 1NP7A 1U3CA 3FY4A 3ND5A 2J07A 3CCEB 3N05A 2CRVA 2A1TS 1N78A 1JA1A 4RD4A 3QE4A 3VNUA 1N2GA 5LM3A 1R5OA 1MOPA 3ZJTA 1G7CA 2YWGA 1COZA 3I55B 4F7DA 2BVNA 1F7VA 1MJHA 1EFTA 3FNRA 1E63A 1N1DA 1N77A 4AF6A 1N2EA 4EG6A 1IB0A 4Y9UA 4YALA 1NURA 3E27A 2CT8A 1OB5A 4FWTA 1FNMA 5IJXA 4ZT4A 2XEXA 1VL2A 3N9IA 3A04A 3H97A 3CLSD 3OW2B 1QVGB 3AGPA 4MYTA 3FPKA 1J1UA 4NX2A 1XB2A 3CCLB 4U9UA 3W2FA 3KT3A 1KC8D 4FZJA 4EH1A 4KKVA 4X0EA 2WQ7A 3GLVA 3CVXA 1M1ZA 4HE6A 3QFCA 4PBTA 4RPIA 1YI2B 2VNKA 1X6VA 1NUUA 4DQKA 1KK1A 4QREA 3FH0A 4JFAA 1I6LA 5GV7A 4I6JA 2PZ8A 1M1KD 3AVTA 1IHOA 2QUHA 1JZSA 1YJWB 4N3GA 1WZ2A 5H59A 1Q86D 1T6YA 3ZXSA 3A05A 2PMDA 1JECA 2QDXA 1WDTA 3P52A 1VBMA 2VNIA 1O97D 3IUEA 4YAUA 1ZUNB 1AMOA 3CD6B 1WY5A 4PBSA 3OZWA 2GQFA 4PY2A 2DETA 5AHWA 5TS2A 4PC1A 4E1AA 4GRIA 4PC3A 4Y7CA 1B6TA 1IQRA 3FDXA 4MAFA 3HFJA 2OTLB 1M8PA 1VLHA 4YBRA 3WYAA 1M8FA 4AF7A 2EL7A 4LBYA 1TYDE 2A1TR 4J75A 1KQNA 4RD6A 4NZPA 3CB4A 1FFYA 4K1XA 4HE5A 1TFUA 3LO8A 3WNBA 4GU5A 4U7JA 2QUKA 5FA6A 1JEDA 2CYCA 3H9BA 4WNYA 3ZUGA 5HUHA 1T9GS 3JXEA 4ZT2A 4YMIA 5TGTA 3LCJA 3G4SB 1Q15A 4B48A 3CCVB 3ZZTA 1IQ0A 1QUEA 1NYLA 4FN5A 1IQUA 3RBAA 3AGQA 1QU2A 1VQ9B 1EP1B 1KRHA 3M5WA 4NATA 1GTSA 2QTRA 3L92A 2PFSA 1K73D 1GLNA 3MMXA 3FIUA 2BMWA 1HA3A 1HYBA 2QJFA 3ISJA 5K0SA 2ZUFA 1I6KA 2JAXA 4MWDA 2QTMA 4MWCA 2HZ7A 3U6BA 2RC6A 5FO1A 3ZBUA 4QFMA 4KR6A 1PFYA 3Q10A 1EUQA 2QUIA 1N0UA 2BV3A 1B2RA 1H42A 2BM0A 4RCYA 3CMEB 1Q7YD 1JMVA 2XRYA 1CQXA 4U63A 1JILA 4Q16A 3UOWA 3COVA 4YHBA 4J0QA 4IW3B 2FX3A 4Q7JB 1I6MA 1P7PA 4MUIA 4DNXA 1OWPA 4EG3A 4RD0A 3P0HA 1QRSA 2Z3VA 1UFVA 4KR9A 4ARCA 1Q77A 3SZGA 3LOQA 1DNPA 4NBSA 3CLRD 1D1NA 1FNDA 1QFJA 3IH5A 4RD3A 1EXDA 3COWA 4DE5A 4DJAA 3W2GA 1KQPA 4MUNA 1GJRA 1ZM2A 3W5VA 1GN8A 2IELA 4PC6A 3U2QA 1ZH6A 2DERA 3OZVA 1I7PA 3C8ZA 1ZJWA 2B7BA 3ND6A 3IDFA 1BQEA 1JA0A 1JEEA 1O5TA 3KT6A 1KAMA 3VO1A 1GR1A 4NCNA 2X1LA 2X1MA 2EJCA 2E1RA 4MW7A 1OWLA 1H3FA 2NSYA 1H3EA 2CV0A 4LBZA 2B7LA 1U7DA 3NBAA 4B44A 2YWHA 2QJTA 1SKQA 4RCZA 3VMFA 1XNHA 3IOEA 1ELOA 5DASA 1MC1A 1BS2A 2C5SA 4MW9A 3W2IA 1KKUA 1XJQA 4NAHA 2DEUA 1OGJA 2IP1A 3INNA 3PXUA 3CR8A 5JBQA 1DARA 2D74A 3AVVA 1B23P 4MUGA 4MW2A 4TS1A 1WXFA 2AHOA 1Q81D 1QU3A 5FNZA 3ZXIA 1QRTA 2RD2A 4CQNA 1F60A 3JQQA 3CC4B 1U7XA 4ND6A 4M4SA 4OJMX 4YP7A 4ZCPA 2I1LA 2A88A 1J09A 1VBKA 4EG7A 3MMPA 4EFKA 4QHYA 1ZUNA 2EFGA 1D2RA 1AIPA 1S72B 3D6UA 1G8HA 4B4DA 2PXHA 1V47A 2JA2A 5H5JA 2BYTA 2CYAA 3CMAB 1R6XA 5KHAA 3TZLA 3ZIUA 5TR9A 3CW2A 1EFUA 5DSZA 4MWEA 4UZEA 1S4MA 5FO0A 3ES9A 3E20A 2BGJA 5LLTA 1IFXA 1KQOA 5DK4A 1KK2A 1OBHA 3NBKA 1NUQA 4MYUA 4MUJA 1XE1A 1YJNB 1V8FA 3Q4GA 4C0SA 4G5YA 4FK8A 1KD1D 2C77A 2EIXA 3WXMA 3QSYA 1N2BA 1O94C 3PNBA 1K8AD 4K03A 1YIAA 5JBNA 4F4HA 1QGAA 4HK4A 1K92A 3X1MA 1EFVA 1KP3A 4EG1A 4R0NA 5BNZA 4M0LA 4P2BA 4YP6A 3RJZA 1O0CA 1BX1A 1ZM3A 3ZJVA 2TS1A 1Y42X 1G7SA 1WJGA 2CV1A 3UY4A 2E0IA 3AFHA 2A7XA 3FI0A 4MUKA 1LW7A 4ZV4A 1SURA 4H9GA 1F7UA 3DPIA 2YWCA 3X1JA 1K9MD 4ZCLA 1O6BA 2A86A 2OTJB 1KAQA 4Q93A 1LI7A 3CLUC 5J59A 2HGZA 1UMKA 3QFTA 3B8HA 2QEXB 3VNVA 3N2YA 1YIJB 3X1KA 1OBCA 3FWKA 4M53A 4QBTA 3CLUD 2BTEA 3AG5A 2J08A 1J1ZA 4WSOA 3SEZA 2QUJA 3UK2A 1VQ6B 1GPMA 4G5FA 4OUDA 1MAWA 3L93A 3UC5A 1J70A 2ZUEA 1A8PA 2J4DA 1IRXA 1LI5A 2QTZA 3SDBA 4TMVA 1I2DA 4MUEA 3P26A 1PFVA 3IVCA 3IMEA 2CSXA 2NPFA 2E18A 5J5AA 5F23A 3K9WA 2WB2A 3AL0C 1T6ZA 4UZFA 1R5NA 1CT9A 2A1UA 1OWNA 4ZCQA 5HXBA 1PG2A 4EG8A 3CLSC 4JXXA 2H29A 1QGYA 2VNJA 4WQMA 2Z09A 1WQ4A 3W2HA 2HCJB 4MUHA 4MVXA 1JGTA 1GAQA 2HDNB 3TS1A 1JNYA 1KORA 1TYBE 3P27A 1TVCA 1ZH0A 4B3XA 1K4KA 1N2OA 2A84A 1M90D 3CCSB 2IJGX 1ZM4A 1QNFA 1M8JA 1K97A 3COZA 3P0JA 1KH1A 3V76A 2WSIA 1QRUA 3WBJA 1G8FA 5HG0A 1CNEA 2VNHA 1EUYA 3CXCB 1VBNA 1W34A 2XNJA 1H3NA 3G6KA 3CCMB 1VQ5B 1CNFA 1MB2A 2G36A 3H9CA 2OQ2A 1M8GA 3ND7A 3OP1A 3S3TA 4ZT5A 1NUTA 1QX4A 3ZZUA 4G5GA 3ZC3A 1VQ7B 2C78A 1TUIA 4P3YA 4L2IB 1IH8A 4ZCSA 4QRDA 3RK1A 1TQ8A 5EMNA 1WXEA 4R2MA 4CDMA 5IHXA 2DR2A 1EFCA 3WNDA 1W35A 4DLPA 1H1TA 3HGMA 1YHQB 4RD1A 1N2HA 2GOYA 3PRHA 4JXZA 4ZT7A 1OD6A 1X8XA 1F4LA 2J09A 1KP2A 3TNJA 1JHDA 2CNDA 3PNYA 2A1UB 4KPUA 3VGJA 4G1BA 4JZYA 1BX0A 3MUEA 4H3SA 3QTBA 5H7XA 1YULA 3WNCA 4LBWA 2CYBA 3PNVA 3KT8A 3FG9A 1O97C 3B78A 3D6VA 2DCUA 3VO2A 2QJOA 1FNCA 3HMQA 4TN1A 1U3DA 1GO2A 5KWVA 3U6KA 4ZCIA
chains in the Genus database with same CATH superfamily
1NXVA 3L77A 2YV5A 4QXQA 3KRTA 1JKIA 1ADYA 4FLEA 3HVJA 4BY9E 1QQTA 3TQ7P 4P8RA 3K6KA 5AJUA 5C3UA 4INOA 2RE8A 1PE0A 2ISCA 2NZUG 2ZQ5A 3A8IA 1FX1A 4BGUA 3QLUC 4MR8B 3N2KA 4Z4VA 3DL4A 5CVEA 3N75A 3UVEA 2BPOA 2H1FA 4Y6RA 4YAWA 2JGKA 4F2GA 3SB2A 3K9HA 3TH5A 3W1EA 5HX7A 2XA9A 3KSZO 1J9EA 1XC7A 2GXSA 2IZ6A 4TM7A 5G0SA 2VDMB 3HGTA 4KQIA 3U0VA 3R5SA 5E9AA 4F3KA 3VS4A 4N1AA 4MAMA 5I51A 3EXEA 5TXGA 2YWFA 1OA0A 3VYSB 4L76A 4O4JA 3AM4A 2A4MA 4IIMA 3GJXC 1Y8QA 5F5LA 2WYRA 1S89A 5E38A 3JRZA 2GCIA 2R2GA 1I5LA 1B4DA 1PJ8A 2JEOA 5P21A 3L4BC 4UUQA 3FJ5A 2EIHA 4KQWA 5CVTA 1PTJC 3MHXA 1YRQA 1OXTA 3MD0A 2GT1A 4M75C 2C03A 2XYGA 4X1VA 4IBOA 4P86A 2G9NA 5T5QA 1QHEA 1Q7YU 1SR8A 3MJXA 3LVBA 2WJ6A 5DNVA 5JO9A 5LC1A 3SMVA 1Z37A 4QQNA 1D0IA 3SYTA 4KPGA 3ASPA 3E2IA 3TRFA 1NE8A 4JT8A 1Q14A 2J3MA 3Q12A 3AEKA 4ZZ2A 1XTPA 2F1MA 4C6TB 3KVRA 4DLAA 3LH5A 2IEDA 5HJ2A 4ATNA 2HQ1A 1C14A 1UL1X 2ZG6A 3PENA 2FG0A 2YY7A 2HU8A 4MPRA 5JADA 2H51A 2VBFA 5KJEA 4E4YA 3OJXA 2QP3A 4COKA 4GQNA 1O6FA 1GUZA 4UE6A 1ZJZA 3EDMA 3FTEA 3TBKA 4BP1A 4DDTA 5IVPA 1YOVA 1V95A 3R3UA 3H0FA 4TSFD 1PW7A 4LAFA 4QUBA 1I2BA 1EP3B 3CTMA 1KO4A 2H0QA 4C0WA 2PGXA 4PYQA 4KFRA 1HM5A 1KO8A 2PV0A 4H08A 5BYKA 2PM8A 3JS5A 3ELYA 1DCFA 1MQ8B 1VQMA 5DT2A 1Z88A 1PR6A 3S68A 4ZQIA 1DC3A 1EHYA 4PNZA 4YDQA 1KMCA 1TM4E 3N8DA 2VA8A 1RAHB 1CC1S 1JG7A 2XSZA 3R9WA 1YL7A 2EYYA 1MFZA 3J81k 1OXMA 2PGAA 2W9XA 2XAUA 4Y67A 2OZEA 1YVDA 1CKBA 1CJCA 3E2PA 4XIJA 5JSYA 1DX9A 3KWMA 3W5HA 4BVFA 1IG0A 3E1YE 1NFFA 3CNHA 3E58A 1DKLA 3GC6A 3UKJA 3KE8A 4KIFA 4H1UA 5C1DA 3G7NA 5ETJA 4OMLA 1P4JA 4X05A 3ONDA 1R6TA 3B9RA 3UMJA 2GCNA 2ONCA 2JGIA 5A02A 2R4QA 1MEJA 4HSEA 2ZZQA 3P1JA 2BW0A 1FLNA 2WIGA 4JEUA 4UNPA 3VXKA 5CHEA 2RM4A 4E5MA 4LXTA 2QQ0A 3NVDA 2P41A 3IUNA 4QT7A 3OY9A 4CMEC 3PKZA 2EF0A 3EEIA 4LWZA 4TKMA 5BXYA 4W1SA 1JHXA 1UZUA 1ECJA 1WQ3A 4TKUA 4LJRA 2XICA 5BOSB 4WK6A 1QF9A 1HDIA 2IIVA 2YWXA 2M0YA 2FJ0A 4N3AA 4QO8A 4KNWA 2PS0A 1NMQA 3R7SA 2CCGA 4LXHA 4BU0A 4FPXA 1ISPA 1UBJS 3E9ZA 3FHCB 1YQEA 3HYCA 4J29A 4PPGA 1UECA 1BGWA 4D4KA 5D84A 2PUFA 2P6MA 3WQRA 5J5CA 3C98A 2WDZA 5JJCA 1ZMOA 1L1EA 1NFQA 1V6AA 3L9WA 1VB3A 2QTVB 2DF6A 1L4UA 4CKCB 4KV9A 1R5JA 4EECA 3R3VA 1ZGGA 2PIDA 1QO7A 3HXKA 3TXYA 4F2PA 1HOTA 1WNFA 4EVIA 3A6ZA 3FZNA 4ZMBA 1K28D 1OYVA 2BZXA 2XG8D 1J0EA 2AOVA 1L4LA 2ZJ8A 1IY0A 3MCZA 1QGZA 3OPVA 3WIOA 1JAXA 2GA9A 3BORA 2ZKLA 4ZO4A 5J23A 5F98A 1MAUA 5IN5A 3QYGB 5B58C 3E3OA 3AF6A 1HF3A 1UD3A 1B8UA 4KN9S 2XVYA 4XPZA 1IC6A 3VJPA 3TQTA 1WDWB 4JENA 2ZAGA 3EIOA 1ZC4A 4Z2AA 3E5RA 3DKVA 2QA4A 2BGKA 2NYSA 1JQQA 3VHRA 3UAVA 1LC0A 3TECE 2CLKB 2KBFA 1NYGA 3ONFA 1JDBB 2EYWA 3CLVA 4DS3A 4DNFA 2R4UA 1IZ6A 4P4TA 4FYWB 2C1XA 4HQRA 4P80A 3FBWA 4R81A 3TCNA 1OX8A 4RLZA 5IMBA 2IYSA 1E3TA 3DKKA 3OPMA 5GV8A 1Z08A 2YHBA 4Z7OB 1ZZEA 5K0CA 1ZCBA 4MQ6A 2TSYB 5B1DA 1F3LA 3OS1A 2EGEA 2LT1A 4A4GA 1W2BB 1I3OA 3F6RA 5D7NA 4YRJA 3S70A 1JFTA 1DAPA 2O4CA 2ZRNA 1ZHIA 1Z28A 2D2IA 1OIWA 2IV2X 5C1PA 3PG5A 2Y0DA 4OV6B 2IUUA 3WQSB 1LW6E 1VMKA 4J4TA 1JKJA 3UHAA 2VVTA 4HXEB 2FMFA 5JZVA 3RYFB 4TLAA 5A05A 4LDAA 4LDJA 4V0QA 5FBWB 2JLSA 2WWWA 2NACA 5GAJA 4US0R 4R2JA 3BFMA 1P74A 1DCMA 1PK8A 1Y98A 2HOQA 4M8KA 5C4MA 1FMLA 2GPTA 3N05A 1L7OA 3HQ4O 4MV9A 2LR0A 1UEXC 2H17A 2A1TS 2H8KA 3W6PA 4C92A 4YMUA 3QE4A 4QJ3A 3VNUA 5CT8A 1AB6A 5MGNA 1GZDA 1MOPA 3HM2A 1G7CA 1CUYA 2KGTA 2PGJA 2R00C 3DT6A 1BDBA 3IKVA 1SSHA 2C5BA 1GL7A 1MJHA 1P1BA 1TAGA 1U5BB 1U0JA 2FCRA 2WC1A 4MUMA 5IMSA 1KI6B 3A8JA 3K9FC 4GOOD 3QXEB 1R6AA 3KSMA 1DC7A 4EUNA 4DJFC 4NG4A 1YXMA 3DMFA 3QUAA 4ZJPA 5DRTA 4N4HA 4S2UA 3N9IA 4LDNA 3OS2A 2GK4A 1SEMA 3HCEA 4LJ8A 4QOJA 3RS2A 3WNQA 5D3ZA 3AUUA 4XTCS 2X77A 2DAPA 2QGGA 1EE9A 2JFYA 4EY6A 3RVRA 2WTMA 1GSAA 2ZWAA 3CCUQ 2P3QA 2ZRQA 3ANTA 4XD7D 4AYWA 4CG0A 1WXTA 1Y1KE 4L8YA 2ZTLA 4DBRA 4CKXA 3FH0A 3TEJA 2GM9A 3IEPA 1KAOA 3MS7A 3PIPA 5E4TA 3ETCA 2LCCA 3O95A 5AKHA 2OYNA 2O3JA 5H59A 2FUCA 1YDGA 4G89A 4BDTA 5HSGA 1H93A 1H2AS 3CNEA 4K6FA 3OTOB 4PBSA 5B7GA 1VQ7T 4HNGA 2ZKIA 5B6JA 5M29A 2C0QA 1BCOA 4DBQA 2WSSD 1T4CB 3P4XA 5IULC 4DR3B 1L1RA 4UXHA 3M4JA 1PWZA 1HNZB 5JAMA 1M1XB 1B34A 2FPWA 3UWPA 3LWBA 3EHDA 4BFLA 2JL1A 4FMBB 1KMIY 1TZ2A 3NEYA 4F7UG 2A0FB 4MP3A 1AGXA 3WYAA 2DSTA 4Q24A 3RIRA 3UHFA 1YCSB 3HUEA 4UEJA 2R8YA 3F9CA 1L1FA 3OE7A 3FNIA 1U9IC 1TT5A 1QRRA 2V6FA 4G81A 2SEMA 2XIDA 4J75A 3CB4A 4L8GA 3UNXA 4B7ZA 5JZ9A 4H7JA 4PZ9A 4CKBA 1QLHA 1KYIA 3TXXA 4HF7A 4HFNA 3CQTA 4BDYA 5I11A 1PIWA 1Z74A 4D0SA 1ZK2A 1QGDA 2OFPA 4MV5A 2CKMA 2PRKA 2H3EB 5T6MA 2PH5A 4JNKA 3LGLA 4KX5A 1K7YA 4ND3A 1VJRA 1G8AA 1QUEA 1HLFA 1IXKA 1MTOA 2FP4B 2H1VA 4A6XA 1JAYA 3ZHSA 4KULA 1FC0A 4B0OA 5DM60 1USVA 2VZEA 1EP1B 2HHCA 2VP4A 2YJGA 4MRRA 3CC2T 2P2ZA 1K73D 1SVUA 2PFSA 2ZYVX 5A7HA 2ZWMA 1JLLA 3SCZA 3IL2A 1N5KA 2I2LA 1PGQA 4O02B 1ZNQO 4KGZA 2E70A 4D6WA 2DIQA 4BO9A 4EFKA 1L3IA 4OLBA 5CVIA 4RV4A 1FS4A 3JQ9C 3LLVA 4V2IA 5EMLA 3BK2A 1U5SA 3Q10A 5F7OA 2I54A 3OAAD 3OWOA 4YRLA 4C7MA 3BMCA 1AZTA 2HDOA 1R0WA 4EKDA 1QH1B 3JYQA 8AT1A 2C7QA 4JL6A 1KJ8A 3C6ZA 3CR3C 2X76A 4IG9A 2H16A 1INLA 3KIPA 4O59O 4Z4ZA 3P0HA 4KYVA 5ALWA 5IXBA 2I8LA 2QMYA 4KO1S 3CLRD 4HNTA 2J0SA 2I6SA 4D0RA 1VRWA 3IH5A 4ZYLA 3K0SA 3X1JA 4LKRA 4A4DA 1JAIA 1OYOA 1PU2A 3PLRA 4L51A 1JSXA 2BRUC 3PC7A 4EJFA 2R79A 1YJNQ 1VJSA 2ZSBA 3HYNA 2GCEA 4BLUA 3THXA 3EXIA 4DC0A 5KYUA 4G0ZA 1RJDA 3TZQA 1WHKA 3REQB 3WGUA 4U7GA 3O9VA 2R62A 3I73A 2FP4A 2PKQO 1RHQA 2NV4A 1OX4A 3OCJA 4UE2A 4DV6B 2BDTA 1OULA 5TF0A 1K9MU 3JQ8B 1VXRA 4RESA 3WB9A 1J5EB 1AK2A 2WRZA 3BMNB 1ODFA 1ZI8A 4PFOA 1S01A 3V2IA 1I2ZA 3W77A 3WRXA 3MRTA 4BN0A 2ZTVA 5IJ9B 1KFJB 5EXTA 4DLRA 5BN3B 2EVRA 3X1YA 3PXUA 4RK1A 4JNCA 1ICEA 1LNSA 5FI1B 3HZOA 3K0AA 4KO3S 1WXFA 3I39X 3ZNOA 1ZUYA 1COWA 3BRWD 3UMCA 4AJOA 4LN2A 3K09C 1TK9A 4CCAA 1N7GA 3AHCA 3QOXA 4ND6A 2EWMA 1U1TA 4ZCPA 3FPLA 2GBQA 5CA1B 3UK7A 3K5WA 2A88A 1VBKA 4R8MA 4I5FA 3R7BA 4DRXA 2XXAB 2WT4A 5JC8A 3P0FA 3E2MA 2Y0CA 5KTTA 1D6SA 3I9V1 3RNLA 1E3EA 4ZIRA 2GD0A 3LQEA 4B4DA 3KTOA 4L7QA 1A97A 2BYTA 3ELUA 1OASA 1CNMA 4XB6B 5G1OA 5GMOA 1YSCA 2AFIE 3GLHA 1MC8A 3NEAA 1B07A 2EW3A 2HEGA 1BWRA 1KI4A 1FP7A 2YV3A 3WDKA 3FOBA 1C81A 2WTUA 3V46A 4HDCA 1XP8A 2EGHA 4KYIB 1U2DC 4ELYC 1N06A 1IFXA 2EZ8A 3G2KA 3JVUA 4WA8A 3V1YA 1GNQA 4U6QA 4GVXA 1O6GA 4G4GA 4WUVA 3ZX5A 1B0PA 4Z4UA 1JG2A 1N2BA 2HNAA 3E3MA 4F71A 3EBLA 5DN6A 2YZGA 4OHXA 2SECE 4ABTA 1VQNT 2LD4A 1NE7A 3L3BA 4FONA 2KT1A 2C9OA 1WKCA 1Z83A 4RTUA 2JRLA 3PXXA 2F1JA 4OXXA 5K6AC 5FUYA 4FGLA 2WD9A 3CC2A 3Q2KA 3FWZA 3FI0A 3QHQA 4OOFA 3CJTA 1YBAA 3B6EA 3LI2A 2HJWA 3B5JA 4RPJA 2IQIA 1PJ3A 3K0AB 2A86A 4YUAA 4LY0A 1WVIA 1GQOA 3BCHA 2O8CA 1R0KA 2V59A 4JRQA 1IE3A 3W7VA 3H4IA 2ZPFB 4KMSA 4N0EA 4BZXA 1YDMA 5FOUA 1V7QA 3TLGA 3U1BA 1NM5C 3CCQA 1B6RA 5BN1A 2OAGA 3LZ6A 4AS2A 2QQ9A 3S2SA 2OXFA 4CLRB 5K8CA 1OEBA 3DTTA 1ACMB 1VQ6B 2HQOA 4DK1A 1GPMA 1H05A 2X1VA 4XX1A 4E2FA 2P6OA 2W6IA 1REQB 1AA6A 2GCOA 4AWAA 1UP7A 1N6KA 3RHZA 1VJGA 3FYUC 5KOYA 1WHMA 2K2VA 2QTZA 1DX4A 1MJGA 1WUKS 3A25A 3HDTA 3GPCA 2JK0A 4GO1A 3S3MA 2JHGA 4KDCA 4PO9A 3UUFA 1G20E 5AI8A 1PFVA 3B38A 4O4HB 2DIEA 3BA1A 5CKDA 5J5AA 4PR3A 1SGWA 1XRNA 4LTNA 1YB6A 1NZ9A 5AW5A 3PVLA 1X7XA 3DOUA 2GESA 2RKOA 3HP4A 5E1OA 1A9YA 1KD1C 2HXGA 4C5IA 3I9KA 4XWTA 1NLPC 3L06A 2X0DA 5CFMA 3KZOA 1ETHA 4LZJA 3QVUA 4F04A 3ONYA 4JLPA 3B1ZA 5EMKA 3QWYA 2F17A 2W2MA 3UB2A 3PWTA 4BZZA 3RMSA 1FU8A 4PGHA 1RQPA 2JVKA 1N7HA 5EZYF 1V9SA 2OYCA 2RBGA 5F1PA 1ZH0A 2C9BA 2CVHA 2RHCA 4PSAA 3SX4A 4ESEA 1VSBA 3MOSA 2XVXA 3Q3JB 1E3SA 4K3VA 1WTCA 2QW1A 4MO9A 2X8AA 2R6R1 2IDJA 5LJ3d 4L3OA 5CVVA 4JVOA 4HGZA 5AM4A 5KYVA 2OR3A 5HG0A 5KOJA 5GAMf 4H0NA 3RS0A 2GVZC 2QQFA 1VF7A 4YA6A 4UHEA 3LP5A 1B7TA 1JFRA 1F2DA 2ZRIA 3G6KA 5AHRA 4D4IA 4BGDA 1D3BA 2C2KA 1M8GA 4JPBW 5GAOm 1C3OA 1PL6A 1Z9ZA 1SHTX 2DVJA 1WOMA 2QK4A 1TJ4A 4PG4A 4BO2A 5F64A 2AJ8A 3CC7T 2BHLA 3UJPA 2Z2KA 2OKCA 3L05A 2PXAA 2O05A 4HGNA 1PP4A 2J5RA 3DGEC 4CU2A 5FJIA 4X20B 1ZAYA 2VWFA 1E3WA 2HL6A 1D6MA 3LC7O 3IT2A 1QIEA 4CR7A 4YJFA 1W8DA 2L8DA 3H17A 4GKVA 1FPMA 3BULA 4DSZA 3ET4A 3DFZA 3TFQA 2IH5A 5SY4A 1QX3A 1BKSB 3FG9A 4UTRA 2A30A 2GM5A 2JN0A 1WRBA 4XRRA 3FPCA 1GAEO 4FR0A 1G9XA 3CMAQ 3CCET 1DIAA 3V7SA 2OP0A 3CX6A 3TZ6A 3AVWA 3ZCRA 2PR2A 2GZMA 2HBWA 2C2YA 2BE9A 5A88A 2ZOSA 3MJHA 3PFHA 4CM8B 4D9FA 2G3RA 1KMHA 1VGRA 3C15C 4MLZA 1JG4A 4EA9A 1GZUA 5L4SA 1X1SA 1ZVVA 5J58A 1GCOA 5J2TB 3ZDBA 5F1YA 1XMSA 1BVUA 4G37A 4RJ2A 5M04A 1XCLA 1AHHA 3CXUA 1OIVA 3DCYA 3OTHA 1B3QA 1PNRA 4GF5A 5CJ2A 1TRKA 1YMVA 1JXOA 5IM5A 5LYJF 4DMFA 2FYTA 4R83A 5REQA 2OBTA 1J90A 2ZRBA 2FWMX 1JQ5A 3SYMA 4AMGA 3CE9A 4NICA 1CXZA 3AF4A 1E62A 3T5BA 1E79A 2O88A 1TH7A 3OT5A 1OR8A 1VQ8B 4I9GA 1ABOA 2CNNA 3HI4A 1I7NA 1NONA 2EJUA 3FROA 3FJOA 1KI6A 3GBSA 1F17A 3DP9A 3EEOA 2D5LA 5L7TA 1BEZA 2PMKA 4EZEA 2D5IA 2H2FA 3GJTA 4D4JA 4R71A 5BSTA 3WRXC 1PJ6A 4MW6A 3VKFA 1Y6RA 1DRVA 3R4CA 2LX7A 1V5VA 4E11A 1A72A 1FXSA 1YI0A 2CHEA 3HWRA 5FQNA 3TMKA 3SOPA 3VYRB 4J07A 4P3NA 3LY7A 3DV0A 3RAGA 4ITRC 2LP4Y 4GE0A 1VQMT 1E0KA 2CMGA 3KHKA 3CUKA 1TXGA 3DWEX 4KVAA 3TW8B 1N75A 3BIOA 3EMVA 4MS3A 1IZYA 1X87A 3E81A 3RHSA 3VNAA 4FHCA 2CC2A 4A5OA 5LKRA 2IEIA 1LNXA 1AC5A 3TTWA 2DL3A 2E7ZA 5H3LA 2CLHB 3PR1A 5SY6A 3ZXYA 4E12A 1HORA 3W5UA 3DDZX 1HI9A 4FHGA 4HJXA 2FSVA 1JHYA 2JVIA 5FWNA 1SVWA 4CMIB 2EKQA 3OE1A 1GAXA 1QG0A 1UFFA 5C34B 4RTLA 2OHHA 1GCIA 3FW1A 4GI1A 2IYAA 5T6BA 1BJRE 3QY9A 3I56A 4PSVA 3JRXA 4XIYA 1EFVB 2UXCB 1IMJA 1NZJA 5GAMg 1BRMA 4V2SA 3A4IA 2VXOA 3PSAA 3Q3EA 1GHTA 1N1GA 1QOQB 5TARA 3GIBA 4RM3A 4JOCA 4UTZA 4RETA 4ARZB 4V0ME 3PGGA 3GNQA 1J9ZA 4NBWA 4E2ZA 5A9SB 1FBTA 1XTJA 4IXWA 3TEFA 3TFWA 3QVGA 3L2VA 4DY4A 2UZ3A 4ZHQA 1BX3A 2XXJA 3RVSA 5FRDA 3PFNA 3F7NA 2GARA 2Z1NA 3EXEB 3IBCA 3IPXA 1AWOA 1T9GR 4P25A 5F4OA 1Z13A 2ZI3A 3BE4A 2V1RA 4IHJB 4UHHA 1T9DA 5EKUA 3AF5A 3WLJA 3I5YA 3FLGA 1FTSA 3VU9B 2ZR8A 3FPPA 4BLOA 2OBMA 1FSPA 5EUBA 3CNLA 4CBVA 3QXGA 4HQ0A 4YJ2F 2GXQA 2V3WA 3GBPA 3OQMA 1W0JD 3W78A 1WOSA 3CCQB 3FJ1A 1G63A 3OOCA 1W73A 2E49A 4YP1A 4H7PA 2VO1A 1U1IA 1Y9ZA 4A9AA 2COYA 4LOHA 5CTJA 1M2OB 1TPYA 1PJRA 1N8TA 3C8UA 5IU6A 2OESA 1KQFA 3OT4A 1J56A 2EFJA 3T6KA 3RVDA 4YRNA 2D1RA 3O4FA 3BS4A 3OE7D 1Z9QA 3QUQA 3KKNA 4QJIA 5KWIA 3NDBB 1NLUA 3R74A 2ZL7A 1NI3A 1OPXA 4Z0TA 1R00A 4CKWB 3OG9A 1P1CA 5CX1A 5AW0A 4IPTA 4R31A 4DCSA 2I87A 2GQIA 3RCBA 4C1NA 3PXCX 4MVJH 1KH3A 3D26A 2CLDX 3A7EA 4BNNA 2ZBPA 2AOTB 2CFIA 1W49A 4G9BA 3VOSA 2XWQA 3I53A 4J83A 1JQDA 2ZBGA 3K1YA 4BO0A 3ACCA 5B6IA 3EVBA 2YFYA 3DBIA 1JTVA 1NXWA 4P6YA 2EFYA 2PCJA 1WKVA 1B0UA 1XJ5A 2WJ4A 3C2QA 1TYCA 3NYQA 4R84A 5DT9A 3GUUA 1WP6A 1RADA 2B1GA 3QHAA 3WE7A 1XQYA 1M8VA 3O8QA 1BGXT 3CCRB 1XYYA 1JIUA 4JJCA 4GVPA 4WCFC 5HE9A 3SS9X 2IZOA 5D85A 1GUBA 4GGPA 3ZYZA 2ECZA 4LXQA 4EFDA 1QP3A 1GA4A 2C7PA 2I2BA 2XECA 4IRXA 4E7SA 3EFSA 2IXEA 3PICA 3UWNA 3FUXA 3H2BA 2WIJA 3IERA 3Q40A 4G0YA 1U81A 4K6GA 1CUFA 3IP9A 4L2IA 4Q66C 1LTKA 1NVUQ 1RBQA 4PRLA 4XVRA 4AW9A 2D8HA 4CJXA 4XAQA 3GB9A 1L4MA 2VSXA 3H65A 4GBJA 5DOZA 5JWHA 5J2UB 4RWEA 5THKA 1GUYA 4GYJA 2PMBA 5COQA 4JMLA 4N5HX 4E7LA 4YXFA 3E9QA 3N0RA 3PHIA 4J49A 2WD7B 2W4QA 3U17A 2IBTA 3B51X 4KP7A 4BLTA 2EP5A 1BI1A 2FUG6 3LBYA 3WDMA 4ERNA 3OI7A 4HR7A 1CF4A 2FR8C 2QRGA 4MMKA 2OT3B 4XM2A 3O75A 5EJ2A 2NADA 2BI4A 3ZWPA 4NXMB 4AP5A 2NAPA 4XNFA 2PG3A 5CCDA 1U0FA 4IVNA 2GHQA 4NONA 2ZE6A 2V6GA 2EYUA 1W5BA 3LY8A 4TTJA 4ZTBA 4C9BA 6NULA 2DBMA 1FDUA 1MCZA 3A0UA 3M4ZA 2JGMA 1WO8A 1N0HA 1JHAA 1RDFA 4J9VA 4TVKA 3J7AC 1OJ7A 4B3BA 1ODTC 3LSYA 2QMHA 3G6EQ 3HCAA 2UU9B 3BFVA 3GRKA 3O6VA 1COWD 3BRWA 4B8YA 1UADA 2GQ0A 3KZMA 3F5QA 5A2QA 2YWWA 1XVIA 5BW5A 4RD4A 2DIGA 3SWNA 2XNDA 4ICIA 3PVCA 4D92A 3LQYA 1RZRD 2C9ZA 3FWYA 3FYDA 3ZQ4A 3QH4A 4N5DA 2P5YA 4KHZA 5FL7D 3PS9A 4ALNA 2A0WA 4DOMA 2O8FB 2MR6A 4WESB 1QONA 3OX2A 2BHNA 1N77A 4ZDKA 4AKHA 4YCAA 2IVWA 1H4TA 3U3OA 2P40A 4YALA 1V39A 1VIAA 2HV8A 3DG9A 3OCZA 2NTNA 4M8SA 3HYLA 5TPWB 4DG8A 4UQLA 2RHDA 3PCRB 1HYEA 3CJRA 4Q82A 5B3AA 1ULZA 4L6CA 3F9RA 3SIPA 4FSDA 1Z6TA 4H7HA 1I10A 2ZDGA 1QVGB 1OLSB 3AGPA 1QIDA 3AY0A 3EQ9A 4IIYA 1ZD8A 3EVAA 4UHCA 1IB8A 4OYLA 1EFHA 2ZQZA 4LCBA 4Q02A 1UKZA 3T7EA 1RI0A 3WMGA 1VI6A 2JFUA 3QFCA 1ZICA 4OKSA 1QV7A 1Q7BA 5A4KA 4RSMA 3B52X 2A37A 4X95A 5PGMA 4YR7A 1D7OA 1E2JA 5CAEB 2YS6A 1FFBA 3QENA 2UZ1B 4A8JB 2ATXA 4LS3A 2MR5A 4O25A 4M77E 5IZCA 1QIHA 5K0JA 3RVMA 1PR1A 5C8VA 2PYDA 1IIBA 4FNAA 5T57A 4NS4A 3R7WA 3EK2A 1WNLA 1X7GA 3P94A 3P52A 4IIBA 3A10A 5TC4A 3VNQA 3QVSA 1KSHA 1MO3A 2V7XA 1TUDA 3BFXA 1HTTA 1YITQ 5ER9A 5IBRA 2Q7XA 4Z4HA 4IIOA 3TVTA 2VT7A 2HKQB 4OI1A 2IPNA 1QYIA 1U6IA 2KYBA 1YKGA 2WU0A 4XAXB 1GGKA 1X8LA 2YYSA 4A73A 1NRIA 1AGYA 1M8FA 3A1DA 2A1TR 4Z5XA 9ABPA 1EEXB 4QYIB 2P9HA 1MV3A 4OF1A 3A4LA 3OEYA 4IZ6A 4N9WA 3UWSA 4BFWA 1HGXA 1ID8A 5IH2A 3JX9A 3GRPA 1SY7A 3N2NA 5FA6A 4LZAA 1VE3A 3PRYA 2MDTA 3F3KA 1CJMA 1GCAA 3JXEA 4MRPA 4Q4CA 1QU2A 2O5EA 2AUNA 2G8LA 4TV8A 5LQSA 3RKUA 2J06A 5EJ5A 2GAAA 4MPJA 3ASRA 2I3GA 4QL3A 4P32A 4D4LA 4WZLA 2ZL6A 4M9UA 3ZWVA 3V1TC 3OW2S 1A0OA 4YCNA 1GTSA 2FZGA 3NORA 4ND2A 3L92A 3KJFA 5SZIA 4J0GA 2Q6IA 1A9SA 1R0XA 1GLNA 3C7KA 3T53B 3SIWA 1SULA 3OYCA 5JTTA 4P3KA 2IW3A 1HYBA 4QXMA 5CIWA 3P0RA 3PI7A 1MOZA 1XTRA 4BMSA 6Q21A 4AJEA 3A9TA 1R6VA 3DMRA 3PTAA 3QPBA 3M83A 4TYWA 2KLHA 3CH4B 1UPXA 1X15A 2XNDD 3RKRA 5HQJA 4ZKDA 1C0MA 2P0KA 3G9ZA 4O4LA 5HJEA 2PRYA 1VE6A 3OIWA 4E5VA 3OU7A 3OOYA 5L3QA 3JAMA 1CR0A 1SKBA 4ZJYA 1J2TA 4Q16A 1P5HA 3HP9A 4EHKA 1VDMA 2F5KA 1HK9A 2RQWA 4Q7JB 2DCMA 4U2DA 1G5PA 3DDYA 3OEHD 1FX0B 3WLSA 4DNXA 4P5DA 1B1AA 1UFVA 2EKPA 3P2MA 3STXA 3T3HA 3ODGA 3R6OA 3EC7A 4QOEA 3NDIA 1XHEA 2C2MA 2I2XB 4YQZA 2L5QA 3SWWA 2JOYA 4KB5A 3LWIA 5CB4A 5B1IA 1K63A 1XOVA 4OXRA 4BU1A 4D3DA 3QKRA 3W2GA 5DGCA 2W6ID 1B15A 1DKRA 2AUTA 1NJ8A 3DO5A 3CCVT 3M9LA 4UCXA 2QYTA 3TRIA 4GLLA 3V4SA 4F5WA 4Z7NB 1JLRA 1JXQA 2C1EA 1P62B 2WFAA 1FZTA 2GI4A 1JA0A 1O5TA 1H22A 3OPYI 3ULRB 1Z4LA 3UAYA 4ENTA 2BEWA 2ID8A 2DVEA 3AI2A 2KEAA 1KFZA 4LFAB 4CI0B 1X0XA 4IIEA 2E65A 1H3FA 4AJ1A 4Q01A 2BM9A 1IAVA 1VB5A 1ZL2A 2B7LA 4J0CA 4LDRA 5GZ3A 4CKEB 4NI5A 4MRMB 2QJTA 3FCCA 3Q3IA 5A7GA 3W1WA 1FLVA 5HCUA 4TYQA 4ZC8A 3D8RA 5DASA 2O8EB 3FUCA 1ZD4A 4OB1B 4X7EA 1KD1U 4LOLA 1DT5A 1N2ZA 2WM2A 4PCLA 3I72A 4EI8A 2FPKA 3T99A 1DARA 2BJHA 2OILA 4I1RA 4TXHA 4YXWD 3ZZMA 3FI9A 1YQTA 2I33A 3C41J 1SCKA 3Q2OA 1QU3A 5EZSA 4BVBA 1U7XA 4L59A 1IN6A 4OJMX 1FDSA 4QTZA 3KJEA 1J09A 3SJAA 5AI6A 2QX9A 5B1HA 4AO8A 1GGMA 5JXIA 2EFGA 1LLCA 4GWGA 4HEHA 1JLKA 3BMOA 4N18A 2MMPA 4M0UA 5BR8B 2FPIA 5H5JA 4BQNA 3FSJX 4XZ3A 3ZIUA 3B3GA 4ER7A 5ES3A 2GILA 3AR8A 4BEJA 4WN3A 3A7DA 1QHYA 2I4MA 1EVJA 5G0UA 2D0DA 1BZYA 2VHWA 1K5GA 5JI3E 1DEKA 1D04A 1U8EA 3R3JA 1N6AA 4GLBA 1RL2A 4EIWA 3EFOB 3JCMb 1O94A 4EYKA 2XDQB 4FU6A 5KCHA 1ISRA 3PNBA 2EIXA 2GK7A 2C1ZA 3G8CA 2HK9A 3HP1A 3ONVA 1GZ3A 1PLKA 3LQ2A 5IVDA 1OHHD 2H1LA 3EDQA 4P38A 5D6NA 5DTJA 2AEEA 1I9CA 4DOVA 5FEMA 3W8RA 3UMMA 1H1LB 5G3ZA 5JSHA 3U5ZB 3H41A 1W59A 4O5VA 1G7SA 1M0TA 2X14A 3DC2A 2X4GA 1OU8A 3JSAA 1UWVA 4N7BA 4HB2A 4Q48A 2H1HA 4UCFA 9LDTA 5J39A 2AFHA 5E7IA 2KROA 2P84A 2Z2XA 3OKCA 1UOEA 4MMXB 3MGAA 4GNKA 5KVAA 4ZI7F 5IAKA 1E18A 1HZEA 1BXGB 2SHKA 3H9EO 4RZXA 3H0CA 4XLZA 1ZCZA 1UMKA 4J1SA 2QEXB 3B7WA 2YVQA 4PYRA 2ST1A 1DMSA 4YLGA 1XJWA 1UP6A 5ALGA 2ZPIB 1FP6A 4E03A 1CYEA 2BIFA 5HBRA 1RVDA 5CLQA 2OCKA 3VDRA 2WV9A 1MAWA 3L93A 2ZRGA 3R20A 4H4DA 4QBKA 2DPHA 2TMKA 2OEPA 4EMKA 3PWSA 2H11A 3D59A 3RVOA 4WECA 1FA9A 3OQIA 1FSGA 4LXIA 5GOZA 4B6FA 3U7GA 2GM4A 5BY2A 3T1OA 3CXCP 1W1IA 2HPHA 4HAIA 4MINA 2CSUA 4GQIA 4LCEA 3WLKX 5FUMA 4C0FA 4KH1A 2O6LA 5AT1B 5JZOA 3D1VA 2DJ5A 1G41A 4P9NA 3UA6A 2XDBA 2X0JA 4WZBB 2WWYA 2D3WA 1U0HC 2ZSAA 3AKCA 3CLSC 3MUFA 1WMDA 4R8KA 5BPHA 5I7HA 1Y9JA 3AF3A 3BK7A 4JI8B 2RHRA 2CUTA 2QPAA 2QSJA 1ZIDA 1KVTA 1SVMA 2H5EA 1KETA 1Y6ZA 2VNAA 1JJBA 4CG3A 3NAGA 5AW3A 1IHMA 3I83A 3TS1A 1OTHA 4PAGA 5LR6A 1OH7A 2WT9A 3GFGA 3QA3E 1VQNQ 3OZ7A 2HWWA 1JHQA 2G0AA 1SRMA 2C4UA 4RA6B 2W4IA 3USES 1BYIA 1AXRA 1MO4A 2GJSA 2NYAA 4H2DA 5KPDA 3K6SB 2P35A 4JUCA 4G0XA 2LKCA 1OXBB 1OKKD 3V42A 1BQ3A 3O8CA 2VNHA 1ITZA 3WQQA 5ALNA 1D03A 3W1VA 4YJ3A 3QEKA 4RY9A 3KUFA 2EBWA 4TTSA 1PT5A 2G36A 3WO0A 4DILA 1BFUA 4LOAA 4UVEA 4BKRA 3HPQA 3RI3A 5EYPB 2C4KA 2ZVDA 5CA1A 3T7JA 1X1TA 3RUEA 3BH4A 2C78A 3GN1A 1E9RA 1XTUA 1IH8A 3HYSA 2NYRA 4R3WA 3OW2P 5E6UA 5EMNA 3UM9A 2D0QB 4J1QA 3AYZB 4B6SA 2PUKB 3CMEA 5GONB 2JJ1D 4MQEA 4M7AE 1P77A 4BO3A 1F4LA 3LT4A 2NLUA 1QYCA 3OEEA 5HUQA 3ESRA 2CJYA 1WSWA 3WQBA 1D1TA 4FFWA 2XQGA 4EBBA 4HBGA 1O97C 1OH8A 5GAN8 4R01A 5GAMh 3ML1A 2DXTA 3K5PA 1E7RA 2QQEA 5HS6A 2YZNA 5ELLA 1YCGA 3Q5DA 3RLFA 2HLDD 1JAZA 1SCQA 2Q4BA 4Y2UA 4XWKA 3WKAA 1M6VB 4K88A 5LLDA 2FB9A 2GHRA 4GLOA 4YDSA 4CMKA 4BXOB 2XITA 1M2EA 4GT1A 5KQPA 4LYHA 5LNK6 3A3PA 3L0ZA 3MAAC 4UBLA 1SWVA 2PX2A 1P91A 3ZVLA 5ADWA 4BMNA 3A2LA 3ILSA 1GPYA 3L1JA 2BGLA 5AKGA 1MHTA 1L7VC 3EIUA 2GYUA 4ZMSA 4A2PA 5BSMA 2CV2A 4NFHA 4TWJA 4Z0PA 2IG0A 1FLAA 4N49A 4XKJA 1DBRA 2JLUA 1JHMA 1IHXA 3A8MB 4XYMA 2ZYRA 4B46A 4I1IA 2IITA 3SF8A 4JMPA 1E6WA 3T0FA 3UXMA 5ADUS 3E9FA 2XTMA 3E3NA 4CC4B 1HH4A 3TIXB 5JSFA 5GMKl 5I9TA 4ENPA 4KNYA 3NOVA 1SZDA 3A9SA 1KAGA 3GPLA 3H5RA 3IVGA 4W8HA 1PWEA 1Z0KA 1NNUA 4GXQA 3ISTA 3QV1A 3KD3A 2WA2A 3JU3A 5DFAA 1HNXB 1OX6A 1B8PA 4OTZA 1IOZA 3RS3A 1RPAA 4YRMA 3QZ5B 1WX1A 2X0RA 3ICCA 4WTOB 3ZCXA 2IGBA 4D44A 4CE6A 1FJXA 2HPAA 1JW9B 3RYHB 1Y9AA 3NHBA 4YV0A 5EUMA 2OBFA 1F8XA 2A14A 3E5NA 3GHYA 5KNDA 1S3FA 2AG5A 1WABA 3EPKA 4HDAA 4ZI2A 4JUFA 1I30A 2B30A 4MB2A 1V71A 2HCTA 2Z5VA 2E1HA 5IYNA 1JBKA 5DX8A 2XZDA 3TZEA 3IO5A 1VQPB 1PWHA 3CCUA 2VDNB 4QDZA 1ZKMA 4TT8A 1P8JA 3H04A 4MDHA 1EP2B 3HA2A 3V8LA 3BHIA 4MOWA 4JJGA 1NNLA 1TYAE 2X6XA 5B7PA 4F46A 2ZT6A 3Q9SA 2MSKA 2XUIA 5DB4A 2AZ4A 2W5UA 3CZ4A 2XVAA 3SM9A 4EO9A 2WINI 4PFSA 1FU7A 1Q20A 4UUPA 1BCRA 1UMDA 3D7KA 4EX7A 1RXWA 2EPDA 2IEYA 3RK4A 1G55A 2JIBA 1U94A 1M34B 2W42A 4O4IF 1Q5PA 2K4MA 2GVDC 1TF7A 2OMEA 1P4SA 4Y2JA 2GEDA 2VYFA 4M75D 1QOZA 1Y1PA 4EI7A 4D9GA 2Y2UA 1TVKB 1UKCA 4I3GA 2VJNA 4Q3AA 4Q19A 5EHIA 4DNQA 3BAZA 1F6DA 3RBBB 3W2EA 3VDMA 2W90A 4JQYA 2H52A 3SR4A 2R1VB 5CCXA 4D9BA 3ANLA 4DLZA 3M6FA 3RVKA 3MT9A 1NMEA 1XAHA 3PITA 3NC0C 3QVVA 4HAYA 2ECFA 2XMQA 3MTEA 2HYIC 1T1IA 4EQZA 3NHPA 4IQ4A 2RFLA 3VNSA 4XL9A 3PC3A 1Y7PA 4D0GA 1P4HA 1WPRA 4B7AA 1P0CA 2R0QC 5ICMA 1ARKA 4KTVE 4HO1X 1QVGP 3GZTB 4RABA 1WWKA 3ZTWA 5BV8A 4ZGNB 1PVOA 1CQJB 5HKOA 1KZ7B 2KYRA 3QTTA 1F20A 1AGNA 3R7LA 3OOSA 2YVUA 1YIOA 4PS1A 4QBFA 1L8OA 2J9ZB 3ZDZB 2BDUA 4KRXA 5AM2A 4ZGQB 1KVUA 3UMGA 2BUDA 1T0PA 1N4DA 2NX2A 1GV0A 3AVXA 5IYZB 4OP1A 3UMYA 5DSTA 3DJYA 5DCWA 4OJKA 2PIAA 3U1VA 1Q81R 4Q39A 1XEFA 1ZOIA 2PJZA 2H92A 4UJ5A 3U44B 3IHKA 4EW3A 1APBA 1NJIC 3DMHA 3F0TA 1A71A 4KR0A 1T6BY 1DAIA 2X40A 3T95A 3UH1A 3LC0A 3K2BA 3NV7A 5ALQA 1U2PA 3IULA 4W5NA 1I1HA 4X3CA 4I99A 4UTVA 3EX7C 2AK3A 4CRWB 5LQKA 1GLVA 2CFOA 3NWBA 4UBNA 4XWAA 2PKYX 1YMQA 1UF9A 2GRUA 1VQOB 2IT1A 1SXJA 5C80A 1ZD9A 5LDGA 3LT5A 2LQKA 1PFUA 3R3SA 2WKRA 2PX0A 4Y1GA 3VU8A 3NASA 1GPBA 2QTTA 3WYGA 3SC2A 2ACKA 1VHQA 4MW0A 3F8SA 1R50A 2BI8A 5HZKA 2ONKA 3VZRA 4PAOA 2YVKA 3L2ZA 5CAIA 3HL0A 3NT2A 4YFYA 3AVUA 3LY9A 4RM2A 4GLKA 3RW9A 4BWYA 3P45A 2PZAA 1JQLB 2PBFA 3AHIA 5HQ3A 5KNCH 2QZJA 2ZP1A 4OGFA 3U3MA 2ZBUA 4NMHA 1H4QA 2L19A 3IKJA 4YP5A 3SP1A 1MXFA 2FLWA 4LSMA 3F5MA 5BUSA 4CLDA 4NBKA 2W2PA 3HVRA 1RACB 3VH2A 3UT5B 5CDFE 4X7MA 5LD2B 4QDOA 2VHUA 5E9QA 3E9RA 4I66A 5JZSA 4H16A 2OV4A 4IV0A 3H1PA 4ODIA 4Y6OA 3T9DA 4WESA 4D3ZA 1RAAA 3KPYA 1JIJA 3IJRA 4X1YB 1ZSZC 1WSVA 1RKBA 2C8KA 3LL7A 3QKSB 1XRPA 2CN1A 3HDVA 1JJVA 1Q3HA 1U7UA 3OQBA 4I4TF 1G9TA 1NQTA 2I3BA 3HHEA 4TMTA 4Q47A 4XOIA 4BE9A 1BCMA 3X28B 1CZRA 3VKVA 3QPHA 1E2IA 2IK8A 4M8LA 1A9TA 5FNVA 5KIAA 4PJNA 5I5GA 4DKJA 1XPOA 1G16A 4DN6A 4NL3A 4UEWA 5K2MA 1OCEA 1VLQA 2Q9AA 3N87A 2YHUA 1WPYA 2OX7A 2O3SA 2VKQA 3LXXA 3QPDA 4X3OA 5E6RB 2F3UA 2HXSA 2O9SA 3TREA 1IPEA 4IEEA 4NNOA 4S1OA 5CGQB 4BNHA 4Z4FA 5HK0A 2EZUA 2FCAA 2CXXA 2VS1A 4H0CA 4QG7A 3JSCA 3VJKA 1WY7A 1H92A 5L6MB 4YAFA 2Q4TA 4Y6GB 1EGQA 3CF4A 4K6KA 3KHUA 1DC4A 1HUQA 4FUQA 1VFPA 4YJGB 5E6SB 4C8QC 1XQHA 3NWEA 2NVBA 4I1OA 3ZHOA 1KQSS 3OUTA 3EC1A 3GY0A 3QMPA 3RV3A 1R5OA 3CTAA 3NQ41 3PIRA 2JHAA 1AUPA 2YWGA 1BD3A 1CUHA 2JJYA 4JB8A 2GEJA 4FZVA 4AVYA 3NAMA 1QQ6A 2I3AA 4ZGJB 2QDLA 1LRLA 2J6OA 4JLBA 4GC5A 3OCWA 2N3ZA 4PZYA 1G8MA 4AF6A 5CYGA 2OGWA 4ZZIA 4R8SA 4FC6A 2PGOA 2FY8A 2R84A 1WMEA 1CS4C 2BJWA 1XCJA 2PLWA 3G85A 3PC2A 5KBYA 2FPLA 4FFSA 4U3JA 3PA1A 4LQLA 3UK1A 3WDLA 1QC5A 3MRVA 1YHQA 4GSYA 4TLDA 3ZU3A 1VQ4A 2SBTA 3WGZA 2QD5A 2IDMA 3RDVA 1OTYA 3VPFA 4B7UA 1VYUA 1UPUA 3JV7A 4PTLA 1YRWA 3D31A 2PFGA 2VHCA 4K9LA 1YU6A 1AS0A 2HSEA 3F4BA 3G8AA 1MMAA 2GGSA 1P3JA 3LPMA 2AG8A 4AZ0A 5LIPA 2EFEB 4R1TA 5K3EA 4N3GA 4DM3A 5E9JA 4KJZA 1BTOA 1NQAO 4LWPA 1U2QA 4IY1A 2YZ7A 4H3VA 1K6IA 1VMDA 2VNIA 2ORED 3AEZA 3DWFA 3H9JA 4KO2S 4M49A 5FCDA 3U23A 3OZWA 3GQBB 4L4XA 5DLQC 5K4AA 1AS2A 4I50B 4GRIA 3VS7A 4PQFA 5JATA 1RZ3A 3WJ2A 1RIFA 4F4JA 3U4MA 2WHRA 4NVRA 4JVSB 1GNPA 1IEXA 1TO6A 2FA9A 2FEXA 4RZIA 2RJCA 2X8JA 4KQ6A 5EESA 3TTYA 4Z88A 1PKTA 1GSIA 4NZPA 3VS5A 2FH5B 3O3NB 4FYHA 3DMTC 4PLHA 2ZPHB 3H9BA 5HUHA 4IOMA 5AKIA 4QW2A 3NJRA 3VTAA 1E7MA 1EVQA 2QMZA 1BPLA 2A9FA 4YJGA 5TGTA 3QG1A 1P5FA 1GGNA 1F38A 2R66A 2G1AA 2QYSA 2JMAA 1Y81A 3G6ET 4MJXA 1E2KA 1I80A 3BDAA 5A3VA 3WWDA 2Q1UA 3FUTA 2RIPA 2V6IA 5FA8A 4AKEA 5AKEA 3GNSA 4LKOA 1VQPA 3GNFB 2XB8A 3HUFA 4V3BA 5J4VA 1XYGA 1CIVA 1PFKA 2XYRA 3HGQA 4DA4A 2Z1MA 4LUDA 4C4SA 3U56A 1WHSA 1WW2A 3KKLA 1C7RA 4BVKA 4MWCA 3AB8A 2RC6A 3LNNA 4FWBA 5IYQA 1KARA 1G3RA 1THTA 2C94A 3UT5A 3TU4K 4DMKA 1FVXA 2RNAA 3COVA 1H42A 5DK6A 4FL6A 3UT6A 3SN6A 1UPCA 5KDLA 3TTSA 3N28A 3HCRA 1QMGA 3KZCA 4HXYA 4J0QA 4RH0A 3VPBA 4BTEA 3U7HB 1G66A 5CHYA 1UJBA 1ISSA 1XVUA 4XJSA 5EXDA 4MVJF 2QV7A 2HUPA 1UWLA 2Z3VA 4M77F 2BEUB 2CH4W 2HDWA 3B7GA 4YPOA 4LD6A 2O2IA 1TLTA 2C4NA 4NBSA 4M88A 1XX6A 2JIDA 3C16C 3EDOA 4NPCA 1L5VA 1IEVA 4GR9A 1S2IA 5GAN7 1GJRA 2DBRA 3GQVA 1DI0A 1Z2PX 2AMYA 3IEXA 4F5EA 3Q6QA 2OHFA 2ZATA 1U6KA 2QRQA 3RYCA 3JB9G 5LMZA 1KU0A 1ULUA 1ZKDA 3ENWA 1AOXA 3LWDA 3ND6A 4M0CA 3V7NA 1PLJA 3AHDA 3NIFB 4EPWA 5C37A 4QXAA 5I8WA 2O0HA 1ZUD1 2X1LA 1A50B 2C4MA 3V8BA 1FOEB 1UOPA 3R7DA 4YQYA 1GILA 2DE0X 1NR5A 2NSYA 2ZJYA 1WBBA 2EHDA 2HTEA 4OO3A 5BWLA 4RCZA 3BL6A 1YB5A 3EBPA 2I6TA 3KLMX 1MC1A 4AXXA 1R9MA 3VC7A 4YP9A 5DTEA 3GYBA 4D8YA 2BH9A 4E5PA 5HZBA 1Y9DA 1ZH2A 3C3WA 4KQ2A 5DGTA 1SAYA 3HVHA 5CDFA 2DPYA 5EOVA 4Q9LA 5FBQB 3LIPA 5BMOA 4K8OA 1MNEA 1KI8A 4J9UE 4N6NA 4ALIA 4XSGA 3N0XA 3MNFA 1KNQA 2J46A 3IELA 5FAXA 1X8KA 1NVVR 2JZNA 5DM1A 3SY8A 1YLOA 1EKXA 2I1LA 3OMLA 2CLIB 1J6UA 1IZ7A 1N9SA 2G0TA 1WI7A 1MPTA 3DM5A 1R16A 3D6UA 1G8HA 2PBLA 2ES4A 2R68A 3LT2A 1ZBDA 1RWMA 4YGXB 1TD1A 4BOYA 1Y9EA 2CXOA 4JJZA 3VYGA 3CW2A 3OC0A 5T67A 4BFYA 2PUWA 2AFVA 5AI0A 2RGEA 3URKA 3EFEA 1KF0A 4OMMA 3GRCA 1S4MA 4D5GA 4QT4A 5JS7A 2O48X 1X7XB 2AVNA 2DHRA 2EKDA 4JL8A 1UKYA 5EMHA 2UXBB 1V8FA 2WNSA 4OJNA 4ZQGA 4NQRA 1V26A 3T34A 3EZ6A 2AR7A 1EX4A 4YROA 2IIQA 1GU0A 3PEYA 2DXUA 1QGAA 1K92A 2WJPA 5KDDA 3AI7A 4IHJA 1EFKA 2WG0A 3DHVA 4WXHA 4Y6LA 1RAIA 4EEXA 5F4JA 2O0JA 2JD0A 1NVEA 1Y5IA 4D4HA 3QE0A 1M6YA 1NRWA 4X7RA 4NTZA 5CK5A 2YMMA 3LFTA 2M1XA 1RFGE 4BMDA 3K70C 3ZVMA 5DYTA 1VQ8Q 4KGXB 1HLGA 5K0LA 2V1QA 1PYDA 5BURA 3PV0A 1FQKA 3WLIA 5JOQA 1PJ5A 3N2IA 3AB7A 1LI7A 2XNKA 4Q05A 3RADC 3G9UA 3L84A 5L3RA 4HOYA 2XZLA 2QAJA 4WD3A 4B3RB 3WLMA 5JW6A 3OZEA 4HP8A 3GVJA 1GCPA 3DB3A 4C8QB 4NYJR 3X1KA 1UDLA 1XMJA 3FTPA 3ZWBA 2O7QA 1KQ2A 1N5MA 3ZY5A 2G67A 1MO2A 4DR1B 4BFVA 3UA4A 3CCVQ 4UFPA 4XYLA 2D3LA 1Z5GA 2GEKA 3JATB 3D1LA 3OYNA 1EAMA 1Y8ZA 2JTFA 1JALA 3IOYA 4J6YA 3V7AA 4PXYA 4BL5A 3GEEA 5E4FA 4S24A 3RWMB 5DI3A 3SBXA 4JI0B 1PW5A 2X5XA 4BEVA 5CR2A 4CIXA 1U2ZA 4TMVA 1X39A 4JLNA 4KT0E 3RKWA 3SSNA 2EYZA 3KR9A 2HPZA 4DT1B 5L3SA 3OW2A 5I9BA 5G2OA 1GZ7A 2G6FX 5EINA 4XM1A 5C8XA 1G38A 1FUKA 4NBLA 3KUDA 3TKLA 3IBGA 1RM4A 4BP9A 3H9NA 3HU2A 4XONA 4GMFA 1X7ZB 4BWFB 1J7JA 3JZFA 3QBYA 2B83A 1JT2A 3HB4X 1Y6QA 5IDYA 4QNNA 2B1IA 2R1TA 5CITA 1CJTC 1PRLC 3SYNA 1W5TA 4JBLA 3R6JA 3GOXA 5E1DA 5JASA 5KKNB 5KOJB 1PBTA 2NTJA 4GP6A 4KACA 4UJ3A 7AT1B 1E32A 1T0HB 1N8KA 1TSFA 2IY9A 4O33A 3E3LA 3A8HB 3OQOA 1L5RA 4C5BA 1RW4A 3SSAA 5LD2C 5JYEA 4QX6A 4YTLA 5EFZA 1NW4A 4HGYA 2I91A 2C5HA 5I2SA 3BRSA 1RLPC 4K87A 1Q6YA 1YJNT 1RI4A 1U4OA 2VDKB 4MYRA 1JLHA 2RHJA 8ABPA 2HF7A 3OT1B 3SNKA 2UVPA 3MKDA 3GMTA 5TIIA 2OQ2A 3LK6A 1XMOB 5JJ5A 3SFTA 3FTDA 3ER8A 3CCQQ 3ZC3A 2QV0A 1KBQA 1VG0B 2YL2A 1TZMA 4ZDWA 5NULA 4CNQA 3G0GA 1S2MA 4R2MA 5ESRA 4EATA 3AHFA 4HNVA 2GUWA 5HBGA 2F3TA 1I1JA 2EYXA 2ZI5A 3NT5A 4GPIB 4OI2A 4QUKA 1ZONA 1NZFA 3WYBA 4WBNA 2J7PA 5T3YA 4KXFB 2HA2A 4MWSA 2C3MA 4WBNB 2Z2YA 3C95A 3A1SA 1ES9A 3PNYA 3DL0A 5BN5A 2QU8A 3BHJA 4DIDA 4OB6A 4LNUB 5H7XA 5EXSA 2GPSA 5INTA 3U3DA 4RTNA 4F0JA 5HY6A 3E1SA 1Z4OA 2CJXA 2X6TA 3TUJC 4O4JF 4Z8AA 3B78A 4BBPA 1U3GA 3IEVA 3PFIA 4OFBA 4WAUA 5DNYB 3RC3A 1VL1A 4KWCA 1D6NA 4II3A 3JCMc 2QTCA 3ILXA 4IUBS 2QU7A 2VP3A 4PQEA 2FDXA 3U6KA 1H6BA 3QVWA 5DM0A 3VMMA 1YR2A 1T3LA 3OJCA 3A9VA 4NYIQ 4UHKA 3T3DA 1UKBA 4Z6KA 1CPYA 1EFPA 2JANA 3KSAC 4DXAA 2O7VA 1XEXA 3EVGA 3QLUA 3HCNA 1FMCA 4KYUA 2V4DA 4MZDA 5FOTA 1ZJYA 2XF2A 4ESVA 1X38A 2WKSA 3RKSA 2W43A 3M6VA 2H3HA 1HDCA 4OJQA 2G5GX 1E6KA 5HFJA 2XNCA 4JRIA 4XTZA 4WK4B 3F3MA 2QAZA 3WP0A 1BVYF 4BKOA 3LX5A 4KGXA 1U0OC 1PEYA 2GD6A 4E09A 4G2NA 3TLBA 2GFUA 2YXPX 3BWBA 1K73R 4LNAA 5EKTA 3LNTA 4FYWA 3SC3A 3CCSA 3I2FA 2IBSA 2JGNA 3E15A 4PTYA 3UAWA 3VHXA 5I9LA 1W36D 3FVVA 4I55F 3PXAA 5BSHA 3DLPX 1SBIA 2IS1A 3NIBA 2ZUUA 4RVSA 3PQEA 3S5UA 3IEKA 1EDOA 2FHSA 3AUKA 4LCJA 5TPZA 3VU1A 4DMRA 3FEOA 2Y67A 3DYVA 2DHCA 3FZEA 3GRAA 2BGRA 3NHSA 2WKPA 3RIEA 1SVKA 2R6HA 1Q1ZA 4QLBA 3CPWA 5JZMA 3H6ZA 1P0FA 3H1BA 4IUUA 2PSSA 5AKXA 5ALYA 5EUQB 3B8EA 3BCRA 3FMIA 2C4WA 2KRNA 5BO5A 3DDUA 1SN7A 3OO1A 1EFPB 4M78B 1TCVA 1DG1G 1G4HA 5FB3A 2ZTNA 5IKEA 4B1FA 1C1XB 2ABWA 4LXXA 5FUWA 2PUTA 2Q6LA 1LF0A 3VR5D 4C92F 4CHTA 4IO0A 4LD9K 3QI7A 2E82A 2P62A 2PEZA 3GK3A 4O29A 1Z7YA 4EZBA 1LBTA 2QBYA 4KR7A 4FYPA 2YUTA 5DBHX 3LYHA 2NU8A 1EK1A 3T38A 2BJVA 2PQMA 1UC8A 4PLYA 4FYMA 3DCIA 3IQGX 4XOTA 5KVCA 5LN1A 1V4VA 3ZCSA 3IURA 1A69A 1NI4B 1XNGA 3N8IA 3L6RA 3E2UA 4I46A 2ZB8A 1RZVA 2J3LA 1Q0UA 2W58A 1NDHA 3E0XA 3X2FA 4HGPA 4NU0A 3S2UA 2R6DA 3K9LA 1Q2UA 2AGVA 3I01A 1B3BA 1QF7A 4PLGA 2WE7A 5J2TA 4URXR 2C54A 1A2OA 3GJ7A 4YRZA 2QR2A 1PWXA 2K3XA 3K31A 2GPWA 3QI2A 2DY1A 1I24A 1K5HA 4BGIA 4OSPA 1ESZA 2YY6A 1FWZA 1ISJA 1QR6A 1QS0B 3JQPA 3DDHA 1VLLA 4KPYA 3UXEA 3E53A 1IM2A 2P78A 1JL3A 2D1SA 2DPMA 2O1WA 1U4NA 1P29A 3ZWMA 3SVTA 3S2FA 1JX6A 4M7DG 3L7AA 3O4VA 3ICQB 4FS3A 2VAPA 2QPLA 5CG2A 1ULBA 4GX5A 1LK5A 2I3DA 4X45A 2XZPA 3U7JA 1EJBA 3BGIA 2LRQA 3PJEA 2L69A 3PHJA 5EGSA 4II1A 2YTZA 4BV8A 5IH3A 1YS9A 1NYQA 1WZOA 4I19A 1BJKA 4QD3A 3AETA 4AECA 1SVOA 2O8NA 5CLIA 3QU9A 4R7ZA 2AC4A 5EJ4A 2YKGA 4C30A 2N42A 2JIZD 3GEPA 3NNDA 4OPOA 4A36A 1F8FA 4TXJA 4Y2PA 4TKVA 3ZNNA 4LJ7A 2EATA 3CLRC 1QLWA 2YRDA 3RABA 1TOVA 4AJKA 2GBIA 2QMUA 2O2XA 4WVFA 2PKEA 4AFUC 1FL9A 3EG2A 1QAOA 1BE6A 3C3EA 1VUBA 3KSUA 4FSSA 3RFVA 2FHDA 3ZV6A 5CDUA 4PANA 1RMTA 4QRIA 3SICE 1O6CA 1VQLB 4M7AC 4YV1A 5M34A 2INGX 2V96A 2VDWA 4DLBA 2L0XA 2G40A 3K94A 3S4YA 3PC8A 1AKWA 1E60A 1J8MF 3VUFA 3HLTA 2P9BA 4FKMA 5K0GA 4IH9A 1U8XX 1QVFA 1YQQA 1M1GA 1XE3A 3BDVA 3MFYA 4IYJA 4A4KA 4MRMA 3DO8A 5KTOA 4B80A 3NLLA 3PYMA 4HHEA 1N2JA 1RCTE 3CIOA 4PGOA 4MRNA 4QARA 3UIEA 4AG5A 4F4IA 1VA5A 2HKNA 3I1FA 4OF4A 2HH9A 3M3HA 5WRFA 3QQ5A 1NN5A 1M9SA 1GKUB 1AEYA 3GIRA 4MDXA 1BXGA 2J5BA 4MO2A 4ETIA 1NC1A 3VPDA 4ND4A 3SEQA 3ZGZA 4JJIA 1YE5A 4XW2A 3UV3A 3OLYA 2ZIGA 3SQWA 2ZI9A 3BBPA 4Q9AA 3MIZA 1J23A 2VBCA 5FUQA 5CCEA 5K05A 3O7WA 3WY9A 2JI9A 4AJPA 2CFCA 2QTWB 2AVDA 5HEKA 5TGDA 2D13A 3W9UA 1KK3A 4B9WA 4Y28E 5JAPA 1N6NA 4G65A 4JT2A 3PYXA 1WHSB 3OU6A 1NT4A 2CGHA 4XIGS 5GVRA 1QSGA 4POAA 2R8ZA 5F2OA 4MUAA 2JS0A 5HF8A 1BKYA 1MG0A 1J4AA 4ROSA 2ODAA 1GNLA 3TR6A 2M51A 1TYZA 4MUYA 3FOZA 4EGFA 2W6ZA 4QOIA 4H31A 1XTKA 4YEJA 2RN8A 1UDAA 4MVJI 2O2CA 4HEA6 3W0LB 3H0IA 4KGZB 1S7CA 2GX6A 2A36A 2OM6A 4RIHA 2CL7X 2JN9A 4EYEA 3B82A 3LW8A 4RK0A 4W9NA 4KQ9A 2V4MA 1ODLA 4TRJA 3O82A 3BMOB 1KVRA 3UB4A 5I7EA 5CKHA 4FD3A 3SD7A 1TQHA 4KAXA 4XWGA 2O01E 1EFLA 1OILA 3F6SA 3CCJB 3B5EA 4F2HA 5JJBA 3ADDA 2JLZA 2NU6B 4S1TA 4BE1A 1N8RR 2C9YA 5CU7A 2BF4A 2QEQA 1MRZA 4WLFA 2QN1A 3KKKA 3CCBA 5LFAA 1TIPA 1Y7IA 4PLWA 2P6RA 3E5HA 2Y0PA 1RADB 1ECCA 2CFTA 4N4IA 3IQXA 4HGRA 3DLLA 2MU1A 3WLAA 5K51A 3PPVA 4J3FA 3A1WA 3Q3VA 4JQZA 2HRQA 4QTTB 2WTXA 1DMRA 3DTYA 4AT1A 2VSQA 3X0DA 1U3WA 2VQSA 2ILVA 3I92A 4GZ6A 1HT0A 4JAVC 2VDJA 1TK2A 3B1XA 1JR6A 5LLSA 1N07A 5CT5A 5DOVA 5A4MS 3L6EA 4J9CA 2ZQYA 3QEJA 4BC1A 4Q1DA 2HR1A 1SC4A 1A2BA 1N6PA 5J2UA 2NSJA 1ZOSA 4PJMA 1W2BA 1YA8A 3A04A 3AM3A 2ZTMA 4DEVA 5BRAA 3ENKA 1LNQA 3MILA 3F49S 2BISA 4Q1VA 1XD8A 3WLEA 2HCRA 2EYQA 4GLJA 1LI4A 3CCLB 1HQKA 3PUWA 4BQSA 1YI2T 3MQ2A 3T35A 1CTQA 2WJJA 4A23A 3NDRA 4KXQA 4X90A 1KY4A 1VIVA 3HKDA 4UTOA 1RYMA 2H1SA 5D5QA 2VOJA 5JD3A 2P0EA 5F78A 4X8MA 3AUFA 3G3EA 1CQIA 2FQQA 1GTG1 4CODB 1W5FA 2NPOA 3HY4A 3H2JA 1UT5A 4O6VA 2ISSD 1JHUA 1ORHA 1E1NA 3LWZA 3M6UA 2EDCA 2WD8A 1LLFA 1CUBA 3DW3X 4HG2A 2HBZA 3RUAA 5BRJA 2EQMA 4DJEC 3CBMA 5CPBA 2BKDN 4BX3A 1NIJA 3AERB 2VVKA 2NO9A 3B7PA 4JLOA 4QDTA 2OV8A 1JHZA 3GFOA 3DNMA 1N5DA 5BQOA 4MAFA 1F9EA 4RMJA 4MI3A 1QNLA 5J1SB 1NM5A 3LZDA 5FOSA 3W4KA 2VRCD 3M7IA 1SZJG 3ZIDA 1XK6A 3VZBA 5A06A 2E6UX 4HH1A 4CIYA 3EVCA 2JAQA 2DQYA 3IHTA 2AR9A 3C6MA 2MWOA 1XD9A 4QOGA 1CKAA 2JASA 4IH4A 1NT2A 2C00A 3D43A 2QUKA 2OCIA 2V65A 1O1YA 3ZUGA 1LVKA 1XQBA 1E69A 1E9DA 2GTJA 1NQVA 2CYCA 4V0MA 3R7FA 2P2LA 3VTKA 5IP5A 4ES6A 5F35A 5KMGB 1USWA 2R25B 3ZVRA 4FN5A 1JRLA 1KZYC 1Y1LA 1GPKA 2DH5A 4XWYA 2ODBA 1RLQC 2ZGVA 2QTRA 3GVPA 4MITA 2ZIXB 2A94A 3L0PA 3ZY2A 3BGOS 4TVRA 5CTAA 3VDQA 5BWMA 4ZKEA 5C7YA 2YDLA 2LWIA 3PJDA 2MYUA 1U3UA 3S1AA 1C9NA 3B9BA 3CZAA 2JAXA 3JVDA 4HX9A 4O8CA 4F38A 3QKWA 5KNDD 1QIIA 2EVWX 3U9LA 2JS7A 4HDOB 4QULA 4URUR 1PFYA 1V11A 2AMFA 3KSBC 5GJBA 4JYAB 2XGGA 2GTIA 1CF9A 2CDBA 2IYQA 2NZJA 4ZODA 5FBZA 3UAGA 4B3MB 1IN1A 1HE8B 1YS1X 1R8SA 1AG9A 1NOKA 1U8UA 4NCAA 3NBYC 1P7PA 4FHDA 4IJQA 1OWPA 1TTQB 1FFHA 1IZ8A 1XG5A 3GFBA 1QQ5A 3LU1A 3N39C 4QQ8A 1Q81C 4RGBA 3NBZC 3HSYA 5D87A 3TQCA 1ID1A 3LOQA 4MIEA 3WFJA 4YCJA 4B8ZA 4O5OA 5DYNA 1VQOT 4NE7A 1RCUA 1AA9A 3C87A 4GOND 1P2GA 3CPHA 5ICFA 3FCYA 1ZH6A 2VQ6A 4XASA 4BO8A 2ZSHA 4PZZA 1D1CA 1VSQA 1NDQA 5JCZA 1NLMA 3OEED 4W1PA 1T5DX 5KE3A 1EWVA 4YRQA 3ICWA 5DDIP 4AB1A 4C04A 3ETJA 1GKKA 2RMKA 3NJ8A 2QHXA 1NW3A 2X1MA 2YXEA 3CR7A 4Y2TA 2FMTA 1U28C 2YIVX 3BEOA 4BFSA 4TTIA 3W5CA 1SA0A 3O93A 2ZYUX 5HF6A 1W4ZA 3AU9A 2FN8A 2BAGA 1JIXA 3TAXA 4FQ7A 2C31A 3TKAA 3ENNA 4WKNA 1BS2A 1ORIA 1W6RA 3NBXX 3IIEA 2FN9A 2FW8A 4IIDA 2K4YA 3SX0A 1MNQA 4CVNA 3AVVA 1EWRA 3LM8A 1G5QA 3G0CA 4KXLA 4MW2A 2IS6A 1JHOA 3CUWA 3RHFA 2OBSA 2ZPAA 1AQNA 1KIKA 2BGNA 2BE7A 4WJLA 3JQQA 4CQNA 4BQPA 1YK1A 3HFRA 3HWWA 4FHFA 4UDNA 3BFJA 4DDWA 2HWKA 4IJ5A 1X13A 4HS4A 3V2HA 4YUYA 4QHYA 2AFHE 3TINA 2TRSB 4KHPB 1BC5A 1QG6A 2E4ZA 2Q3DA 5ALTA 3HKSA 4Z4RA 2WYOA 2KI5A 3W06A 5IANA 2HCBA 4B3FX 3KQSA 3RIHA 4GR4A 3DTVB 1EYZA 2IFTA 5F76A 5KQLA 4IIHA 1ECFA 2GD2A 4TZKA 5DSZA 2JJMA 4M7AD 5TB5A 4DXDA 1ZVKA 2R2AA 4YCDA 4YX9A 5DK4A 4WCIA 5LUAA 2QVZX 4AF8A 2NG1A 1QXSA 4US2R 1OV6A 1TU4A 5GIPE 4IGIA 3MCVA 3OQJA 1D09B 4KDRA 2O1XA 2FSGA 2GSWA 3TOVA 1SKYB 4RG8A 2QTXA 1MC4A 2IV7A 3HBMA 3MT7A 3OJOA 4LRWA 5JJLA 2J5XA 2CSIA 2OXRA 5ILOA 3IKTA 5LB2A 2W2TA 2XV1A 1T1SA 1NFRA 1H0SA 3AEYA 2J6IA 1Q2XA 4J0JA 3M0TA 4WNIA 3GROA 2AE2A 2MOXA 2CL0X 3H75A 4QBHA 5LVAA 4M1MA 4W7SA 1CRZA 4DUZB 2HDAA 4MUKA 2RJNA 1Z07A 3I6IA 1JJ2S 3AOEC 3SQDA 1N05A 1TM3E 2Y6UA 1DKUA 1YASA 1E8MA 2VEOA 3AIKA 4RQBA 5ITZA 1QVFS 3ZQJA 4AY2A 4GMKA 4EITA 2E6NA 4KUHA 4S04A 2WQ6A 5LJ3g 3EZ2A 2OHOA 4DNPA 3OM8A 2V8KA 1P2BA 2A5JA 4BQRA 3H2GA 1ADCA 3QITA 4P33A 1JV2B 2VF8A 3CLUD 1E0DA 2G76A 3AG5A 3KU4A 4K6HA 5ALKA 1C2YA 1LV8A 2FSVC 1TQ6A 3PGMA 2PVSA 3E3AA 2QNRA 3KDAA 5KQGA 3LIIA 4H3KB 2XUAA 1N6RA 4CKYA 3RRYA 2HL3A 2AI1A 5DYYA 3D6JA 3JWIA 2RAFA 2IYOA 3F6PA 4Q1BA 4DZZA 1GA6A 3C14C 4HCZA 3E4DA 4XU2A 1HOXA 4IDEA 4AG1C 3IR7A 3BMQA 2ZCVA 3L6BA 3MBOA 2ZBQA 2XSZD 3IBSA 4NKRA 2XADA 4EO4A 4KDFA 4CKWA 8GPBA 3PWZA 1OPRA 2Z6VA 1EM6A 4UBOA 1OPLA 3OYKA 1R8JA 2FAXA 3H5OA 5G4KB 4AZ3A 4JP5A 5EAIA 1Z3IX 2FMUA 1Z47A 3L8EA 3NAQA 5EE9A 4QHTA 5D3MA 4CL0A 1GZ5A 2DWQA 4QRHA 4R8RA 4XMYA 2O2EA 2WYIA 2HMYB 2RGXA 2GWRA 3EHEA 4OD0A 4UBMA 1S8AA 3NTIA 2Y4YA 3AC0A 3G9QA 4V24A 4E6RA 1D3AA 2DUJA 4FGWA 1NF9A 3GVXA 1M73E 5I5EA 4OREX 1QW1A 4B3XA 1M90D 1TPZA 5AMXA 4RANA 3U7RA 4RPHA 3I4LA 2OO5C 3FVRA 3EYWA 4M1ZA 3WBJA 2B2XA 2DFVA 1A9OA 2K2QB 2VAMA 3BIXA 1WQ1R 3L8DA 4RO0A 3BWCA 5CURA 4BX9A 5IABA 5JYCA 4JUDX 2EGCA 2IYTA 3AFNA 5EIOA 4XUCA 4I4TB 4J90A 3CIFA 4EHJA 1NVXQ 4RA6A 2VSOA 5E9WA 4E2FB 3H6GA 1RM5A 3G13A 3DKIA 2XT6A 2QX8A 1RI3A 2YQ5A 4Y3UA 4U2EA 4ZHQB 1Y4AE 1ZGAA 4H1TA 3WL7A 3H5TA 1W0KA 4TL8A 2ZU6A 3I2HA 4HNQA 4LJSA 3E7PA 1A8QA 4LGCA 5GANe 1N2HA 1Q7CA 3G2IA 2V8IA 4CQLA 1GPLA 3OZFA 3PD7A 1OD6A 3TW0A 1CERA 4ALJA 1PKSA 1Y0YA 1YAJA 1Z0AA 4YR9A 1YDWA 4PU0A 2A1UB 3OMWA 5GAMe 4PJOD 1GZ6A 2HN9A 2VJMB 4PQYA 1KDPA 1QWFA 4FN4A 4LC9A 1W2WB 4HVUA 4E5S