2DF5A

Crystal structure of pf-pcp(1-204)-c
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMCYEMELEAVKVAIEVALTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational contagion in a protein: structural properties of a chameleon sequence
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
total genus 71
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 2df5A00
4HPSA 1IOIA 4GXHA 3RO0A 2EO8A 1Z8XA 1X10A 1Z8WA 1AUGA 1Z8TA 2EBJA 3RNZA 1X12A 2DF5A 1IU8A 1IOFA 3GIUA 3LACA 1A2ZA
chains in the Genus database with same CATH superfamily
2B58A 4NGTA 3RO0A 3EXNA 1YK3A 2P0WA 4E2AA 2NSMA 1XFOA 4LQ6A 3FEEA 2JEWA 4B5PB 2PJ9A 2WPXA 5AG6A 2NMTA 3D7HA 1LCPA 5A27A 2JDCA 4ZY1A 4OIDA 2YNDA 2A4NA 3K9TA 2B5GB 3KL9A 2ZEHA 4LQGA 1I21A 2V8GA 1HDQA 3LMSA 1K4JA 4P4BA 3RAMA 4A39A 4KOWA 2ZEMA 3TCVA 3H8EA 4NGPA 4Q7AA 2OH1A 1BOBA 3D68A 4AVBA 2QIRA 1XE4A 3S6KA 4KLWA 5JQ4A 3ISZA 3PBBA 4KS9A 2J8MA 3G3SA 4H6UA 3WC5A 2WYRA 3D7DA 2VQYA 3NH5A 4XNHC 2Q7BA 1NMTA 3GB0A 3IC1A 1R43A 3DR8A 5CBMA 2V8DA 2ZW5A 3IFEA 5AG7A 4UEEA 1IICA 2ARHA 4R9MA 3TT2A 2AFOA 4MHYA 1CJWA 4MHPA 1QQ9A 3B35A 2R7HA 4H2KA 5G22A 1Y9WA 4ZX8A 2AFZA 5D8NA 4KOVA 3QB8A 2IL4A 3R95A 4TNUA 4ZYQA 3TFYA 2HQYA 1ELLP 1XRYA 2PRBA 3KGQA 3V8IA 4OKOA 4CGNA 2JDDA 4KSIA 2PJ5A 4CYNA 5KTAA 1AMPA 3FBUA 2GANA 1VHSA 5JGFA 1S7NA 4KVME 2Z0ZA 4R87A 3T90A 4ORFA 5C88A 1LAMA 3MRUA 2R98A 4R6TA 4JXQA 3EFAA 1BPNA 1XBUA 2IMOA 2PIYA 3TOAA 3OWCA 1CPXA 3ZZIA 2Q4YA 4Y49B 2G3AA 3GKRA 4KOTA 5C82A 2PIZA 4IK2A 1RTQA 2PDOA 4QVTA 5G20A 3FH4A 3IJ3A 4JJXA 1CX8A 2QMLA 2VL1A 3CXQA 1ZG8A 3R96A 3MN8A 3S9NA 3DDDA 1VIXA 4C2XA 4CAFA 5LRJA 1S7FA 2F5IA 2CIJA 2RFHA 3BHXA 4HNWB 4NF1A 5LYDA 4X8IA 4NFRA 4IAVA 2B3VA 2FL4A 1LOKA 4RUHA 5EC4A 3B3WA 3CXSA 4OC2A 4PQAA 5CNPA 4H6ZA 1IY7A 2B4DA 1VHEA 3FEDA 4KUAA 4YU9A 5F49A 4KOXA 4NGNA 3TO7A 4F6AA 1M4GA 2EK9A 3NA6A 3D66A 2V8VA 4JD6A 4MHNA 3SHPA 6CPAA 5K8NA 5LYLA 3CXPA 2R1IA 1YMEA 2C1CA 3DNSA 4NJRA 5HH1A 4A33A 5F46A 3SJFA 2FIAA 4MY0A 2PE3A 2FVGA 2CNTA 1ZLIA 4AXVA 1B87A 3H8FA 5HMNA 1R57A 4FWUA 4QBJA 4JXRA 1GYTA 1ARMA 4PXCA 2IQ6A 3FECA 2Z3MA 4CRZB 3FMCA 2Q0YA 2Q4VA 4IHMA 5LRKA 3PRTA 4CRYB 1IOFA 3GIUA 3T8WA 4C68A 1YQEA 4R7MA 3KR5A 4B13A 4FD5A 1P0HA 3DR6A 4OC5A 2XEIA 3B3VA 4M6GA 2EK8A 1BO4A 1TF8A 2OOTA 3R9GA 2B3UA 4UF4A 1KUYA 2Q4ZA 2YGWA 4Y49C 2AE6A 4K30A 1I1DA 3VH9A 2H5MA 3EO4A 4P6YA 2EBJA 2FE7A 4M85A 3TOBA 1V0CA 4NJQA 1XIXA 4AB7A 4IF5A 7CPAA 4XPKA 4MRIA 5J1QA 1WK4A 1LFWA 4XPLA 4UEFA 2PJ3A 3DGVA 4F0YA 5DWMA 2AFUA 3JVNA 4EFDA 1YVKA 4NGRA 4C7HA 3PFOA 4MCQA 2PC1A 3BI1A 4B12A 4KSFA 2JBKA 1R3NA 2BUEA 4A37A 4R3LA 2GU2A 4EVYA 5I0CA 3B3CA 4KVXA 4JWPA 4P10A 1F57A 4ZY2A 2Z3PA 3T9YA 4C2YA 3RZAA 4AG7A 1PUAA 4CGPA 2G9DA 3FX6A 4MHDA 4MMOA 3FVLA 1GHEA 4II9A 3PB9X 4CGMA 1IIDA 4MFQA 2JEVA 4P4IA 4EMEA 1Y7EA 1Z5RA 2REEA 2RB7A 4HNXB 2VZZA 3KZWA 5EBVA 3D2PA 4M6HA 3WC6A 2OR4A 2WPWA 4GS4A 1ON0A 2PJ7A 4NEXA 3QAYA 4ZBGA 2HUZA 4F8ZA 5HVFA 3PB6X 2RC4A 3FJUA 5IB0A 3PZJA 1YREA 2C6PA 4MY3A 3PEIA 3S6FA 4ZY0A 3N5FA 4OADA 2VEZA 2WSAA 1Q7LA 1M4DA 1M44A 1Q2YA 2XEFA 4UFXA 1FT7A 3D7GA 2J9AA 4UWJA 2QVPA 4A31A 5F47A 2FT0A 3F8KA 3GLJA 2AJ6A 1CPSA 1X10A 3RBUA 4MJ8A 4Q38A 3WT4A 2ABZA 3BXMA 4KZTA 2P6FA 1OZPA 2I79A 2BCOA 1NSAA 4W9YA 4FD4A 1QSNA 2ZEFA 3ISXA 3S9LA 2CTCA 4E0AA 5H84A 3WC7A 4DNCA 1TKHA 2OU2A 2OZUA 2PJ1A 3SI2A 2V8HA 4A32A 4B14A 3LWUA 2CXAA 2B4DB 2CY2A 4NGSA 2PSWA 4AG9A 4ONWA 1L0CA 4RS2A 2DF5A 3KASA 1RXTA 5FVJA 1LANA 4WJBA 1TKJA 3PP9A 4O23A 4U9ZA 5IB9A 2OB0A 4GM5A 4X3RA 4PXEA 2FXFA 2ZELA 3EC4A 4J3GA 1IYLA 1CG2A 4EWTA 2PJ6A 3NE8A 3TO9A 1X12A 4UIAA 3TO6A 3SJEA 3LD2A 3CPXA 3CPAA 4R3KA 1PYTB 1IB1E 1CM0A 4PSXA 4YFJA 3I9SA 5ISVA 1QMUA 2D4PA 3D4UA 4PV6A 4CPAA 3I1UA 2V77A 2FIWA 1DE4C 2O53A 1Z8TA 3KR4A 3QNVA 2XEJA 5LYIA 1Y0RA 1YGHA 2ANPA 2C6CA 2JLMA 3FB3A 4UIBA 1QSRA 1QSMA 3FYNA 1TXRA 3GUXA 2C6GA 2POKA 3D7FA 4KOUA 1VHOA 3KI9A 1Q2CA 4Z65A 1FY7A 2EO8A 4UCPA 2ZEEA 1ZG9A 4A94A 3N7ZA 2IJZA 4CYOA 1IU8A 1CP7A 4X2TA 5DS0A 4CYQA 4FBEA 4C7IA 1TKFA 1UFHA 3H8GA 4YRHA 1BLLE 1ARLA 1S3ZA 4KOYA 1YSJA 4UFVA 3SI0A 2F7VA 2DEAA 3B7IA 3A9LA 3PBEA 4ONUA 3NFZA 4PXBA 2FCKA 3PB4X 1Z4EA 2Z3LA 2VZYA 4A2ZA 2GIVA 3D3SA 4MBUA 2Q51A 3C26A 3IWWA 1M4LA 5F48A 2Q7SA 4PK2A 4IUSA 3TC8A 4B11A 4F0XA 4B5OA 5A28A 2CF4A 1M4IA 4NCZA 1PCAA 4PXDA 1IYKA 1ZO0A 4HKFA 3IO1A 2VBQA 2ZW4A 4FUUA 4TWEA 5K8OA 4ZI6A 3W6XA 4QB9A 4KLVA 2F8HA 4UWIA 4CAVA 3NE7A 2AFWA 3S6HA 2WZNA 4P44A 2NYQA 1VGYA 1Z4RA 2AFXA 4U5YA 3CT9A 4B6ZA 2C27A 4U9YA 1YR0A 3R9FA 2BOAA 3JTKA 3SJXA 5AG4A 2GFQA 5THWA 4H89A 3BI0A 3EY5A 4XNHB 3P2FA 1RO5A 4GXHA 4MCPA 1Q2DA 2WUUA 4JYWA 3VARA 4BBHA 3IGRA 2OZHA 3F0AA 4MI4A 5AG5A 4KUBA 3SXNA 1F2PA 3W91A 1Z2LA 4P4JA 1U6MA 2GREA 2AFMA 3D67A 1J4JA 1LRZA 2ZENA 2VXKA 1XOVA 3FF3A 4XPDB 2PQ8A 3W6SA 3IIBA 2Q04A 3CZXA 3IU1A 2J8NA 2JBJA 1QSTA 2DPSA 2PJ0A 4LX9A 3VWDA 3PGPA 5IX3A 5IV0A 2FSRA 4OP4A 1ZLHA 3K2KA 4P4DA 3IWEA 4KORA 2O28A 3B3TA 3RYOA 5JH9A 2ZOFA 3S6GA 5JPHA 2I00A 4OC1A 5G1ZA 3B3SA 4XPDC 5D29A 3WR7A 3D2MA 3V7ZA 4BMHA 3MGDA 3L2NA 4P4FA 2P6EA 4OIWA 5KTCA 3HUVA 4HPSA 4R57A 2GE3A 4F9UA 2PRQA 4FD7A 5K8PA 4B10A 4L8AA 1N71A 2REFA 1AYEA 3GYAA 4L89A 2YNCA 1KWMA 2X7BA 4RI1A 4BINA 1SQHA 4A38A 3R1KA 2ZPAA 5GCNA 3SJGA 4NSQA 1P4NA 3E0KA 1WWZA 1YLOA 5EMIA 5JM6A 2Z10A 1A2ZA 4FAIA 3GY9A 5I4MA 1CBXA 2G3TA 4OC4A 2Z3KA 3PFEA 4A30A 4UEZA 4MHZA 1NE9A 3PB8X 1HEEA 2Q43A 2PJ8A 2BO9A 2D4OA 2ZEOA 2QJ8A 4G1PA 3H4QA 2HC9A 1CP6A 1UWYA 4ZX9A 1JQGA 5F09A 4BD9A 4CAWA 1XMBA 3BJ8A 3NH8A 2Z3OA 4PPZA 3I3GA 4PK3A 5HVGA 2DXQA 2CNSA 2Z11A 1TF9A 4OAEA 2ZXVA 5DWNA 1S7KA 1MK4A 1IOIA 2G0BA 4AVCA 4AVAA 1OBRA 2PJ2A 3H5ZA 4HNYB 2I3CA 2YNCC 4NGQA 2EUIA 2J8RA 2B5GA 4UFWA 4NGMA 2Q44A 1S5KA 1Z8WA 2PR8A 2QECA 1BPMA 3LODA 5BWAB 4CS0B 2FS5A 3KQXA 5KTDA 3KQZA 5J8CA 5LRGA 4M6IA 2CTBA 1XJOA 2ZEDA 3TTHA 3JUWA 4K3NA 1B6BA 4DJLA 1HDUA 2OZGA 4QC6A 2PJAA 4F9VA 4LUAA 4RN7A 1Z8LA 1KUVA 1YW6A 3P2HA 3VWEA 4QUSA 3G8WA 4CGOA 4OC3A 3TE4A 4UBRA 3B2YA 1NSLA 1KUXA 2Z3NA 2VI7A 4MFPA 2BEIA 3TX8A 4JZ0A 3SXOA 3KHXA 4JLYA 1LAPA 4I49A 3S9MA 4MFZA 4ZGYB 5J8FA 3VATA 3IU2A 4MFLA 4E8OA 5H86A 1XEBA 1ELMP 1JWQA 1YVOA 2O4HA 3R9EA 3JRUA 5E96A 4C2ZA 4NXYA 4CYPA 2KCWA 1QSOA 2EWBA 5HVHA 3K9UA 4OMEA 4MXUA 3BJ7A 2AFSA 4A95A 2ODFA 2BL1A 2PVVA 4DYOA 3F5BA 1IGBA 3KKWA 4R8FA 1XF8A 3NH4A 2R8VA 4WWVA 3UY5A 2PCUA 2ZOGA 2XEGA 5CPAA 2ATRA 5LYFA 5HXDA 4MFJA 1BAVA 3IEHA 1MJBA 2GLJA 1KZFA 2PJ4A 4DUKA 4CGLA 3CDXA 4YWYA 2GLFA 4PSWA 1F2OA 2CNMA 5AGEA 4P4EA 2HV2A 1TIQA 4MCSA 3DSBA 1ZG7A 1M1DA 1EE3P 3BLNA 1Z9UA 4B5PA 4X5KA 2ZEPA 8CPAA 4M3SA 4UA3A 4P45A 2ZEGA 3KHZA 2DPTA 2Y0MA 3HLPA 4FD6A 2B4BA 2PVWA 4KOSA 5G21A 1S7LA 4YGOA 2PJCA 1VKCA 2ZW6A 3PB7X 2ZW7A 3FXTA 3SI1A 4CAXA 2HB6A 3WABA 4KVOE 4CAEA 2PJBA 1MJ9A 5ELYA 5K8MA 1H8LA 3IWGA 3FRMA 4MCRA 3QAHA 1S60A 2BSWA 4OC0A 3FIXA 1Y0YA 1YW4A 4Q36A 1Y9KA 2QYVA 2EVNA 1PU9A 3B8GA 1DTDA 1I12A 2PR1A 3RNZA 3V38A 3ZJ0A 1XMTA 3FNCA 3LACA 2K5TA 3DLJA 1FNOA 4MFKA 3D8PA 1Y7RA 1Z8XA 1YLEA 1AUGA 2YNEA 4OLLA 4UCNA 4UCMA 4R76A 1YX0A 4KSAA 1MJAA 2P6GA
chains in the Genus database with same CATH topology
4HPSA 1IOIA 4GXHA 3RO0A 2EO8A 1Z8XA 1X10A 1Z8WA 1AUGA 1Z8TA 2EBJA 3RNZA 1X12A 2DF5A 1IU8A 1IOFA 3GIUA 3LACA 1A2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HPS A;  1IOI A;  4GXH A;  3RO0 A;  2EO8 A;  1Z8X A;  1X10 A;  1Z8W A;  1AUG A;  1Z8T A;  2EBJ A;  3RNZ A;  1X12 A;  2DF5 A;  1IU8 A;  1IOF A;  3GIU A;  3LAC A;  1A2Z A; 
#chains in the Genus database with same CATH topology
 2B58 A;  4NGT A;  3RO0 A;  3EXN A;  1YK3 A;  2P0W A;  4E2A A;  2NSM A;  1XFO A;  4LQ6 A;  3FEE A;  2JEW A;  4B5P B;  2PJ9 A;  2WPX A;  5AG6 A;  2NMT A;  3D7H A;  1LCP A;  5A27 A;  2JDC A;  4ZY1 A;  4OID A;  2YND A;  2A4N A;  3K9T A;  2B5G B;  3KL9 A;  2ZEH A;  4LQG A;  1I21 A;  2V8G A;  1HDQ A;  3LMS A;  1K4J A;  4P4B A;  3RAM A;  4A39 A;  4KOW A;  2ZEM A;  3TCV A;  3H8E A;  4NGP A;  4Q7A A;  2OH1 A;  1BOB A;  3D68 A;  4AVB A;  2QIR A;  1XE4 A;  3S6K A;  4KLW A;  5JQ4 A;  3ISZ A;  3PBB A;  4KS9 A;  2J8M A;  3G3S A;  4H6U A;  3WC5 A;  2WYR A;  3D7D A;  2VQY A;  3NH5 A;  4XNH C;  2Q7B A;  1NMT A;  3GB0 A;  3IC1 A;  1R43 A;  3DR8 A;  5CBM A;  2V8D A;  2ZW5 A;  3IFE A;  5AG7 A;  4UEE A;  1IIC A;  2ARH A;  4R9M A;  3TT2 A;  2AFO A;  4MHY A;  1CJW A;  4MHP A;  1QQ9 A;  3B35 A;  2R7H A;  4H2K A;  5G22 A;  1Y9W A;  4ZX8 A;  2AFZ A;  5D8N A;  4KOV A;  3QB8 A;  2IL4 A;  3R95 A;  4TNU A;  4ZYQ A;  3TFY A;  2HQY A;  1ELL P;  1XRY A;  2PRB A;  3KGQ A;  3V8I A;  4OKO A;  4CGN A;  2JDD A;  4KSI A;  2PJ5 A;  4CYN A;  5KTA A;  1AMP A;  3FBU A;  2GAN A;  1VHS A;  5JGF A;  1S7N A;  4KVM E;  2Z0Z A;  4R87 A;  3T90 A;  4ORF A;  5C88 A;  1LAM A;  3MRU A;  2R98 A;  4R6T A;  4JXQ A;  3EFA A;  1BPN A;  1XBU A;  2IMO A;  2PIY A;  3TOA A;  3OWC A;  1CPX A;  3ZZI A;  2Q4Y A;  4Y49 B;  2G3A A;  3GKR A;  4KOT A;  5C82 A;  2PIZ A;  4IK2 A;  1RTQ A;  2PDO A;  4QVT A;  5G20 A;  3FH4 A;  3IJ3 A;  4JJX A;  1CX8 A;  2QML A;  2VL1 A;  3CXQ A;  1ZG8 A;  3R96 A;  3MN8 A;  3S9N A;  3DDD A;  1VIX A;  4C2X A;  4CAF A;  5LRJ A;  1S7F A;  2F5I A;  2CIJ A;  2RFH A;  3BHX A;  4HNW B;  4NF1 A;  5LYD A;  4X8I A;  4NFR A;  4IAV A;  2B3V A;  2FL4 A;  1LOK A;  4RUH A;  5EC4 A;  3B3W A;  3CXS A;  4OC2 A;  4PQA A;  5CNP A;  4H6Z A;  1IY7 A;  2B4D A;  1VHE A;  3FED A;  4KUA A;  4YU9 A;  5F49 A;  4KOX A;  4NGN A;  3TO7 A;  4F6A A;  1M4G A;  2EK9 A;  3NA6 A;  3D66 A;  2V8V A;  4JD6 A;  4MHN A;  3SHP A;  6CPA A;  5K8N A;  5LYL A;  3CXP A;  2R1I A;  1YME A;  2C1C A;  3DNS A;  4NJR A;  5HH1 A;  4A33 A;  5F46 A;  3SJF A;  2FIA A;  4MY0 A;  2PE3 A;  2FVG A;  2CNT A;  1ZLI A;  4AXV A;  1B87 A;  3H8F A;  5HMN A;  1R57 A;  4FWU A;  4QBJ A;  4JXR A;  1GYT A;  1ARM A;  4PXC A;  2IQ6 A;  3FEC A;  2Z3M A;  4CRZ B;  3FMC A;  2Q0Y A;  2Q4V A;  4IHM A;  5LRK A;  3PRT A;  4CRY B;  1IOF A;  3GIU A;  3T8W A;  4C68 A;  1YQE A;  4R7M A;  3KR5 A;  4B13 A;  4FD5 A;  1P0H A;  3DR6 A;  4OC5 A;  2XEI A;  3B3V A;  4M6G A;  2EK8 A;  1BO4 A;  1TF8 A;  2OOT A;  3R9G A;  2B3U A;  4UF4 A;  1KUY A;  2Q4Z A;  2YGW A;  4Y49 C;  2AE6 A;  4K30 A;  1I1D A;  3VH9 A;  2H5M A;  3EO4 A;  4P6Y A;  2EBJ A;  2FE7 A;  4M85 A;  3TOB A;  1V0C A;  4NJQ A;  1XIX A;  4AB7 A;  4IF5 A;  7CPA A;  4XPK A;  4MRI A;  5J1Q A;  1WK4 A;  1LFW A;  4XPL A;  4UEF A;  2PJ3 A;  3DGV A;  4F0Y A;  5DWM A;  2AFU A;  3JVN A;  4EFD A;  1YVK A;  4NGR A;  4C7H A;  3PFO A;  4MCQ A;  2PC1 A;  3BI1 A;  4B12 A;  4KSF A;  2JBK A;  1R3N A;  2BUE A;  4A37 A;  4R3L A;  2GU2 A;  4EVY A;  5I0C A;  3B3C A;  4KVX A;  4JWP A;  4P10 A;  1F57 A;  4ZY2 A;  2Z3P A;  3T9Y A;  4C2Y A;  3RZA A;  4AG7 A;  1PUA A;  4CGP A;  2G9D A;  3FX6 A;  4MHD A;  4MMO A;  3FVL A;  1GHE A;  4II9 A;  3PB9 X;  4CGM A;  1IID A;  4MFQ A;  2JEV A;  4P4I A;  4EME A;  1Y7E A;  1Z5R A;  2REE A;  2RB7 A;  4HNX B;  2VZZ A;  3KZW A;  5EBV A;  3D2P A;  4M6H A;  3WC6 A;  2OR4 A;  2WPW A;  4GS4 A;  1ON0 A;  2PJ7 A;  4NEX A;  3QAY A;  4ZBG A;  2HUZ A;  4F8Z A;  5HVF A;  3PB6 X;  2RC4 A;  3FJU A;  5IB0 A;  3PZJ A;  1YRE A;  2C6P A;  4MY3 A;  3PEI A;  3S6F A;  4ZY0 A;  3N5F A;  4OAD A;  2VEZ A;  2WSA A;  1Q7L A;  1M4D A;  1M44 A;  1Q2Y A;  2XEF A;  4UFX A;  1FT7 A;  3D7G A;  2J9A A;  4UWJ A;  2QVP A;  4A31 A;  5F47 A;  2FT0 A;  3F8K A;  3GLJ A;  2AJ6 A;  1CPS A;  1X10 A;  3RBU A;  4MJ8 A;  4Q38 A;  3WT4 A;  2ABZ A;  3BXM A;  4KZT A;  2P6F A;  1OZP A;  2I79 A;  2BCO A;  1NSA A;  4W9Y A;  4FD4 A;  1QSN A;  2ZEF A;  3ISX A;  3S9L A;  2CTC A;  4E0A A;  5H84 A;  3WC7 A;  4DNC A;  1TKH A;  2OU2 A;  2OZU A;  2PJ1 A;  3SI2 A;  2V8H A;  4A32 A;  4B14 A;  3LWU A;  2CXA A;  2B4D B;  2CY2 A;  4NGS A;  2PSW A;  4AG9 A;  4ONW A;  1L0C A;  4RS2 A;  2DF5 A;  3KAS A;  1RXT A;  5FVJ A;  1LAN A;  4WJB A;  1TKJ A;  3PP9 A;  4O23 A;  4U9Z A;  5IB9 A;  2OB0 A;  4GM5 A;  4X3R A;  4PXE A;  2FXF A;  2ZEL A;  3EC4 A;  4J3G A;  1IYL A;  1CG2 A;  4EWT A;  2PJ6 A;  3NE8 A;  3TO9 A;  1X12 A;  4UIA A;  3TO6 A;  3SJE A;  3LD2 A;  3CPX A;  3CPA A;  4R3K A;  1PYT B;  1IB1 E;  1CM0 A;  4PSX A;  4YFJ A;  3I9S A;  5ISV A;  1QMU A;  2D4P A;  3D4U A;  4PV6 A;  4CPA A;  3I1U A;  2V77 A;  2FIW A;  1DE4 C;  2O53 A;  1Z8T A;  3KR4 A;  3QNV A;  2XEJ A;  5LYI A;  1Y0R A;  1YGH A;  2ANP A;  2C6C A;  2JLM A;  3FB3 A;  4UIB A;  1QSR A;  1QSM A;  3FYN A;  1TXR A;  3GUX A;  2C6G A;  2POK A;  3D7F A;  4KOU A;  1VHO A;  3KI9 A;  1Q2C A;  4Z65 A;  1FY7 A;  2EO8 A;  4UCP A;  2ZEE A;  1ZG9 A;  4A94 A;  3N7Z A;  2IJZ A;  4CYO A;  1IU8 A;  1CP7 A;  4X2T A;  5DS0 A;  4CYQ A;  4FBE A;  4C7I A;  1TKF A;  1UFH A;  3H8G A;  4YRH A;  1BLL E;  1ARL A;  1S3Z A;  4KOY A;  1YSJ A;  4UFV A;  3SI0 A;  2F7V A;  2DEA A;  3B7I A;  3A9L A;  3PBE A;  4ONU A;  3NFZ A;  4PXB A;  2FCK A;  3PB4 X;  1Z4E A;  2Z3L A;  2VZY A;  4A2Z A;  2GIV A;  3D3S A;  4MBU A;  2Q51 A;  3C26 A;  3IWW A;  1M4L A;  5F48 A;  2Q7S A;  4PK2 A;  4IUS A;  3TC8 A;  4B11 A;  4F0X A;  4B5O A;  5A28 A;  2CF4 A;  1M4I A;  4NCZ A;  1PCA A;  4PXD A;  1IYK A;  1ZO0 A;  4HKF A;  3IO1 A;  2VBQ A;  2ZW4 A;  4FUU A;  4TWE A;  5K8O A;  4ZI6 A;  3W6X A;  4QB9 A;  4KLV A;  2F8H A;  4UWI A;  4CAV A;  3NE7 A;  2AFW A;  3S6H A;  2WZN A;  4P44 A;  2NYQ A;  1VGY A;  1Z4R A;  2AFX A;  4U5Y A;  3CT9 A;  4B6Z A;  2C27 A;  4U9Y A;  1YR0 A;  3R9F A;  2BOA A;  3JTK A;  3SJX A;  5AG4 A;  2GFQ A;  5THW A;  4H89 A;  3BI0 A;  3EY5 A;  4XNH B;  3P2F A;  1RO5 A;  4GXH A;  4MCP A;  1Q2D A;  2WUU A;  4JYW A;  3VAR A;  4BBH A;  3IGR A;  2OZH A;  3F0A A;  4MI4 A;  5AG5 A;  4KUB A;  3SXN A;  1F2P A;  3W91 A;  1Z2L A;  4P4J A;  1U6M A;  2GRE A;  2AFM A;  3D67 A;  1J4J A;  1LRZ A;  2ZEN A;  2VXK A;  1XOV A;  3FF3 A;  4XPD B;  2PQ8 A;  3W6S A;  3IIB A;  2Q04 A;  3CZX A;  3IU1 A;  2J8N A;  2JBJ A;  1QST A;  2DPS A;  2PJ0 A;  4LX9 A;  3VWD A;  3PGP A;  5IX3 A;  5IV0 A;  2FSR A;  4OP4 A;  1ZLH A;  3K2K A;  4P4D A;  3IWE A;  4KOR A;  2O28 A;  3B3T A;  3RYO A;  5JH9 A;  2ZOF A;  3S6G A;  5JPH A;  2I00 A;  4OC1 A;  5G1Z A;  3B3S A;  4XPD C;  5D29 A;  3WR7 A;  3D2M A;  3V7Z A;  4BMH A;  3MGD A;  3L2N A;  4P4F A;  2P6E A;  4OIW A;  5KTC A;  3HUV A;  4HPS A;  4R57 A;  2GE3 A;  4F9U A;  2PRQ A;  4FD7 A;  5K8P A;  4B10 A;  4L8A A;  1N71 A;  2REF A;  1AYE A;  3GYA A;  4L89 A;  2YNC A;  1KWM A;  2X7B A;  4RI1 A;  4BIN A;  1SQH A;  4A38 A;  3R1K A;  2ZPA A;  5GCN A;  3SJG A;  4NSQ A;  1P4N A;  3E0K A;  1WWZ A;  1YLO A;  5EMI A;  5JM6 A;  2Z10 A;  1A2Z A;  4FAI A;  3GY9 A;  5I4M A;  1CBX A;  2G3T A;  4OC4 A;  2Z3K A;  3PFE A;  4A30 A;  4UEZ A;  4MHZ A;  1NE9 A;  3PB8 X;  1HEE A;  2Q43 A;  2PJ8 A;  2BO9 A;  2D4O A;  2ZEO A;  2QJ8 A;  4G1P A;  3H4Q A;  2HC9 A;  1CP6 A;  1UWY A;  4ZX9 A;  1JQG A;  5F09 A;  4BD9 A;  4CAW A;  1XMB A;  3BJ8 A;  3NH8 A;  2Z3O A;  4PPZ A;  3I3G A;  4PK3 A;  5HVG A;  2DXQ A;  2CNS A;  2Z11 A;  1TF9 A;  4OAE A;  2ZXV A;  5DWN A;  1S7K A;  1MK4 A;  1IOI A;  2G0B A;  4AVC A;  4AVA A;  1OBR A;  2PJ2 A;  3H5Z A;  4HNY B;  2I3C A;  2YNC C;  4NGQ A;  2EUI A;  2J8R A;  2B5G A;  4UFW A;  4NGM A;  2Q44 A;  1S5K A;  1Z8W A;  2PR8 A;  2QEC A;  1BPM A;  3LOD A;  5BWA B;  4CS0 B;  2FS5 A;  3KQX A;  5KTD A;  3KQZ A;  5J8C A;  5LRG A;  4M6I A;  2CTB A;  1XJO A;  2ZED A;  3TTH A;  3JUW A;  4K3N A;  1B6B A;  4DJL A;  1HDU A;  2OZG A;  4QC6 A;  2PJA A;  4F9V A;  4LUA A;  4RN7 A;  1Z8L A;  1KUV A;  1YW6 A;  3P2H A;  3VWE A;  4QUS A;  3G8W A;  4CGO A;  4OC3 A;  3TE4 A;  4UBR A;  3B2Y A;  1NSL A;  1KUX A;  2Z3N A;  2VI7 A;  4MFP A;  2BEI A;  3TX8 A;  4JZ0 A;  3SXO A;  3KHX A;  4JLY A;  1LAP A;  4I49 A;  3S9M A;  4MFZ A;  4ZGY B;  5J8F A;  3VAT A;  3IU2 A;  4MFL A;  4E8O A;  5H86 A;  1XEB A;  1ELM P;  1JWQ A;  1YVO A;  2O4H A;  3R9E A;  3JRU A;  5E96 A;  4C2Z A;  4NXY A;  4CYP A;  2KCW A;  1QSO A;  2EWB A;  5HVH A;  3K9U A;  4OME A;  4MXU A;  3BJ7 A;  2AFS A;  4A95 A;  2ODF A;  2BL1 A;  2PVV A;  4DYO A;  3F5B A;  1IGB A;  3KKW A;  4R8F A;  1XF8 A;  3NH4 A;  2R8V A;  4WWV A;  3UY5 A;  2PCU A;  2ZOG A;  2XEG A;  5CPA A;  2ATR A;  5LYF A;  5HXD A;  4MFJ A;  1BAV A;  3IEH A;  1MJB A;  2GLJ A;  1KZF A;  2PJ4 A;  4DUK A;  4CGL A;  3CDX A;  4YWY A;  2GLF A;  4PSW A;  1F2O A;  2CNM A;  5AGE A;  4P4E A;  2HV2 A;  1TIQ A;  4MCS A;  3DSB A;  1ZG7 A;  1M1D A;  1EE3 P;  3BLN A;  1Z9U A;  4B5P A;  4X5K A;  2ZEP A;  8CPA A;  4M3S A;  4UA3 A;  4P45 A;  2ZEG A;  3KHZ A;  2DPT A;  2Y0M A;  3HLP A;  4FD6 A;  2B4B A;  2PVW A;  4KOS A;  5G21 A;  1S7L A;  4YGO A;  2PJC A;  1VKC A;  2ZW6 A;  3PB7 X;  2ZW7 A;  3FXT A;  3SI1 A;  4CAX A;  2HB6 A;  3WAB A;  4KVO E;  4CAE A;  2PJB A;  1MJ9 A;  5ELY A;  5K8M A;  1H8L A;  3IWG A;  3FRM A;  4MCR A;  3QAH A;  1S60 A;  2BSW A;  4OC0 A;  3FIX A;  1Y0Y A;  1YW4 A;  4Q36 A;  1Y9K A;  2QYV A;  2EVN A;  1PU9 A;  3B8G A;  1DTD A;  1I12 A;  2PR1 A;  3RNZ A;  3V38 A;  3ZJ0 A;  1XMT A;  3FNC A;  3LAC A;  2K5T A;  3DLJ A;  1FNO A;  4MFK A;  3D8P A;  1Y7R A;  1Z8X A;  1YLE A;  1AUG A;  2YNE A;  4OLL A;  4UCN A;  4UCM A;  4R76 A;  1YX0 A;  4KSA A;  1MJA A;  2P6G A; 
#chains in the Genus database with same CATH homology
 4HPS A;  1IOI A;  4GXH A;  3RO0 A;  2EO8 A;  1Z8X A;  1X10 A;  1Z8W A;  1AUG A;  1Z8T A;  2EBJ A;  3RNZ A;  1X12 A;  2DF5 A;  1IU8 A;  1IOF A;  3GIU A;  3LAC A;  1A2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...