2DF6A

Crystal structure of the sh3 domain of betapix in complex with a high affinity peptide from pak2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 7
total genus 10
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2df6A00
4GLMA 1PKSA 1QKXA 2KYMA 2A28A 4RTTA 4AFSC 1GL5A 1U06A 1JEGA 2FG0A 2ROLA 2EYZA 3TVTA 2RF0A 2GGRA 2K79A 4OMOA 2KT8A 2JMCA 1AWWA 2KT1A 2YT6A 3VS5A 2RQUA 2L0AA 2RQTA 2CREA 2CSIA 2DLPA 1ZUYA 4WCIA 1QKWA 3I9QA 1H92A 2DL8A 2K2MA 1YNZA 5IHKA 2CH4W 2KEAA 2HDAA 2JT4A 4OMLA 4J9HA 2EGEA 2JS0A 2O31A 3C0CA 1M3CA 2CUBA 2L2PA 1WXBA 2DNUA 1HJDA 2DRMA 4M4ZA 2RMOA 1B07A 2LCSA 2EPDA 1MV3A 3M0PA 4CC7A 2HCKA 1ZUUA 4D8DA 1UECA 1OPLA 2DILA 4AG2C 3H41A 1FYNA 1KSWA 2YUOA 1Y0MA 1GBRA 1M3AA 1YWPA 4J9DA 1HSQA 3M0TA 1X27A 2DL7A 4Y92A 1WIEA 4J9BA 3VS6A 2KXCA 1M3BA 3VS0A 2M0YA 1SRMA 2O9SA 1WLPB 1G2BA 1PRLC 2KRNA 1T0JA 4JPBW 2EBPA 1G83A 5IHIA 1E7OA 1Y57A 3I5SA 2GBQA 1H8KA 1B3QA 2CT4A 3FJ5A 1J3TA 2J05A 4IIMA 1JXOA 1SPKA 3UA6A 2EGAA 2KGTA 4JJDA 5GJVB 1M27C 2OAWA 3NGPA 2DVJA 2ED1A 3LH5A 1AZGB 3QWYA 1AWJA 3M0SA 2PTKA 2CT3A 3PVQA 4AFUC 2JMAA 1UTIA 4EIKA 1RUWA 1NEBA 5FW9A 1MUZA 4DEYA 2RQRA 4AG1C 2F2VA 5I22A 3I5RA 4J9GA 1GCQC 1U5SA 1GRIA 2DL4A 2MIOA 4JJBA 4RTVA 1ZUKA 2HEQA 1YCSB 2J6KA 4GBQA 1CKBA 1GBQA 2KRMA 1RI9A 1TUDA 2W0ZA 1SHFA 4RUGA 1GFDA 1VYTA 1E6GA 1UJYA 2KBTA 3U23A 4OMMA 4CC3A 1HD3A 1UJ0A 1YN8A 1AWOA 3THKA 2MCNA 2DL3A 2M51A 1ABOA 2JM8A 1WXUA 4HCKA 2F2WA 3QWXX 2LQNA 1UFFA 3NMZC 1UGVA 4Z88A 3VRZA 2SEMA 2CUDA 4JJCA 1ZSGA 4RTYA 3EG0A 3UATA 1GCQA 2K6DA 3SEMA 4OMPA 3R6NA 4ESRA 5IXBA 1W1FA 2D8HA 1T0HA 4F16A 4IIOA 1SSHA 3REAB 1M30A 2DRKA 2IIMA 2AKKA 5L23A 2ECZA 5IXFA 1VYVA 2VKNA 1FMKA 2DJQA 4E6RA 3TSZA 1BU1A 1WYXA 2JM9A 2BZYA 4LUEA 1A0NB 5FWCA 2AK5A 1NEGA 2K3BA 2P4RA 2RQWA 4AFQC 1QWEA 3UA7A 1X43A 1OOTA 1AZEA 2BZ8A 1IO6A 3CQTA 3VRYA 1M8MA 2C0TA 3RBBB 3VS7A 1ZBJA 1PKTA 2DBMA 1I07A 1BB9A 1KFZA 1KIKA 1GFCA 2CH4A 3SHWA 3KFVA 2EYWA 1CSKA 2X3XD 2CSQA 1WXTA 3PVLA 2DE0X 4HXJA 2FRWA 2GQIA 2AZVA 5GJWB 3JV3A 2YUQA 1AVZC 1WX6A 1WDXA 1UUEA 4RTWA 2DBKA 2PNIA 2MOXA 2LNHB 2RQVA 1X2KA 2C0IA 5EC7A 4LE9A 3IQLA 2OJ2A 2YUPA 1X2QA 2EYXA 4OMNA 4F17A 2DYBA 2G6FX 4QT7A 4J9IA 2CDTA 2ED0A 3A98A 4HVUA 3UF4A 1NLOC 2HBWA 1JO8A 4LN2A 3REBB 3VS3A 3NHNA 1CKAA 2SRCA 2EGCA 2D1XA 1T3LA 1NM7A 1N5ZA 2V1RA 1QWFA 2JTEA 1ZLMA 1NYGA 2K9GA 2LP5A 5IHNA 2JS2A 4KRTA 2DL5A 2L3PA 4DEXA 2BTTA 1PHTA 1NYFA 4HVVA 2V1QA 4AFZC 2KXDA 1K4US 1PWTA 1X6BA 1AOJA 3ULRB 2C0OA 1JU5C 2ENMA 1I0CA 2J06A 2D8JA 1X6GA 2HSPA 2FEIA 5HCKA 2A37A 2XMFA 2LMJA 1PRMC 1EFNA 2J6FA 1Z9ZA 4RTUA 2L3SA 3TSWA 1K1ZA 1NLPC 1I1JA 1BK2A 1W6XA 2JW4A 2ESWA 1OEBA 3ZL7C 2KNBB 4J9EA 4F14A 1VYUA 4Z8AA 3VS1A 1W70A 4R0KA 3H0IA 3H0FA 2EQIA 1YWOA 1SRLA 1UHFA 1GCPA 2YDLA 1ABQA 1SHGA 1TG0A 2LJ1A 2GTJA 1AD5A 4FSSA 1T3SA 3RNJA 2JXBA 4K11A 2KR3A 2LJ3A 5I11A 2KYBA 1OPKA 2OI3A 1K76A 1WI7A 2H8HA 2YUNA 3I35A 2E5KA 2L3QA 4OMQA 1ZX6A 1BBZA 1ARKA 4LUDA 2BZXA 1MV0B 1TUCA 2A36A 2KE9A 4J9FA 1OV3A 1K0SA 2D0NA 1K9AA 1LCKA 1SEMA 1UHCA 2LZ6B 2DM1A 1S1NA 1K0XA 1UG1A 3M0UA 1YP5A 1UE9A 2EW3A 3VS4A 2O2OA 2FPDA 3EG2A 2RPNA 2NUZA 1VA7A 4X1VA 1AEYA 2FPFA 3EG1A 2DMOA 2GTOA 4Z89A 2F2XA 2LQWA 1PNJA 2AKLA 2X3WD 3PE0A 2J7IA 1AWXA 2VVKA 2EKHA 4HVWA 4ZNXA 2O88A 2FRYA 1E6HA 1V1CA 1WFWA 3GBQA 1X69A 3EHRA 2ABLA 5ECAA 1JQQA 3EG3A 3NPFA 4RTZA 2FPEA 1XOVA 3H0HA 1QCFA 1RLPC 1KJWA 2B86A 1JXMA 2LJ0A 1NG2A 4CC4B 4D8KA 2EVRA 2DF6A 2O9VA 4JZ3A 2J6OA 2LX7A 2DX1A 2K7AA 1Z9QA 3O5ZA 2VWFA 2GNCA 4CC2A 1RLQC 3EGUA 1WA7A 2RN8A 2W10A 2ROTA 2FO0A 4RTXA 2PZ1A 2YSQA 1QLYA 2DA9A 4J9CA 5FWBA 3EHQA 2RNAA 1UDLA 3M0QA 2QDLA 5IH2A 4A63B 1H3HA 2KROA 2AZSA 2I0NA 2A08A 3M0RA 4JZ4A 3VS2A 2EYYA 1U3OA 2KRSA 4LNPA 2NWMA 4ORZA
chains in the Genus database with same CATH superfamily
1Q82U 1VQNT 4GLMA 3CC2A 1PKSA 1P92A 4RTTA 1U06A 1PC0A 3ZFJA 2FG0A 1FXXA 4JS5A 2QGFB 1H3ZA 4QVDA 1AWWA 5FU6B 2L0AA 1W4SA 2CSIA 1D3BA 2DLPA 1ZUYA 3HRSA 4F7UA 1EX4A 2RHYA 1K73R 2JT4A 4OMLA 1G5VA 2EWNA 2JS0A 5LJ5e 1M3CA 2CUBA 2L2PA 4GLKA 2DNUA 2DTOA 3C94A 2EPDA 3PT9A 1MV3A 3M0PA 1UECA 1OPLA 2DILA 4J8OA 4FM4B 3OW2P 1KSWA 3RMSA 2YUOA 4V2SA 3CPWA 1GBRA 3MKDA 2YRDA 3A1PA 2FHDA 4J9DA 4X9DA 3VYHB 3L2UA 3CCLT 1HSQA 1VQOQ 2YHTA 4Y92A 3UDCA 1WIEA 5DLOA 5GAN2 2DYIA 3OYYA 5D7UA 2COYA 3LH0A 2QA4Q 1G8XA 4PK4A 2WSFE 2GBQA 1B3QA 2CT4A 5FU6C 3CXCP 3CCMT 8AT1B 5KYUB 3HRTA 4C92G 4X34A 4FYXB 1QVGS 3QZ9B 4IIMA 5A0LA 3UA6A 2EGAA 3M56A 1M1FA 4JJDA 2HKNA 4DOWA 2DVJA 1BI3A 2XHCA 1AZGB 3CC4Q 1AWJA 2CT3A 1UTIA 2DXBA 5FW9A 1BIAA 1KK7A 4AG1C 2F2VA 5I22A 1IZ6A 4J9GA 2MI6A 5KYUA 1GRIA 2DL4A 3VYGA 1YITQ 5GAMj 2XICA 5I2MA 1BI2A 1QVGP 1UJYA 1QP3A 3U23A 1N8RR 2F5KA 4JDSA 4M7DF 2QQBA 1HD3A 2DL3A 2LC4A 3CCJA 1ABOA 2JM8A 1WXUA 4N4HA 5CKBA 5A0DA 3NMZC 3UATA 4KT0E 1IRXA 2HAXA 4KUDK 4BI8B 4OGEA 2Y90A 4E2FB 4IIOA 3REAB 4PNOA 2EFIA 1M30A 5GAMd 3META 4MMLA 1YIJA 4NS5A 2ECZA 1K8AU 2CP5A 1V76A 2E10A 2KDSA 3MCAB 3HL8A 2YWWA 1A0NB 2AK5A 2K3BA 2RQWA 4F7UB 3H9NA 2HL3A 1AZEA 2BZ8A 2A0FB 3VRYA 2RHUA 3VS7A 4M77A 4D6WA 1PKTA 2DBMA 2AIRB 2COZA 2EJFA 2P0QA 1BB9A 1HYOA 2RA2A 2CH4A 3RDVA 2YXYA 3KFVA 4C0DC 1BKBA 1WHHA 1CSKA 1WXTA 4EMKB 3CCLQ 1B34B 5GANh 2GQIA 5KYXA 2A7YA 2YRVA 1SG5A 1WX6A 3JB9H 1LPLA 1UUEA 4RTWA 3E9FA 5KCOA 4BD3A 1N9SA 3ER0A 3LW5E 2COWA 4HT8A 4J7IA 4DQ2A 3IQLA 2OJ2A 1X2QA 4WF2A 3VJPA 2DERA 4C8QD 1PD0A 4J9IA 2CDTA 2ED0A 2CGHA 4CRIA 1TOVA 2X4WA 3CCET 3TCJA 4ME7A 4XU0A 4M7DD 4QQGA 1VQ9T 2DZ9A 1WQ7A 2E6NA 3VS3A 1UGSB 1M90R 2PVOB 3CC4T 1G3WA 3D7SB 1VQLQ 2HD0A 3NTIA 4C0ZA 2RH2A 1WQWA 1QVPA 2M9UA 3OYKA 1B34A 3OYJA 2E6ZA 1N5ZA 3HHTB 2QQ9A 2LX9A 1NYGA 4JLIA 4ANJA 4KRTA 4DEXA 2LT1A 3FEOA 1PHTA 2KAFA 3OYNA 2CP2A 1NE8A 4JS4A 4YTLA 2HMAA 1S72Q 3JCMg 2K57A 2EJ9A 4M77C 4EDUA 1Q7YC 1NPPA 2IVWA 2RI3A 2LMJA 5KE2A 4PJOE 2VXFA 3S3MA 5CR2A 2DPPB 5FLXE 2FYKA 5J39A 1I1JA 4BY6B 2P4TA 5KE3A 2DVEA 1LNXA 1KQ2A 4XQ3A 4M7AE 1VYUA 3QSUA 3VS1A 3G4ST 1QQJA 3BY7A 3PMIA 4PJOG 3V7CA 1YWOA 1PCXA 1VQ4A 2R5MA 3RUXA 5GMKi 1ABQA 3CCEQ 1SHGA 2DEUA 4K11A 2KR3A 2P0KA 5I11A 2KYBA 2RK2A 3OSVA 1WJRA 5A2QE 1YHQT 2XKOC 3CCVQ 4FSXA 4ZGEB 2H8HA 1RI0A 1VQ4T 2E5KA 1VQOT 1BBZA 1ARKA 4LUDA 1K9MU 1TUCA 4PJNA 4ELYC 1K0SA 2D0NA 4C8QC 1VUBA 3EH2A 2JOYA 1UG1A 3P8BB 3EFOB 3CD6Q 2F69A 1BI1A 1M90C 3DKMA 4A54A 2BIVA 4X1VA 3EG1A 2P84A 2DMOA 2GTOA 3A5ZB 2F2XA 2LQWA 4IURA 1LVKA 4C0GA 1AWXA 1W2BS 5IN1A 4PLLA 4IUQA 2O88A 4PFZA 5LJ3g 3LWIA 3V7RA 1X69A 3A8OB 5CK9A 4M78D 4BE0A 4JJNK 3H0HA 3MHXA 4AMCA 2B86A 3C95A 3OS2A 2LJ0A 2XU8A 4D8KA 4PL6A 1WJQA 3JB9I 2K7AA 2EQKA 3OYMA 3M9QA 5GMKh 1V29B 3JB9F 3EGUA 2MYSA 1WA7A 2W10A 4M78E 1QVGA 2FO0A 4RTXA 2YSQA 3DLLA 2DA9A 4J9CA 4DOVA 5FWBA 3EHQA 2RNAA 4WTOB 1VQKT 4A63B 4OB1B 2AZSA 2A08A 3MEWA 3UPUA 4QVCA 4C0FA 1KQ1A 4LNPA 5GAN7 2M1HA 2K2VA 4LDUA 3GPLA 3SB2A 1M5Q1 2KYMA 2XIDA 4FW1A 3M57A 2DEQA 4M7DB 3BE3A 4ZTFA 2K79A 4OMOA 2DD5A 2DKGA 1D0XA 1Q7YR 2JMCA 3VS5A 3CCUA 3X25B 3OA6A 3MP1A 2RQTA 3M59A 4IUUA 2DIGA 5KYYB 2R57A 4WCIA 3I9QA 4E7KA 2K2MA 1YNZA 4Y28E 3HPWA 2HDAA 3OSSC 1YITA 4KUIA 3OS0A 4PJLA 1M1KR 1YJNT 6AT1B 2LQKA 2RMOA 1H641 2LCSA 1OX8A 3GNGA 3JRZA 4KULA 3CCUQ 4CC7A 2WSEE 2AHJB 3HRUA 4RMOA 3BW1A 3H41A 1VQ6A 1PSFA 4RCBA 4C92C 1YWPA 4VUBA 1FWZA 1PD1A 1W2BP 2E1HA 1VQLT 2QTVA 3EFOA 2E65A 2KXCA 2M0YA 3EG9A 3J81E 1PRLC 1T0JA 4JPBW 2EBPA 4O5VA 2VASA 4J6WA 5GAMh 2QQAA 1H8KA 5GAOp 1NZ9A 4M7AG 4BUGA 3OY9A 3J7AF 1D1AA 3QZ5B 1JBMA 3M5AA 3WVDB 1VQOA 3RKWA 5GANe 2CP0A 4BE2A 2EQJA 2GFUA 4DBHA 3L2WA 4AFUC 3LYIA 2JMAA 1OU9A 5GAOq 1RUWA 5DLQE 5CVIA 1KHIA 1VIEA 2CS7A 4EMKA 1GCQC 3I55A 3ZBDA 2D0QB 4J6XA 3VKIA 1TUGB 4E7HA 4GBQA 1YCSB 2J6KA 3FLGA 1CKBA 1GBQA 5GAOl 5CKFA 2W0ZA 4MZPA 2KBTA 3I56T 1TTHB 4M7DG 1C0MA 1C1AA 3GLXA 3THKA 5CQYA 3CD6A 2M51A 5LJ5h 3EGDA 3CMEA 2F2WA 5KCHA 2LQNA 1UGVA 2SEMA 1ZSGA 3EG0A 3L42A 3SEMA 3R6NA 2BUDA 3CXCA 3VUBA 5LJ3h 2QEXQ 5IXBA 1W1FA 4BACA 3CC2Q 2XDPA 1T0HA 3S3NA 2IIMA 3HFNA 1YJ9T 2AKKA 5L23A 1ZHIA 1XTDA 5IXFA 1VYVA 5GANj 1KC8C 3V8KA 2Z0WA 4E6RA 2NUTA 3TSZA 1BU1A 2DO3A 2JTFA 2JM9A 2A3LA 4LUEA 1YJNA 3FJPA 1TU0B 4JRIA 1YI2Q 4AFQC 3O8VA 1I5LA 5LJ3d 1OOTA 5KYNA 3RBBB 1N6AA 4FCYA 2DK3A 1I07A 1MGQA 2OTLA 1K8AC 2CP3A 2CZ0B 4LDXA 1N8RC 1YIJT 3OB9A 1Y7XA 2X3XD 4LXCA 1Q82R 2OTJT 3JCMc 2NYSA 1VQ6T 3PVLA 2AZVA 3BFMA 3X20B 3I56Q 1WHLA 3JV3A 2YUQA 3OS5A 1D0YA 2ZPFB 2DBKA 2PNIA 5IAYA 2RD1A 2MOXA 2YLCA 4M77F 4FW2A 2RQVA 3M53A 1UGRB 5EC7A 1R8OB 2MWOA 2EYXA 2G6FX 3UF4A 2FZGB 4FT2A 5GAN4 1Q81C 1NBEB 4XU3A 1VQ5Q 4N4GA 2E64A 2RHIA 3OYGA 1CKAA 2EGCA 2DTIA 4BDYA 1U1TA 4EPCA 3H8ZA 4M7DE 3C12A 1N8RU 2JTEA 1DJ7B 3CXCS 5GANg 3SWNC 4QQ6A 3PTAA 3FIFA 2DL5A 1KC8R 3RERA 2QXFA 1NYFA 1XJWB 4AFZC 1YITT 2X35A 2KXDA 1PWTA 3S3OA 2C0OA 4PJOA 3G7ZA 1I0CA 5GAMg 1X01A 2LT4A 1M4ZA 4C8QG 1OYXA 3VUZA 3CPWS 1LJOA 1N9RA 3TSWA 2L3RA 2RK1A 1VQMA 2MAMA 1W6XA 3JB9D 3G4SQ 2KNBB 4FYWB 2RO0A 2RJEA 1BCMA 4Z8AA 4C5IA 1W70A 3R6OA 4F04B 3H0IA 3OYEA 2QTXA 1I5OB 2GQVA 3X28B 4J83A 4M77E 1SRLA 1GCPA 3S6WA 2CZ1B 3A8LB 2G3RA 3MEUA 4XTWA 3INZA 4RG2A 2LCCA 2JXBA 3FDRA 5I2SA 3CCMQ 2JVVA 1RADB 2VUBA 3FRNA 5CKEA 3QKJA 3HSBA 2M02A 3CCRT 4PJJA 5KYWB 4Y91A 3I35A 4M7AC 2GFAA 2L3QA 2PQWA 4OMQA 4E7SA 4A53A 5HK3A 2BZXA 1SF9A 1K9AA 3ZEHA 1UHCA 2LZ6B 1EIFA 2JJ9A 3OYLA 1YI2T 3M0UA 3OBYA 3EFRA 3GIBA 3A8MB 3VS4A 2EW3A 4B9XA 4KH1B 2FPDA 2RPNA 5FU7B 2L5QA 5FU7C 4Z89A 1IREB 1R77A 1PG5B 2K3XA 3H6ZA 1PNJA 2AKLA 1M8VA 3PE0A 1M90U 1KD1U 2VVKA 1YJ9A 2DXTA 1YJWA 2CP6A 3PGGA 2FRYA 1E6HA 1V1CA 2K5LA 2VXEA 2LTOA 1AHJB 3EHRA 2EYQA 3NPFA 4ZGDB 1TH7A 4NOYA 2FPEA 2DXCA 2FVUA 3OW2S 2VYTA 3CC7T 3ME9A 1WHMA 4CC4B 5KYYA 2QA4T 2EVRA 3DB3A 5GMKl 3CC4A 4JZ3A 1LOJA 1JJ2P 3RKXA 4M78A 1D3BB 3O5ZA 4OMFB 2E5QA 4KH0B 2PU9B 4M7DA 3CMAT 4CC2A 3J80E 2RN8A 3V8LA 4C8QA 1VQNQ 1QLYA 1QMCA 1BI0A 1EZZB 1Q86U 1UDLA 3V7SA 2HKQB 5IH2A 1VQ7T 4LD9K 3HP9A 3M0RA 4LDVA 3OYAA 4LDWA 4JRKA 5KH6A 2KRSA 1D1CA 5FRMA 4ORZA 1BCOA 2MMPA 4FU6A 2YRCA 5GMKm 1QKXA 4C0DB 4C5HA 1RAHB 4AFSC 1JEGA 2AT1B 3QUIA 2GGRA 4C92A 1NPRA 4DBFA 2ZPBB 2KT8A 5GAN5 3CCQT 4QKUA 2KT1A 2YT6A 4L5GA 2HBPA 3JCMh 2ZZDA 1WJSA 2DETA 2CREA 1QKWA 3URGA 2DL8A 1QW1A 5IHKA 2KEAA 3EGXB 2ZPGB 1JJ2A 4J9HA 2EGEA 2O31A 3LX7A 3FB9A 1YJWQ 1WXBA 3M58A 1B07A 2X51A 3OYBA 3CCVT 1ZUUA 4D8DA 1RAIB 1MNEA 4MDXA 2V8IA 4AG2C 1KD1R 3QBYA 1ZBXA 3PIOA 2FB7A 1Y0MA 3PFSA 1M3AA 4B9WA 4OP0A 2QDYB 4M7AD 2K5FA 4A4KA 3M0TA 3X24B 2DL7A 2QQRA 4OF1A 4M75C 4J9BA 3G6ET 3WVEB 2EIFA 1XNIA 3VS6A 2I2LA 3VS0A 9ATCB 1D1BA 1SRMA 2VV5A 5C0MA 2O9SA 4PJOD 2NUPB 3N5BB 4GY5A 1ZSZA 3EG9B 2E41A 3E19A 1X75C 5IHIA 1G83A 5LL6S 1E7OA 1Y57A 1YJWT 3I5SA 3JCMV 4FIBA 2HQEA 1J3TA 2F5TX 4M75A 4F7UG 4XAXB 4C92E 1JXOA 1SPKA 4F7UE 2KGTA 1Q86R 5GJVB 2ZPIB 1SKUB 3CCQA 4ATOA 4TVRA 2O01E 4J6YA 4M77D 3V8JA 1IXDA 2V8KA 4OB2B 3PVQA 1KQSP 4EIKA 1NEBA 1VQ9Q 5LJ3j 1FMWA 4OVAA 4DA4A 2KSSA 3I5RA 1U5SA 2MIOA 1VQMQ 1ZQ1A 2LRQA 1F1BB 3ASKA 2HEQA 2BE9B 4XU1A 3MP6A 2OTJQ 2KRMA 2GF7A 1RI9A 1TUDA 1SHFA 4RUGA 1GFDA 2DJZA 1W2BA 1Q82C 5CQXA 3P8DA 2E70A 2RHZA 1AWOA 2MCNA 3QXEB 1B7TA 4FT4A 2QK0A 2HL5C 4OB0B 3VRZA 4NL3A 2FL7A 2P0PA 1IGQA 1O75A 4OMPA 4ESRA 3SD4A 5GAN8 1KD1C 3QJYA 2XDBA 4HKEA 3NTHA 1Q81U 5HKCA 3JCMJ 5J3BA 2Y4XA 2ZAEA 3EH1A 1FMKA 2DJQA 1R0CB 3NTKA 1WYXA 1KQSA 3CC7A 2BZYA 3NFCA 5C6SA 3CBPA 3QPHA 3GOXA 5CKDA 1NEGA 1QWEA 3CPFA 1WHGA 2VB6A 3UA7A 1M1KC 1X43A 2EKOA 3CCSA 1IO6A 2QGGA 4E47A 4F7UF 4E7ZA 1UGPB 1Q86C 1Q81R 5LJ5g 1KHCA 5LJ5f 3OYHA 4ZTJA 3CBOA 2X4YA 2CP7A 3BDUA 4QQDA 2R5AA 3A8HB 1OU8A 1VQ8Q 1WNLA 5CIUA 2DE0X 1TSFA 2FRWA 1OZ2A 4M75D 1VIFA 1VQNA 5GJWB 4PJOC 1JRIA 1S72A 4P5NA 3TEEA 4LE9A 3JSCA 2YUPA 4OMNA 4F17A 2DYBA 4XU2A 1K9MR 1I81A 2XI9A 3A98A 1TXQA 4IUTA 1NLOC 1C6VX 3REBB 3NHNA 4CI0C 2DFUA 2OTJA 2JUFA 1D09B 2ZPHB 2D1XA 2OTLT 3QDFA 1YJ9Q 7AT1B 1Y07A 4EMGA 1BYMA 2E4HA 2B8AA 1O9SA 1RABB 1ZLMA 2K9GA 1VQPT 2QEXA 4PKCC 2LP5A 2X9HA 2EJGA 4NL2A 1VQMT 2LVMA 2L3PA 3SWNB 4HVVA 1K8AR 1Y96B 2V1QA 2VGNA 1K4US 1AOJA 3MO8A 4X9CA 3OBWA 3OW2A 2ENMA 1JU5C 5CO7A 4L59A 2DXUA 2J06A 1MMDA 5GAN6 1M2VB 5HCKA 3GF5A 2A37A 2XMFA 4M7DC 2MPXC 3CBMA 5KYWA 1X6OA 3CMAQ 2RI2A 3WXMB 1UGQB 1PRMC 3EAEA 2J6FA 1Z9ZA 1IHWA 1K1ZA 3CCLA 2BE7D 1BK2A 1QVFA 2JW4A 2ESWA 5GMKe 3ZL7C 2JZ2A 1HXDA 2KVQG 4J9EA 1PM3A 3CPWP 3CD6T 2JTMA 2OAUA 2RJDA 3QG1A 4R0KA 3CCJQ 5I21A 2H3EB 3H0FA 3SWNA 1UHFA 3G4SA 2RJFA 4J5YA 2LJ1A 2GTJA 3JB9G 3QO3A 4QVZA 2LJ3A 2M0OA 2VC8A 2CKKA 2QYZA 2K4YA 3F70A 2RHXA 4XTYA 1K73U 4HA8A 4HCBA 4M78C 2OI3A 2HQXA 1WI7A 2XK0A 2YUNA 4MMKA 1VQPQ 1ZX6A 1U8RA 1YIJQ 2RJCA 2KK4A 1MV0B 4J7FA 4A4HA 2A36A 4JUVA 4J9FA 1OV3A 2JN0A 2R58A 3KBGA 2HSEB 1GXIE 1VQ7A 1Y96A 4FYVB 2O4XA 1S1NA 1OZ3A 3GNFB 1YP5A 3RKYA 1UE9A 4XTVA 1M1KU 4EMKC 3JB9J 5GANf 3HTRA 5LJ3e 1AEYA 3CCST 1N27A 2FPFA 1QVFP 3JCMd 4MZTA 4R55A 4PLIA 2DD4A 2EKHA 4ZNXA 4PJOF 5FROA 1MMAA 2QA4A 1NJIC 5M9OA 1VQ8A 2ABLA 1VQ5A 4MZMA 2IPOB 4RTZA 1XOVA 3G71A 4C5GA 4II1A 1QCFA 1RLPC 1KJWA 1K73C 1QP2A 1NG2A 2NUPA 2VGMA 4KGVB 2DF6A 3CCRQ 4JRQA 2O9VA 2QEXT 2LX7A 2O4XB 2DX1A 5DY9A 2ATCB 1M2OA 1Z9QA 1M1GA 2VWFA 2GNCA 3KUFA 5GAN3 3X26B 2D6FA 2V8JA 3T9NA 4OGCA 2ROTA 3I56A 3QYHB 2PZ1A 1YFNA 2X4XA 1WZOA 3M0QA 1H3HA 3OQ5A 4PFPA 3JCMX 3AHUA 1IB8A 5AYFA 3SHWA 4BI4A 4IKFA 1MNDA 1IHVA 2OTLQ 2A28A 2XDDA 1YHQA 1GL5A 2ROLA 2EYZA 3TVTA 2RF0A 1RAAB 2XD0A 3OMCA 3OMGA 2RQUA 4E7JA 2QASA 1OX9A 2QG9B 3JCMe 1I8FA 1H92A 3M55A 3LWHA 2LDMA 2CH4W 4ZGJB 4N0AA 1MHNA 1S72T 4N0AC 3C0CA 2K5IA 4XTZA 1HJDA 2DRMA 4M4ZA 4LD6A 2YLBA 2HCKA 3PNWC 4KGXB 3G6EA 2ZPEB 3M4YA 1FYNA 3RMQA 5D6XA 4AT1B 1VQ5T 2HQHA 3CMEQ 4BI3A 1MMNA 5GAOn 1QVFS 2OX7A 1YHQQ 3EGDB 2F1LA 1X27A 4M78F 4M78B 2X4JA 2JNGA 1M3BA 2ZGWA 2RI5A 3JCMf 2ZCFB 1WLPB 5FRNA 1G2BA 4M77G 1OULA 2KRNA 3CCVA 1MMGA 5GAOr 1WHJA 5GANd 3I55Q 3A8GB 3FJ5A 5CKHA 2J05A 3TU4K 2V26A 1RACB 4DBRA 2FZCB 3SFMA 1M27C 1VQ4Q 3PIPA 2OAWA 3NGPA 2ED1A 3LH5A 2WACA 4Z02A 3CCRA 3QWYA 3M0SA 2PTKA 3GP8A 3QYGB 3JAME 1MUZA 2WSCE 2RQRA 4DEYA 3TQ7P 3G71Q 4HCCA 1NJIR 2KY9A 4JRPA 4MDWA 3L2VA 4IUPA 2QQSA 4JJBA 3MJXA 3MEAA 4RTVA 1RL2A 1ZSZB 1ZUKA 4M75F 3OS1A 5CCAA 3EGXA 5HY6A 2IG0A 1VQKQ 1VYTA 1E6GA 1WPYA 4OMMA 4CC3A 4ZN1A 1WHKA 3MEVA 1UJ0A 1YN8A 2LCLA 1M2VA 2KI7A 4HCKA 3QWXX 1RAEB 2H3JA 3SDZA 1JJ2S 1UFFA 4Z88A 1VQ7Q 2CUDA 4JJCA 4C5EA 4RTYA 5AT1B 1RAGB 1GCQA 2K6DA 2HZYA 1AT1B 3JCMP 2D8HA 4A4EA 4F16A 4KGZB 4M7AA 1G3TA 1SSHA 1QCNA 2DRKA 1VQLA 3MPUB 3UT1A 2VKNA 2CYZB 4N4IA 5FWCA 2P4RA 3RIRA 3FC3A 4BE1A 3OYIA 2M16A 4KBMB 4PJOB 4QW2A 1K9MC 3CQTA 3G1JA 4M7AF 1M8MA 2C0TA 4M75G 3DLMA 3M4GA 3E1SA 1ZBJA 1TS9A 3L2RA 4DBQA 1KFZA 1KIKA 1GFCA 3M54A 4M78G 1YI2A 2NUTB 4OB3B 3CCJT 4BY6C 2EAYA 2E3HA 2EYWA 1VQPA 2Y4YA 1BIBA 2RB6A 1SSFA 2CSQA 2E12A 3C4SA 1ZA1B 4HXJA 2NLUA 4C8QB 4C92F 1Y71A 1AVZC 1WDXA 2L8DA 2LNHB 3E9GA 1X2KA 2D9TA 2C0IA 5GMKj 4E7LA 3BDLA 1R0BG 4L6V5 5EG2A 3JCMQ 2DTHA 3CEYA 3L2QA 2BKDN 2E3IA 4QT7A 4HVUA 4M75B 2DIQA 5HK0A 4BDZA 1G3SA 2K3YA 1Q7YU 2HBWA 4RCCA 1PSEA 1JO8A 2PUKB 4LN2A 4Q5WA 2LQ8A 5LJ5d 4A4GA 2SRCA 3RESA 1Q95G 1T3LA 3CMAA 1NM7A 2L89A 3QIIA 3CCMA 2KMTA 4M7AB 2V1RA 4RG8A 1QWFA 1FMVA 2EQUA 4IUVA 1VQ8T 5IHNA 1YCYA 2JS2A 4BB7A 5GAOm 5J26A 5CAIA 2BTTA 2DAQA 4UC4A 1JB0E 2CZ7B 4C92D 1IGUA 1FX7A 3UWNA 2LNVA 1X6BA 2PVGB 3ULRB 1KQSS 2D8JA 1X6GA 2RM4A 2HSPA 2FEIA 2DZCA 2PUOB 1EFNA 2QI2A 4RTUA 2L3SA 1KC8U 5DM7R 5L8RE 3JCMW 1NLPC 3L1AA 4B6MA 1UEBA 2MK5A 1D0ZA 5LJ3f 3OYDA 1OEBA 4ZN3A 1HK9A 3CCEA 4F14A 2EQMA 3CC2T 1ZA2B 2MF2A 3CCSQ 1WGSA 3TREA 2EQIA 4C8QE 3JCMb 2YDLA 8ATCB 3QJ6A 4XK8E 4PFOA 2PVDB 3I55T 1TG0A 5KYXB 1VQ6Q 1AD5A 3AT1B 4FSSA 1T3SA 1XQHA 3RNJA 5IT9E 4HCZA 4PJMA 1M9SA 3P8HA 1OPKA 2KQWA 1K76A 1OQKA 4EMHA 4R56A 3VV0A 4FYYB 1ZSZC 2KE9A 4M77B 3VU3C 1LCKA 1SEMA 2DM1A 1OI1A 3G71T 1K0XA 1UB4A 5GAMf 2O2OA 4XTXA 3EG2A 2NUZA 1VA7A 4HT9A 3HKSA 1KG1A 1U3OA 3QDRB 2MWPA 2QAZA 4XTUA 2FZKB 2X3WD 2J7IA 3Q1JA 4HVWA 5D6WA 3CC7Q 1VQKA 4RKUE 1WFWA 3GBQA 3QHSA 4O6JA 3E2UA 5A0GA 5ECAA 1JQQA 3EG3A 3LGFA 1RAFB 1U1SA 3PMTA 1VQ9A 1JXMA 2C06A 1QCOA 5LJ5j 3CCQQ 1TWBA 2HNIA 2J6OA 5D6YA 3DB4A 4ELZC 3EFSA 3KXTA 3L2ZA 3G6EQ 3CMET 1RLQC 1ACMB 3RR6A 5GAMe 2XG8D 3LGLA 4C92B 4C8QF 1YJNQ 3LLRA 3OYCA 1G3YA 2GCXA 1NJIU 4LDYA 1VOMA 4E7IA 4FL6A 3CCUT 2QDLA 4M75E 2KROA 1I4K1 2I0NA 3MP8A 4JZ4A 3VS2A 1YBYA 3HFOA 2EYYA 4A4FA 4JLGA 2CZ6B 3OYFA 2NWMA
chains in the Genus database with same CATH topology
4GLMA 1PKSA 1QKXA 2KYMA 2A28A 4RTTA 4AFSC 1GL5A 1U06A 1JEGA 2FG0A 2ROLA 2EYZA 3TVTA 2RF0A 2GGRA 2K79A 4OMOA 2KT8A 2JMCA 1AWWA 2KT1A 2YT6A 3VS5A 2RQUA 2L0AA 2RQTA 2CREA 2CSIA 2DLPA 1ZUYA 4WCIA 1QKWA 3I9QA 1H92A 2DL8A 2K2MA 1YNZA 5IHKA 2CH4W 2KEAA 2HDAA 2JT4A 4OMLA 4J9HA 2EGEA 2JS0A 2O31A 3C0CA 1M3CA 2CUBA 2L2PA 1WXBA 2DNUA 1HJDA 2DRMA 4M4ZA 2RMOA 1B07A 2LCSA 2EPDA 1MV3A 3M0PA 4CC7A 2HCKA 1ZUUA 4D8DA 1UECA 1OPLA 2DILA 4AG2C 3H41A 1FYNA 1KSWA 2YUOA 1Y0MA 1GBRA 1M3AA 1YWPA 4J9DA 1HSQA 3M0TA 1X27A 2DL7A 4Y92A 1WIEA 4J9BA 3VS6A 2KXCA 1M3BA 3VS0A 2M0YA 1SRMA 2O9SA 1WLPB 1G2BA 1PRLC 2KRNA 1T0JA 4JPBW 2EBPA 1G83A 5IHIA 1E7OA 1Y57A 3I5SA 2GBQA 1H8KA 1B3QA 2CT4A 3FJ5A 1J3TA 2J05A 4IIMA 1JXOA 1SPKA 3UA6A 2EGAA 2KGTA 4JJDA 5GJVB 1M27C 2OAWA 3NGPA 2DVJA 2ED1A 3LH5A 1AZGB 3QWYA 1AWJA 3M0SA 2PTKA 2CT3A 3PVQA 4AFUC 2JMAA 1UTIA 4EIKA 1RUWA 1NEBA 5FW9A 1MUZA 4DEYA 2RQRA 4AG1C 2F2VA 5I22A 3I5RA 4J9GA 1GCQC 1U5SA 1GRIA 2DL4A 2MIOA 4JJBA 4RTVA 1ZUKA 2HEQA 1YCSB 2J6KA 4GBQA 1CKBA 1GBQA 2KRMA 1RI9A 1TUDA 2W0ZA 1SHFA 4RUGA 1GFDA 1VYTA 1E6GA 1UJYA 2KBTA 3U23A 4OMMA 4CC3A 1HD3A 1UJ0A 1YN8A 1AWOA 3THKA 2MCNA 2DL3A 2M51A 1ABOA 2JM8A 1WXUA 4HCKA 2F2WA 3QWXX 2LQNA 1UFFA 3NMZC 1UGVA 4Z88A 3VRZA 2SEMA 2CUDA 4JJCA 1ZSGA 4RTYA 3EG0A 3UATA 1GCQA 2K6DA 3SEMA 4OMPA 3R6NA 4ESRA 5IXBA 1W1FA 2D8HA 1T0HA 4F16A 4IIOA 1SSHA 3REAB 1M30A 2DRKA 2IIMA 2AKKA 5L23A 2ECZA 5IXFA 1VYVA 2VKNA 1FMKA 2DJQA 4E6RA 3TSZA 1BU1A 1WYXA 2JM9A 2BZYA 4LUEA 1A0NB 5FWCA 2AK5A 1NEGA 2K3BA 2P4RA 2RQWA 4AFQC 1QWEA 3UA7A 1X43A 1OOTA 1AZEA 2BZ8A 1IO6A 3CQTA 3VRYA 1M8MA 2C0TA 3RBBB 3VS7A 1ZBJA 1PKTA 2DBMA 1I07A 1BB9A 1KFZA 1KIKA 1GFCA 2CH4A 3SHWA 3KFVA 2EYWA 1CSKA 2X3XD 2CSQA 1WXTA 3PVLA 2DE0X 4HXJA 2FRWA 2GQIA 2AZVA 5GJWB 3JV3A 2YUQA 1AVZC 1WX6A 1WDXA 1UUEA 4RTWA 2DBKA 2PNIA 2MOXA 2LNHB 2RQVA 1X2KA 2C0IA 5EC7A 4LE9A 3IQLA 2OJ2A 2YUPA 1X2QA 2EYXA 4OMNA 4F17A 2DYBA 2G6FX 4QT7A 4J9IA 2CDTA 2ED0A 3A98A 4HVUA 3UF4A 1NLOC 2HBWA 1JO8A 4LN2A 3REBB 3VS3A 3NHNA 1CKAA 2SRCA 2EGCA 2D1XA 1T3LA 1NM7A 1N5ZA 2V1RA 1QWFA 2JTEA 1ZLMA 1NYGA 2K9GA 2LP5A 5IHNA 2JS2A 4KRTA 2DL5A 2L3PA 4DEXA 2BTTA 1PHTA 1NYFA 4HVVA 2V1QA 4AFZC 2KXDA 1K4US 1PWTA 1X6BA 1AOJA 3ULRB 2C0OA 1JU5C 2ENMA 1I0CA 2J06A 2D8JA 1X6GA 2HSPA 2FEIA 5HCKA 2A37A 2XMFA 2LMJA 1PRMC 1EFNA 2J6FA 1Z9ZA 4RTUA 2L3SA 3TSWA 1K1ZA 1NLPC 1I1JA 1BK2A 1W6XA 2JW4A 2ESWA 1OEBA 3ZL7C 2KNBB 4J9EA 4F14A 1VYUA 4Z8AA 3VS1A 1W70A 4R0KA 3H0IA 3H0FA 2EQIA 1YWOA 1SRLA 1UHFA 1GCPA 2YDLA 1ABQA 1SHGA 1TG0A 2LJ1A 2GTJA 1AD5A 4FSSA 1T3SA 3RNJA 2JXBA 4K11A 2KR3A 2LJ3A 5I11A 2KYBA 1OPKA 2OI3A 1K76A 1WI7A 2H8HA 2YUNA 3I35A 2E5KA 2L3QA 4OMQA 1ZX6A 1BBZA 1ARKA 4LUDA 2BZXA 1MV0B 1TUCA 2A36A 2KE9A 4J9FA 1OV3A 1K0SA 2D0NA 1K9AA 1LCKA 1SEMA 1UHCA 2LZ6B 2DM1A 1S1NA 1K0XA 1UG1A 3M0UA 1YP5A 1UE9A 2EW3A 3VS4A 2O2OA 2FPDA 3EG2A 2RPNA 2NUZA 1VA7A 4X1VA 1AEYA 2FPFA 3EG1A 2DMOA 2GTOA 4Z89A 2F2XA 2LQWA 1PNJA 2AKLA 2X3WD 3PE0A 2J7IA 1AWXA 2VVKA 2EKHA 4HVWA 4ZNXA 2O88A 2FRYA 1E6HA 1V1CA 1WFWA 3GBQA 1X69A 3EHRA 2ABLA 5ECAA 1JQQA 3EG3A 3NPFA 4RTZA 2FPEA 1XOVA 3H0HA 1QCFA 1RLPC 1KJWA 2B86A 1JXMA 2LJ0A 1NG2A 4CC4B 4D8KA 2EVRA 2DF6A 2O9VA 4JZ3A 2J6OA 2LX7A 2DX1A 2K7AA 1Z9QA 3O5ZA 2VWFA 2GNCA 4CC2A 1RLQC 3EGUA 1WA7A 2RN8A 2W10A 2ROTA 2FO0A 4RTXA 2PZ1A 2YSQA 1QLYA 2DA9A 4J9CA 5FWBA 3EHQA 2RNAA 1UDLA 3M0QA 2QDLA 5IH2A 4A63B 1H3HA 2KROA 2AZSA 2I0NA 2A08A 3M0RA 4JZ4A 3VS2A 2EYYA 1U3OA 2KRSA 4LNPA 2NWMA 4ORZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLM A;  1PKS A;  1QKX A;  2KYM A;  2A28 A;  4RTT A;  4AFS C;  1GL5 A;  1U06 A;  1JEG A;  2FG0 A;  2ROL A;  2EYZ A;  3TVT A;  2RF0 A;  2GGR A;  2K79 A;  4OMO A;  2KT8 A;  2JMC A;  1AWW A;  2KT1 A;  2YT6 A;  3VS5 A;  2RQU A;  2L0A A;  2RQT A;  2CRE A;  2CSI A;  2DLP A;  1ZUY A;  4WCI A;  1QKW A;  3I9Q A;  1H92 A;  2DL8 A;  2K2M A;  1YNZ A;  5IHK A;  2CH4 W;  2KEA A;  2HDA A;  2JT4 A;  4OML A;  4J9H A;  2EGE A;  2JS0 A;  2O31 A;  3C0C A;  1M3C A;  2CUB A;  2L2P A;  1WXB A;  2DNU A;  1HJD A;  2DRM A;  4M4Z A;  2RMO A;  1B07 A;  2LCS A;  2EPD A;  1MV3 A;  3M0P A;  4CC7 A;  2HCK A;  1ZUU A;  4D8D A;  1UEC A;  1OPL A;  2DIL A;  4AG2 C;  3H41 A;  1FYN A;  1KSW A;  2YUO A;  1Y0M A;  1GBR A;  1M3A A;  1YWP A;  4J9D A;  1HSQ A;  3M0T A;  1X27 A;  2DL7 A;  4Y92 A;  1WIE A;  4J9B A;  3VS6 A;  2KXC A;  1M3B A;  3VS0 A;  2M0Y A;  1SRM A;  2O9S A;  1WLP B;  1G2B A;  1PRL C;  2KRN A;  1T0J A;  4JPB W;  2EBP A;  1G83 A;  5IHI A;  1E7O A;  1Y57 A;  3I5S A;  2GBQ A;  1H8K A;  1B3Q A;  2CT4 A;  3FJ5 A;  1J3T A;  2J05 A;  4IIM A;  1JXO A;  1SPK A;  3UA6 A;  2EGA A;  2KGT A;  4JJD A;  5GJV B;  1M27 C;  2OAW A;  3NGP A;  2DVJ A;  2ED1 A;  3LH5 A;  1AZG B;  3QWY A;  1AWJ A;  3M0S A;  2PTK A;  2CT3 A;  3PVQ A;  4AFU C;  2JMA A;  1UTI A;  4EIK A;  1RUW A;  1NEB A;  5FW9 A;  1MUZ A;  4DEY A;  2RQR A;  4AG1 C;  2F2V A;  5I22 A;  3I5R A;  4J9G A;  1GCQ C;  1U5S A;  1GRI A;  2DL4 A;  2MIO A;  4JJB A;  4RTV A;  1ZUK A;  2HEQ A;  1YCS B;  2J6K A;  4GBQ A;  1CKB A;  1GBQ A;  2KRM A;  1RI9 A;  1TUD A;  2W0Z A;  1SHF A;  4RUG A;  1GFD A;  1VYT A;  1E6G A;  1UJY A;  2KBT A;  3U23 A;  4OMM A;  4CC3 A;  1HD3 A;  1UJ0 A;  1YN8 A;  1AWO A;  3THK A;  2MCN A;  2DL3 A;  2M51 A;  1ABO A;  2JM8 A;  1WXU A;  4HCK A;  2F2W A;  3QWX X;  2LQN A;  1UFF A;  3NMZ C;  1UGV A;  4Z88 A;  3VRZ A;  2SEM A;  2CUD A;  4JJC A;  1ZSG A;  4RTY A;  3EG0 A;  3UAT A;  1GCQ A;  2K6D A;  3SEM A;  4OMP A;  3R6N A;  4ESR A;  5IXB A;  1W1F A;  2D8H A;  1T0H A;  4F16 A;  4IIO A;  1SSH A;  3REA B;  1M30 A;  2DRK A;  2IIM A;  2AKK A;  5L23 A;  2ECZ A;  5IXF A;  1VYV A;  2VKN A;  1FMK A;  2DJQ A;  4E6R A;  3TSZ A;  1BU1 A;  1WYX A;  2JM9 A;  2BZY A;  4LUE A;  1A0N B;  5FWC A;  2AK5 A;  1NEG A;  2K3B A;  2P4R A;  2RQW A;  4AFQ C;  1QWE A;  3UA7 A;  1X43 A;  1OOT A;  1AZE A;  2BZ8 A;  1IO6 A;  3CQT A;  3VRY A;  1M8M A;  2C0T A;  3RBB B;  3VS7 A;  1ZBJ A;  1PKT A;  2DBM A;  1I07 A;  1BB9 A;  1KFZ A;  1KIK A;  1GFC A;  2CH4 A;  3SHW A;  3KFV A;  2EYW A;  1CSK A;  2X3X D;  2CSQ A;  1WXT A;  3PVL A;  2DE0 X;  4HXJ A;  2FRW A;  2GQI A;  2AZV A;  5GJW B;  3JV3 A;  2YUQ A;  1AVZ C;  1WX6 A;  1WDX A;  1UUE A;  4RTW A;  2DBK A;  2PNI A;  2MOX A;  2LNH B;  2RQV A;  1X2K A;  2C0I A;  5EC7 A;  4LE9 A;  3IQL A;  2OJ2 A;  2YUP A;  1X2Q A;  2EYX A;  4OMN A;  4F17 A;  2DYB A;  2G6F X;  4QT7 A;  4J9I A;  2CDT A;  2ED0 A;  3A98 A;  4HVU A;  3UF4 A;  1NLO C;  2HBW A;  1JO8 A;  4LN2 A;  3REB B;  3VS3 A;  3NHN A;  1CKA A;  2SRC A;  2EGC A;  2D1X A;  1T3L A;  1NM7 A;  1N5Z A;  2V1R A;  1QWF A;  2JTE A;  1ZLM A;  1NYG A;  2K9G A;  2LP5 A;  5IHN A;  2JS2 A;  4KRT A;  2DL5 A;  2L3P A;  4DEX A;  2BTT A;  1PHT A;  1NYF A;  4HVV A;  2V1Q A;  4AFZ C;  2KXD A;  1K4U S;  1PWT A;  1X6B A;  1AOJ A;  3ULR B;  2C0O A;  1JU5 C;  2ENM A;  1I0C A;  2J06 A;  2D8J A;  1X6G A;  2HSP A;  2FEI A;  5HCK A;  2A37 A;  2XMF A;  2LMJ A;  1PRM C;  1EFN A;  2J6F A;  1Z9Z A;  4RTU A;  2L3S A;  3TSW A;  1K1Z A;  1NLP C;  1I1J A;  1BK2 A;  1W6X A;  2JW4 A;  2ESW A;  1OEB A;  3ZL7 C;  2KNB B;  4J9E A;  4F14 A;  1VYU A;  4Z8A A;  3VS1 A;  1W70 A;  4R0K A;  3H0I A;  3H0F A;  2EQI A;  1YWO A;  1SRL A;  1UHF A;  1GCP A;  2YDL A;  1ABQ A;  1SHG A;  1TG0 A;  2LJ1 A;  2GTJ A;  1AD5 A;  4FSS A;  1T3S A;  3RNJ A;  2JXB A;  4K11 A;  2KR3 A;  2LJ3 A;  5I11 A;  2KYB A;  1OPK A;  2OI3 A;  1K76 A;  1WI7 A;  2H8H A;  2YUN A;  3I35 A;  2E5K A;  2L3Q A;  4OMQ A;  1ZX6 A;  1BBZ A;  1ARK A;  4LUD A;  2BZX A;  1MV0 B;  1TUC A;  2A36 A;  2KE9 A;  4J9F A;  1OV3 A;  1K0S A;  2D0N A;  1K9A A;  1LCK A;  1SEM A;  1UHC A;  2LZ6 B;  2DM1 A;  1S1N A;  1K0X A;  1UG1 A;  3M0U A;  1YP5 A;  1UE9 A;  2EW3 A;  3VS4 A;  2O2O A;  2FPD A;  3EG2 A;  2RPN A;  2NUZ A;  1VA7 A;  4X1V A;  1AEY A;  2FPF A;  3EG1 A;  2DMO A;  2GTO A;  4Z89 A;  2F2X A;  2LQW A;  1PNJ A;  2AKL A;  2X3W D;  3PE0 A;  2J7I A;  1AWX A;  2VVK A;  2EKH A;  4HVW A;  4ZNX A;  2O88 A;  2FRY A;  1E6H A;  1V1C A;  1WFW A;  3GBQ A;  1X69 A;  3EHR A;  2ABL A;  5ECA A;  1JQQ A;  3EG3 A;  3NPF A;  4RTZ A;  2FPE A;  1XOV A;  3H0H A;  1QCF A;  1RLP C;  1KJW A;  2B86 A;  1JXM A;  2LJ0 A;  1NG2 A;  4CC4 B;  4D8K A;  2EVR A;  2DF6 A;  2O9V A;  4JZ3 A;  2J6O A;  2LX7 A;  2DX1 A;  2K7A A;  1Z9Q A;  3O5Z A;  2VWF A;  2GNC A;  4CC2 A;  1RLQ C;  3EGU A;  1WA7 A;  2RN8 A;  2W10 A;  2ROT A;  2FO0 A;  4RTX A;  2PZ1 A;  2YSQ A;  1QLY A;  2DA9 A;  4J9C A;  5FWB A;  3EHQ A;  2RNA A;  1UDL A;  3M0Q A;  2QDL A;  5IH2 A;  4A63 B;  1H3H A;  2KRO A;  2AZS A;  2I0N A;  2A08 A;  3M0R A;  4JZ4 A;  3VS2 A;  2EYY A;  1U3O A;  2KRS A;  4LNP A;  2NWM A;  4ORZ A; 
#chains in the Genus database with same CATH topology
 1Q82 U;  1VQN T;  4GLM A;  3CC2 A;  1PKS A;  1P92 A;  4RTT A;  1U06 A;  1PC0 A;  3ZFJ A;  2FG0 A;  1FXX A;  4JS5 A;  2QGF B;  1H3Z A;  4QVD A;  1AWW A;  5FU6 B;  2L0A A;  1W4S A;  2CSI A;  1D3B A;  2DLP A;  1ZUY A;  3HRS A;  4F7U A;  1EX4 A;  2RHY A;  1K73 R;  2JT4 A;  4OML A;  1G5V A;  2EWN A;  2JS0 A;  5LJ5 e;  1M3C A;  2CUB A;  2L2P A;  4GLK A;  2DNU A;  2DTO A;  3C94 A;  2EPD A;  3PT9 A;  1MV3 A;  3M0P A;  1UEC A;  1OPL A;  2DIL A;  4J8O A;  4FM4 B;  3OW2 P;  1KSW A;  3RMS A;  2YUO A;  4V2S A;  3CPW A;  1GBR A;  3MKD A;  2YRD A;  3A1P A;  2FHD A;  4J9D A;  4X9D A;  3VYH B;  3L2U A;  3CCL T;  1HSQ A;  1VQO Q;  2YHT A;  4Y92 A;  3UDC A;  1WIE A;  5DLO A;  5GAN 2;  2DYI A;  3OYY A;  5D7U A;  2COY A;  3LH0 A;  2QA4 Q;  1G8X A;  4PK4 A;  2WSF E;  2GBQ A;  1B3Q A;  2CT4 A;  5FU6 C;  3CXC P;  3CCM T;  8AT1 B;  5KYU B;  3HRT A;  4C92 G;  4X34 A;  4FYX B;  1QVG S;  3QZ9 B;  4IIM A;  5A0L A;  3UA6 A;  2EGA A;  3M56 A;  1M1F A;  4JJD A;  2HKN A;  4DOW A;  2DVJ A;  1BI3 A;  2XHC A;  1AZG B;  3CC4 Q;  1AWJ A;  2CT3 A;  1UTI A;  2DXB A;  5FW9 A;  1BIA A;  1KK7 A;  4AG1 C;  2F2V A;  5I22 A;  1IZ6 A;  4J9G A;  2MI6 A;  5KYU A;  1GRI A;  2DL4 A;  3VYG A;  1YIT Q;  5GAM j;  2XIC A;  5I2M A;  1BI2 A;  1QVG P;  1UJY A;  1QP3 A;  3U23 A;  1N8R R;  2F5K A;  4JDS A;  4M7D F;  2QQB A;  1HD3 A;  2DL3 A;  2LC4 A;  3CCJ A;  1ABO A;  2JM8 A;  1WXU A;  4N4H A;  5CKB A;  5A0D A;  3NMZ C;  3UAT A;  4KT0 E;  1IRX A;  2HAX A;  4KUD K;  4BI8 B;  4OGE A;  2Y90 A;  4E2F B;  4IIO A;  3REA B;  4PNO A;  2EFI A;  1M30 A;  5GAM d;  3MET A;  4MML A;  1YIJ A;  4NS5 A;  2ECZ A;  1K8A U;  2CP5 A;  1V76 A;  2E10 A;  2KDS A;  3MCA B;  3HL8 A;  2YWW A;  1A0N B;  2AK5 A;  2K3B A;  2RQW A;  4F7U B;  3H9N A;  2HL3 A;  1AZE A;  2BZ8 A;  2A0F B;  3VRY A;  2RHU A;  3VS7 A;  4M77 A;  4D6W A;  1PKT A;  2DBM A;  2AIR B;  2COZ A;  2EJF A;  2P0Q A;  1BB9 A;  1HYO A;  2RA2 A;  2CH4 A;  3RDV A;  2YXY A;  3KFV A;  4C0D C;  1BKB A;  1WHH A;  1CSK A;  1WXT A;  4EMK B;  3CCL Q;  1B34 B;  5GAN h;  2GQI A;  5KYX A;  2A7Y A;  2YRV A;  1SG5 A;  1WX6 A;  3JB9 H;  1LPL A;  1UUE A;  4RTW A;  3E9F A;  5KCO A;  4BD3 A;  1N9S A;  3ER0 A;  3LW5 E;  2COW A;  4HT8 A;  4J7I A;  4DQ2 A;  3IQL A;  2OJ2 A;  1X2Q A;  4WF2 A;  3VJP A;  2DER A;  4C8Q D;  1PD0 A;  4J9I A;  2CDT A;  2ED0 A;  2CGH A;  4CRI A;  1TOV A;  2X4W A;  3CCE T;  3TCJ A;  4ME7 A;  4XU0 A;  4M7D D;  4QQG A;  1VQ9 T;  2DZ9 A;  1WQ7 A;  2E6N A;  3VS3 A;  1UGS B;  1M90 R;  2PVO B;  3CC4 T;  1G3W A;  3D7S B;  1VQL Q;  2HD0 A;  3NTI A;  4C0Z A;  2RH2 A;  1WQW A;  1QVP A;  2M9U A;  3OYK A;  1B34 A;  3OYJ A;  2E6Z A;  1N5Z A;  3HHT B;  2QQ9 A;  2LX9 A;  1NYG A;  4JLI A;  4ANJ A;  4KRT A;  4DEX A;  2LT1 A;  3FEO A;  1PHT A;  2KAF A;  3OYN A;  2CP2 A;  1NE8 A;  4JS4 A;  4YTL A;  2HMA A;  1S72 Q;  3JCM g;  2K57 A;  2EJ9 A;  4M77 C;  4EDU A;  1Q7Y C;  1NPP A;  2IVW A;  2RI3 A;  2LMJ A;  5KE2 A;  4PJO E;  2VXF A;  3S3M A;  5CR2 A;  2DPP B;  5FLX E;  2FYK A;  5J39 A;  1I1J A;  4BY6 B;  2P4T A;  5KE3 A;  2DVE A;  1LNX A;  1KQ2 A;  4XQ3 A;  4M7A E;  1VYU A;  3QSU A;  3VS1 A;  3G4S T;  1QQJ A;  3BY7 A;  3PMI A;  4PJO G;  3V7C A;  1YWO A;  1PCX A;  1VQ4 A;  2R5M A;  3RUX A;  5GMK i;  1ABQ A;  3CCE Q;  1SHG A;  2DEU A;  4K11 A;  2KR3 A;  2P0K A;  5I11 A;  2KYB A;  2RK2 A;  3OSV A;  1WJR A;  5A2Q E;  1YHQ T;  2XKO C;  3CCV Q;  4FSX A;  4ZGE B;  2H8H A;  1RI0 A;  1VQ4 T;  2E5K A;  1VQO T;  1BBZ A;  1ARK A;  4LUD A;  1K9M U;  1TUC A;  4PJN A;  4ELY C;  1K0S A;  2D0N A;  4C8Q C;  1VUB A;  3EH2 A;  2JOY A;  1UG1 A;  3P8B B;  3EFO B;  3CD6 Q;  2F69 A;  1BI1 A;  1M90 C;  3DKM A;  4A54 A;  2BIV A;  4X1V A;  3EG1 A;  2P84 A;  2DMO A;  2GTO A;  3A5Z B;  2F2X A;  2LQW A;  4IUR A;  1LVK A;  4C0G A;  1AWX A;  1W2B S;  5IN1 A;  4PLL A;  4IUQ A;  2O88 A;  4PFZ A;  5LJ3 g;  3LWI A;  3V7R A;  1X69 A;  3A8O B;  5CK9 A;  4M78 D;  4BE0 A;  4JJN K;  3H0H A;  3MHX A;  4AMC A;  2B86 A;  3C95 A;  3OS2 A;  2LJ0 A;  2XU8 A;  4D8K A;  4PL6 A;  1WJQ A;  3JB9 I;  2K7A A;  2EQK A;  3OYM A;  3M9Q A;  5GMK h;  1V29 B;  3JB9 F;  3EGU A;  2MYS A;  1WA7 A;  2W10 A;  4M78 E;  1QVG A;  2FO0 A;  4RTX A;  2YSQ A;  3DLL A;  2DA9 A;  4J9C A;  4DOV A;  5FWB A;  3EHQ A;  2RNA A;  4WTO B;  1VQK T;  4A63 B;  4OB1 B;  2AZS A;  2A08 A;  3MEW A;  3UPU A;  4QVC A;  4C0F A;  1KQ1 A;  4LNP A;  5GAN 7;  2M1H A;  2K2V A;  4LDU A;  3GPL A;  3SB2 A;  1M5Q 1;  2KYM A;  2XID A;  4FW1 A;  3M57 A;  2DEQ A;  4M7D B;  3BE3 A;  4ZTF A;  2K79 A;  4OMO A;  2DD5 A;  2DKG A;  1D0X A;  1Q7Y R;  2JMC A;  3VS5 A;  3CCU A;  3X25 B;  3OA6 A;  3MP1 A;  2RQT A;  3M59 A;  4IUU A;  2DIG A;  5KYY B;  2R57 A;  4WCI A;  3I9Q A;  4E7K A;  2K2M A;  1YNZ A;  4Y28 E;  3HPW A;  2HDA A;  3OSS C;  1YIT A;  4KUI A;  3OS0 A;  4PJL A;  1M1K R;  1YJN T;  6AT1 B;  2LQK A;  2RMO A;  1H64 1;  2LCS A;  1OX8 A;  3GNG A;  3JRZ A;  4KUL A;  3CCU Q;  4CC7 A;  2WSE E;  2AHJ B;  3HRU A;  4RMO A;  3BW1 A;  3H41 A;  1VQ6 A;  1PSF A;  4RCB A;  4C92 C;  1YWP A;  4VUB A;  1FWZ A;  1PD1 A;  1W2B P;  2E1H A;  1VQL T;  2QTV A;  3EFO A;  2E65 A;  2KXC A;  2M0Y A;  3EG9 A;  3J81 E;  1PRL C;  1T0J A;  4JPB W;  2EBP A;  4O5V A;  2VAS A;  4J6W A;  5GAM h;  2QQA A;  1H8K A;  5GAO p;  1NZ9 A;  4M7A G;  4BUG A;  3OY9 A;  3J7A F;  1D1A A;  3QZ5 B;  1JBM A;  3M5A A;  3WVD B;  1VQO A;  3RKW A;  5GAN e;  2CP0 A;  4BE2 A;  2EQJ A;  2GFU A;  4DBH A;  3L2W A;  4AFU C;  3LYI A;  2JMA A;  1OU9 A;  5GAO q;  1RUW A;  5DLQ E;  5CVI A;  1KHI A;  1VIE A;  2CS7 A;  4EMK A;  1GCQ C;  3I55 A;  3ZBD A;  2D0Q B;  4J6X A;  3VKI A;  1TUG B;  4E7H A;  4GBQ A;  1YCS B;  2J6K A;  3FLG A;  1CKB A;  1GBQ A;  5GAO l;  5CKF A;  2W0Z A;  4MZP A;  2KBT A;  3I56 T;  1TTH B;  4M7D G;  1C0M A;  1C1A A;  3GLX A;  3THK A;  5CQY A;  3CD6 A;  2M51 A;  5LJ5 h;  3EGD A;  3CME A;  2F2W A;  5KCH A;  2LQN A;  1UGV A;  2SEM A;  1ZSG A;  3EG0 A;  3L42 A;  3SEM A;  3R6N A;  2BUD A;  3CXC A;  3VUB A;  5LJ3 h;  2QEX Q;  5IXB A;  1W1F A;  4BAC A;  3CC2 Q;  2XDP A;  1T0H A;  3S3N A;  2IIM A;  3HFN A;  1YJ9 T;  2AKK A;  5L23 A;  1ZHI A;  1XTD A;  5IXF A;  1VYV A;  5GAN j;  1KC8 C;  3V8K A;  2Z0W A;  4E6R A;  2NUT A;  3TSZ A;  1BU1 A;  2DO3 A;  2JTF A;  2JM9 A;  2A3L A;  4LUE A;  1YJN A;  3FJP A;  1TU0 B;  4JRI A;  1YI2 Q;  4AFQ C;  3O8V A;  1I5L A;  5LJ3 d;  1OOT A;  5KYN A;  3RBB B;  1N6A A;  4FCY A;  2DK3 A;  1I07 A;  1MGQ A;  2OTL A;  1K8A C;  2CP3 A;  2CZ0 B;  4LDX A;  1N8R C;  1YIJ T;  3OB9 A;  1Y7X A;  2X3X D;  4LXC A;  1Q82 R;  2OTJ T;  3JCM c;  2NYS A;  1VQ6 T;  3PVL A;  2AZV A;  3BFM A;  3X20 B;  3I56 Q;  1WHL A;  3JV3 A;  2YUQ A;  3OS5 A;  1D0Y A;  2ZPF B;  2DBK A;  2PNI A;  5IAY A;  2RD1 A;  2MOX A;  2YLC A;  4M77 F;  4FW2 A;  2RQV A;  3M53 A;  1UGR B;  5EC7 A;  1R8O B;  2MWO A;  2EYX A;  2G6F X;  3UF4 A;  2FZG B;  4FT2 A;  5GAN 4;  1Q81 C;  1NBE B;  4XU3 A;  1VQ5 Q;  4N4G A;  2E64 A;  2RHI A;  3OYG A;  1CKA A;  2EGC A;  2DTI A;  4BDY A;  1U1T A;  4EPC A;  3H8Z A;  4M7D E;  3C12 A;  1N8R U;  2JTE A;  1DJ7 B;  3CXC S;  5GAN g;  3SWN C;  4QQ6 A;  3PTA A;  3FIF A;  2DL5 A;  1KC8 R;  3RER A;  2QXF A;  1NYF A;  1XJW B;  4AFZ C;  1YIT T;  2X35 A;  2KXD A;  1PWT A;  3S3O A;  2C0O A;  4PJO A;  3G7Z A;  1I0C A;  5GAM g;  1X01 A;  2LT4 A;  1M4Z A;  4C8Q G;  1OYX A;  3VUZ A;  3CPW S;  1LJO A;  1N9R A;  3TSW A;  2L3R A;  2RK1 A;  1VQM A;  2MAM A;  1W6X A;  3JB9 D;  3G4S Q;  2KNB B;  4FYW B;  2RO0 A;  2RJE A;  1BCM A;  4Z8A A;  4C5I A;  1W70 A;  3R6O A;  4F04 B;  3H0I A;  3OYE A;  2QTX A;  1I5O B;  2GQV A;  3X28 B;  4J83 A;  4M77 E;  1SRL A;  1GCP A;  3S6W A;  2CZ1 B;  3A8L B;  2G3R A;  3MEU A;  4XTW A;  3INZ A;  4RG2 A;  2LCC A;  2JXB A;  3FDR A;  5I2S A;  3CCM Q;  2JVV A;  1RAD B;  2VUB A;  3FRN A;  5CKE A;  3QKJ A;  3HSB A;  2M02 A;  3CCR T;  4PJJ A;  5KYW B;  4Y91 A;  3I35 A;  4M7A C;  2GFA A;  2L3Q A;  2PQW A;  4OMQ A;  4E7S A;  4A53 A;  5HK3 A;  2BZX A;  1SF9 A;  1K9A A;  3ZEH A;  1UHC A;  2LZ6 B;  1EIF A;  2JJ9 A;  3OYL A;  1YI2 T;  3M0U A;  3OBY A;  3EFR A;  3GIB A;  3A8M B;  3VS4 A;  2EW3 A;  4B9X A;  4KH1 B;  2FPD A;  2RPN A;  5FU7 B;  2L5Q A;  5FU7 C;  4Z89 A;  1IRE B;  1R77 A;  1PG5 B;  2K3X A;  3H6Z A;  1PNJ A;  2AKL A;  1M8V A;  3PE0 A;  1M90 U;  1KD1 U;  2VVK A;  1YJ9 A;  2DXT A;  1YJW A;  2CP6 A;  3PGG A;  2FRY A;  1E6H A;  1V1C A;  2K5L A;  2VXE A;  2LTO A;  1AHJ B;  3EHR A;  2EYQ A;  3NPF A;  4ZGD B;  1TH7 A;  4NOY A;  2FPE A;  2DXC A;  2FVU A;  3OW2 S;  2VYT A;  3CC7 T;  3ME9 A;  1WHM A;  4CC4 B;  5KYY A;  2QA4 T;  2EVR A;  3DB3 A;  5GMK l;  3CC4 A;  4JZ3 A;  1LOJ A;  1JJ2 P;  3RKX A;  4M78 A;  1D3B B;  3O5Z A;  4OMF B;  2E5Q A;  4KH0 B;  2PU9 B;  4M7D A;  3CMA T;  4CC2 A;  3J80 E;  2RN8 A;  3V8L A;  4C8Q A;  1VQN Q;  1QLY A;  1QMC A;  1BI0 A;  1EZZ B;  1Q86 U;  1UDL A;  3V7S A;  2HKQ B;  5IH2 A;  1VQ7 T;  4LD9 K;  3HP9 A;  3M0R A;  4LDV A;  3OYA A;  4LDW A;  4JRK A;  5KH6 A;  2KRS A;  1D1C A;  5FRM A;  4ORZ A;  1BCO A;  2MMP A;  4FU6 A;  2YRC A;  5GMK m;  1QKX A;  4C0D B;  4C5H A;  1RAH B;  4AFS C;  1JEG A;  2AT1 B;  3QUI A;  2GGR A;  4C92 A;  1NPR A;  4DBF A;  2ZPB B;  2KT8 A;  5GAN 5;  3CCQ T;  4QKU A;  2KT1 A;  2YT6 A;  4L5G A;  2HBP A;  3JCM h;  2ZZD A;  1WJS A;  2DET A;  2CRE A;  1QKW A;  3URG A;  2DL8 A;  1QW1 A;  5IHK A;  2KEA A;  3EGX B;  2ZPG B;  1JJ2 A;  4J9H A;  2EGE A;  2O31 A;  3LX7 A;  3FB9 A;  1YJW Q;  1WXB A;  3M58 A;  1B07 A;  2X51 A;  3OYB A;  3CCV T;  1ZUU A;  4D8D A;  1RAI B;  1MNE A;  4MDX A;  2V8I A;  4AG2 C;  1KD1 R;  3QBY A;  1ZBX A;  3PIO A;  2FB7 A;  1Y0M A;  3PFS A;  1M3A A;  4B9W A;  4OP0 A;  2QDY B;  4M7A D;  2K5F A;  4A4K A;  3M0T A;  3X24 B;  2DL7 A;  2QQR A;  4OF1 A;  4M75 C;  4J9B A;  3G6E T;  3WVE B;  2EIF A;  1XNI A;  3VS6 A;  2I2L A;  3VS0 A;  9ATC B;  1D1B A;  1SRM A;  2VV5 A;  5C0M A;  2O9S A;  4PJO D;  2NUP B;  3N5B B;  4GY5 A;  1ZSZ A;  3EG9 B;  2E41 A;  3E19 A;  1X75 C;  5IHI A;  1G83 A;  5LL6 S;  1E7O A;  1Y57 A;  1YJW T;  3I5S A;  3JCM V;  4FIB A;  2HQE A;  1J3T A;  2F5T X;  4M75 A;  4F7U G;  4XAX B;  4C92 E;  1JXO A;  1SPK A;  4F7U E;  2KGT A;  1Q86 R;  5GJV B;  2ZPI B;  1SKU B;  3CCQ A;  4ATO A;  4TVR A;  2O01 E;  4J6Y A;  4M77 D;  3V8J A;  1IXD A;  2V8K A;  4OB2 B;  3PVQ A;  1KQS P;  4EIK A;  1NEB A;  1VQ9 Q;  5LJ3 j;  1FMW A;  4OVA A;  4DA4 A;  2KSS A;  3I5R A;  1U5S A;  2MIO A;  1VQM Q;  1ZQ1 A;  2LRQ A;  1F1B B;  3ASK A;  2HEQ A;  2BE9 B;  4XU1 A;  3MP6 A;  2OTJ Q;  2KRM A;  2GF7 A;  1RI9 A;  1TUD A;  1SHF A;  4RUG A;  1GFD A;  2DJZ A;  1W2B A;  1Q82 C;  5CQX A;  3P8D A;  2E70 A;  2RHZ A;  1AWO A;  2MCN A;  3QXE B;  1B7T A;  4FT4 A;  2QK0 A;  2HL5 C;  4OB0 B;  3VRZ A;  4NL3 A;  2FL7 A;  2P0P A;  1IGQ A;  1O75 A;  4OMP A;  4ESR A;  3SD4 A;  5GAN 8;  1KD1 C;  3QJY A;  2XDB A;  4HKE A;  3NTH A;  1Q81 U;  5HKC A;  3JCM J;  5J3B A;  2Y4X A;  2ZAE A;  3EH1 A;  1FMK A;  2DJQ A;  1R0C B;  3NTK A;  1WYX A;  1KQS A;  3CC7 A;  2BZY A;  3NFC A;  5C6S A;  3CBP A;  3QPH A;  3GOX A;  5CKD A;  1NEG A;  1QWE A;  3CPF A;  1WHG A;  2VB6 A;  3UA7 A;  1M1K C;  1X43 A;  2EKO A;  3CCS A;  1IO6 A;  2QGG A;  4E47 A;  4F7U F;  4E7Z A;  1UGP B;  1Q86 C;  1Q81 R;  5LJ5 g;  1KHC A;  5LJ5 f;  3OYH A;  4ZTJ A;  3CBO A;  2X4Y A;  2CP7 A;  3BDU A;  4QQD A;  2R5A A;  3A8H B;  1OU8 A;  1VQ8 Q;  1WNL A;  5CIU A;  2DE0 X;  1TSF A;  2FRW A;  1OZ2 A;  4M75 D;  1VIF A;  1VQN A;  5GJW B;  4PJO C;  1JRI A;  1S72 A;  4P5N A;  3TEE A;  4LE9 A;  3JSC A;  2YUP A;  4OMN A;  4F17 A;  2DYB A;  4XU2 A;  1K9M R;  1I81 A;  2XI9 A;  3A98 A;  1TXQ A;  4IUT A;  1NLO C;  1C6V X;  3REB B;  3NHN A;  4CI0 C;  2DFU A;  2OTJ A;  2JUF A;  1D09 B;  2ZPH B;  2D1X A;  2OTL T;  3QDF A;  1YJ9 Q;  7AT1 B;  1Y07 A;  4EMG A;  1BYM A;  2E4H A;  2B8A A;  1O9S A;  1RAB B;  1ZLM A;  2K9G A;  1VQP T;  2QEX A;  4PKC C;  2LP5 A;  2X9H A;  2EJG A;  4NL2 A;  1VQM T;  2LVM A;  2L3P A;  3SWN B;  4HVV A;  1K8A R;  1Y96 B;  2V1Q A;  2VGN A;  1K4U S;  1AOJ A;  3MO8 A;  4X9C A;  3OBW A;  3OW2 A;  2ENM A;  1JU5 C;  5CO7 A;  4L59 A;  2DXU A;  2J06 A;  1MMD A;  5GAN 6;  1M2V B;  5HCK A;  3GF5 A;  2A37 A;  2XMF A;  4M7D C;  2MPX C;  3CBM A;  5KYW A;  1X6O A;  3CMA Q;  2RI2 A;  3WXM B;  1UGQ B;  1PRM C;  3EAE A;  2J6F A;  1Z9Z A;  1IHW A;  1K1Z A;  3CCL A;  2BE7 D;  1BK2 A;  1QVF A;  2JW4 A;  2ESW A;  5GMK e;  3ZL7 C;  2JZ2 A;  1HXD A;  2KVQ G;  4J9E A;  1PM3 A;  3CPW P;  3CD6 T;  2JTM A;  2OAU A;  2RJD A;  3QG1 A;  4R0K A;  3CCJ Q;  5I21 A;  2H3E B;  3H0F A;  3SWN A;  1UHF A;  3G4S A;  2RJF A;  4J5Y A;  2LJ1 A;  2GTJ A;  3JB9 G;  3QO3 A;  4QVZ A;  2LJ3 A;  2M0O A;  2VC8 A;  2CKK A;  2QYZ A;  2K4Y A;  3F70 A;  2RHX A;  4XTY A;  1K73 U;  4HA8 A;  4HCB A;  4M78 C;  2OI3 A;  2HQX A;  1WI7 A;  2XK0 A;  2YUN A;  4MMK A;  1VQP Q;  1ZX6 A;  1U8R A;  1YIJ Q;  2RJC A;  2KK4 A;  1MV0 B;  4J7F A;  4A4H A;  2A36 A;  4JUV A;  4J9F A;  1OV3 A;  2JN0 A;  2R58 A;  3KBG A;  2HSE B;  1GXI E;  1VQ7 A;  1Y96 A;  4FYV B;  2O4X A;  1S1N A;  1OZ3 A;  3GNF B;  1YP5 A;  3RKY A;  1UE9 A;  4XTV A;  1M1K U;  4EMK C;  3JB9 J;  5GAN f;  3HTR A;  5LJ3 e;  1AEY A;  3CCS T;  1N27 A;  2FPF A;  1QVF P;  3JCM d;  4MZT A;  4R55 A;  4PLI A;  2DD4 A;  2EKH A;  4ZNX A;  4PJO F;  5FRO A;  1MMA A;  2QA4 A;  1NJI C;  5M9O A;  1VQ8 A;  2ABL A;  1VQ5 A;  4MZM A;  2IPO B;  4RTZ A;  1XOV A;  3G71 A;  4C5G A;  4II1 A;  1QCF A;  1RLP C;  1KJW A;  1K73 C;  1QP2 A;  1NG2 A;  2NUP A;  2VGM A;  4KGV B;  2DF6 A;  3CCR Q;  4JRQ A;  2O9V A;  2QEX T;  2LX7 A;  2O4X B;  2DX1 A;  5DY9 A;  2ATC B;  1M2O A;  1Z9Q A;  1M1G A;  2VWF A;  2GNC A;  3KUF A;  5GAN 3;  3X26 B;  2D6F A;  2V8J A;  3T9N A;  4OGC A;  2ROT A;  3I56 A;  3QYH B;  2PZ1 A;  1YFN A;  2X4X A;  1WZO A;  3M0Q A;  1H3H A;  3OQ5 A;  4PFP A;  3JCM X;  3AHU A;  1IB8 A;  5AYF A;  3SHW A;  4BI4 A;  4IKF A;  1MND A;  1IHV A;  2OTL Q;  2A28 A;  2XDD A;  1YHQ A;  1GL5 A;  2ROL A;  2EYZ A;  3TVT A;  2RF0 A;  1RAA B;  2XD0 A;  3OMC A;  3OMG A;  2RQU A;  4E7J A;  2QAS A;  1OX9 A;  2QG9 B;  3JCM e;  1I8F A;  1H92 A;  3M55 A;  3LWH A;  2LDM A;  2CH4 W;  4ZGJ B;  4N0A A;  1MHN A;  1S72 T;  4N0A C;  3C0C A;  2K5I A;  4XTZ A;  1HJD A;  2DRM A;  4M4Z A;  4LD6 A;  2YLB A;  2HCK A;  3PNW C;  4KGX B;  3G6E A;  2ZPE B;  3M4Y A;  1FYN A;  3RMQ A;  5D6X A;  4AT1 B;  1VQ5 T;  2HQH A;  3CME Q;  4BI3 A;  1MMN A;  5GAO n;  1QVF S;  2OX7 A;  1YHQ Q;  3EGD B;  2F1L A;  1X27 A;  4M78 F;  4M78 B;  2X4J A;  2JNG A;  1M3B A;  2ZGW A;  2RI5 A;  3JCM f;  2ZCF B;  1WLP B;  5FRN A;  1G2B A;  4M77 G;  1OUL A;  2KRN A;  3CCV A;  1MMG A;  5GAO r;  1WHJ A;  5GAN d;  3I55 Q;  3A8G B;  3FJ5 A;  5CKH A;  2J05 A;  3TU4 K;  2V26 A;  1RAC B;  4DBR A;  2FZC B;  3SFM A;  1M27 C;  1VQ4 Q;  3PIP A;  2OAW A;  3NGP A;  2ED1 A;  3LH5 A;  2WAC A;  4Z02 A;  3CCR A;  3QWY A;  3M0S A;  2PTK A;  3GP8 A;  3QYG B;  3JAM E;  1MUZ A;  2WSC E;  2RQR A;  4DEY A;  3TQ7 P;  3G71 Q;  4HCC A;  1NJI R;  2KY9 A;  4JRP A;  4MDW A;  3L2V A;  4IUP A;  2QQS A;  4JJB A;  3MJX A;  3MEA A;  4RTV A;  1RL2 A;  1ZSZ B;  1ZUK A;  4M75 F;  3OS1 A;  5CCA A;  3EGX A;  5HY6 A;  2IG0 A;  1VQK Q;  1VYT A;  1E6G A;  1WPY A;  4OMM A;  4CC3 A;  4ZN1 A;  1WHK A;  3MEV A;  1UJ0 A;  1YN8 A;  2LCL A;  1M2V A;  2KI7 A;  4HCK A;  3QWX X;  1RAE B;  2H3J A;  3SDZ A;  1JJ2 S;  1UFF A;  4Z88 A;  1VQ7 Q;  2CUD A;  4JJC A;  4C5E A;  4RTY A;  5AT1 B;  1RAG B;  1GCQ A;  2K6D A;  2HZY A;  1AT1 B;  3JCM P;  2D8H A;  4A4E A;  4F16 A;  4KGZ B;  4M7A A;  1G3T A;  1SSH A;  1QCN A;  2DRK A;  1VQL A;  3MPU B;  3UT1 A;  2VKN A;  2CYZ B;  4N4I A;  5FWC A;  2P4R A;  3RIR A;  3FC3 A;  4BE1 A;  3OYI A;  2M16 A;  4KBM B;  4PJO B;  4QW2 A;  1K9M C;  3CQT A;  3G1J A;  4M7A F;  1M8M A;  2C0T A;  4M75 G;  3DLM A;  3M4G A;  3E1S A;  1ZBJ A;  1TS9 A;  3L2R A;  4DBQ A;  1KFZ A;  1KIK A;  1GFC A;  3M54 A;  4M78 G;  1YI2 A;  2NUT B;  4OB3 B;  3CCJ T;  4BY6 C;  2EAY A;  2E3H A;  2EYW A;  1VQP A;  2Y4Y A;  1BIB A;  2RB6 A;  1SSF A;  2CSQ A;  2E12 A;  3C4S A;  1ZA1 B;  4HXJ A;  2NLU A;  4C8Q B;  4C92 F;  1Y71 A;  1AVZ C;  1WDX A;  2L8D A;  2LNH B;  3E9G A;  1X2K A;  2D9T A;  2C0I A;  5GMK j;  4E7L A;  3BDL A;  1R0B G;  4L6V 5;  5EG2 A;  3JCM Q;  2DTH A;  3CEY A;  3L2Q A;  2BKD N;  2E3I A;  4QT7 A;  4HVU A;  4M75 B;  2DIQ A;  5HK0 A;  4BDZ A;  1G3S A;  2K3Y A;  1Q7Y U;  2HBW A;  4RCC A;  1PSE A;  1JO8 A;  2PUK B;  4LN2 A;  4Q5W A;  2LQ8 A;  5LJ5 d;  4A4G A;  2SRC A;  3RES A;  1Q95 G;  1T3L A;  3CMA A;  1NM7 A;  2L89 A;  3QII A;  3CCM A;  2KMT A;  4M7A B;  2V1R A;  4RG8 A;  1QWF A;  1FMV A;  2EQU A;  4IUV A;  1VQ8 T;  5IHN A;  1YCY A;  2JS2 A;  4BB7 A;  5GAO m;  5J26 A;  5CAI A;  2BTT A;  2DAQ A;  4UC4 A;  1JB0 E;  2CZ7 B;  4C92 D;  1IGU A;  1FX7 A;  3UWN A;  2LNV A;  1X6B A;  2PVG B;  3ULR B;  1KQS S;  2D8J A;  1X6G A;  2RM4 A;  2HSP A;  2FEI A;  2DZC A;  2PUO B;  1EFN A;  2QI2 A;  4RTU A;  2L3S A;  1KC8 U;  5DM7 R;  5L8R E;  3JCM W;  1NLP C;  3L1A A;  4B6M A;  1UEB A;  2MK5 A;  1D0Z A;  5LJ3 f;  3OYD A;  1OEB A;  4ZN3 A;  1HK9 A;  3CCE A;  4F14 A;  2EQM A;  3CC2 T;  1ZA2 B;  2MF2 A;  3CCS Q;  1WGS A;  3TRE A;  2EQI A;  4C8Q E;  3JCM b;  2YDL A;  8ATC B;  3QJ6 A;  4XK8 E;  4PFO A;  2PVD B;  3I55 T;  1TG0 A;  5KYX B;  1VQ6 Q;  1AD5 A;  3AT1 B;  4FSS A;  1T3S A;  1XQH A;  3RNJ A;  5IT9 E;  4HCZ A;  4PJM A;  1M9S A;  3P8H A;  1OPK A;  2KQW A;  1K76 A;  1OQK A;  4EMH A;  4R56 A;  3VV0 A;  4FYY B;  1ZSZ C;  2KE9 A;  4M77 B;  3VU3 C;  1LCK A;  1SEM A;  2DM1 A;  1OI1 A;  3G71 T;  1K0X A;  1UB4 A;  5GAM f;  2O2O A;  4XTX A;  3EG2 A;  2NUZ A;  1VA7 A;  4HT9 A;  3HKS A;  1KG1 A;  1U3O A;  3QDR B;  2MWP A;  2QAZ A;  4XTU A;  2FZK B;  2X3W D;  2J7I A;  3Q1J A;  4HVW A;  5D6W A;  3CC7 Q;  1VQK A;  4RKU E;  1WFW A;  3GBQ A;  3QHS A;  4O6J A;  3E2U A;  5A0G A;  5ECA A;  1JQQ A;  3EG3 A;  3LGF A;  1RAF B;  1U1S A;  3PMT A;  1VQ9 A;  1JXM A;  2C06 A;  1QCO A;  5LJ5 j;  3CCQ Q;  1TWB A;  2HNI A;  2J6O A;  5D6Y A;  3DB4 A;  4ELZ C;  3EFS A;  3KXT A;  3L2Z A;  3G6E Q;  3CME T;  1RLQ C;  1ACM B;  3RR6 A;  5GAM e;  2XG8 D;  3LGL A;  4C92 B;  4C8Q F;  1YJN Q;  3LLR A;  3OYC A;  1G3Y A;  2GCX A;  1NJI U;  4LDY A;  1VOM A;  4E7I A;  4FL6 A;  3CCU T;  2QDL A;  4M75 E;  2KRO A;  1I4K 1;  2I0N A;  3MP8 A;  4JZ4 A;  3VS2 A;  1YBY A;  3HFO A;  2EYY A;  4A4F A;  4JLG A;  2CZ6 B;  3OYF A;  2NWM A; 
#chains in the Genus database with same CATH homology
 4GLM A;  1PKS A;  1QKX A;  2KYM A;  2A28 A;  4RTT A;  4AFS C;  1GL5 A;  1U06 A;  1JEG A;  2FG0 A;  2ROL A;  2EYZ A;  3TVT A;  2RF0 A;  2GGR A;  2K79 A;  4OMO A;  2KT8 A;  2JMC A;  1AWW A;  2KT1 A;  2YT6 A;  3VS5 A;  2RQU A;  2L0A A;  2RQT A;  2CRE A;  2CSI A;  2DLP A;  1ZUY A;  4WCI A;  1QKW A;  3I9Q A;  1H92 A;  2DL8 A;  2K2M A;  1YNZ A;  5IHK A;  2CH4 W;  2KEA A;  2HDA A;  2JT4 A;  4OML A;  4J9H A;  2EGE A;  2JS0 A;  2O31 A;  3C0C A;  1M3C A;  2CUB A;  2L2P A;  1WXB A;  2DNU A;  1HJD A;  2DRM A;  4M4Z A;  2RMO A;  1B07 A;  2LCS A;  2EPD A;  1MV3 A;  3M0P A;  4CC7 A;  2HCK A;  1ZUU A;  4D8D A;  1UEC A;  1OPL A;  2DIL A;  4AG2 C;  3H41 A;  1FYN A;  1KSW A;  2YUO A;  1Y0M A;  1GBR A;  1M3A A;  1YWP A;  4J9D A;  1HSQ A;  3M0T A;  1X27 A;  2DL7 A;  4Y92 A;  1WIE A;  4J9B A;  3VS6 A;  2KXC A;  1M3B A;  3VS0 A;  2M0Y A;  1SRM A;  2O9S A;  1WLP B;  1G2B A;  1PRL C;  2KRN A;  1T0J A;  4JPB W;  2EBP A;  1G83 A;  5IHI A;  1E7O A;  1Y57 A;  3I5S A;  2GBQ A;  1H8K A;  1B3Q A;  2CT4 A;  3FJ5 A;  1J3T A;  2J05 A;  4IIM A;  1JXO A;  1SPK A;  3UA6 A;  2EGA A;  2KGT A;  4JJD A;  5GJV B;  1M27 C;  2OAW A;  3NGP A;  2DVJ A;  2ED1 A;  3LH5 A;  1AZG B;  3QWY A;  1AWJ A;  3M0S A;  2PTK A;  2CT3 A;  3PVQ A;  4AFU C;  2JMA A;  1UTI A;  4EIK A;  1RUW A;  1NEB A;  5FW9 A;  1MUZ A;  4DEY A;  2RQR A;  4AG1 C;  2F2V A;  5I22 A;  3I5R A;  4J9G A;  1GCQ C;  1U5S A;  1GRI A;  2DL4 A;  2MIO A;  4JJB A;  4RTV A;  1ZUK A;  2HEQ A;  1YCS B;  2J6K A;  4GBQ A;  1CKB A;  1GBQ A;  2KRM A;  1RI9 A;  1TUD A;  2W0Z A;  1SHF A;  4RUG A;  1GFD A;  1VYT A;  1E6G A;  1UJY A;  2KBT A;  3U23 A;  4OMM A;  4CC3 A;  1HD3 A;  1UJ0 A;  1YN8 A;  1AWO A;  3THK A;  2MCN A;  2DL3 A;  2M51 A;  1ABO A;  2JM8 A;  1WXU A;  4HCK A;  2F2W A;  3QWX X;  2LQN A;  1UFF A;  3NMZ C;  1UGV A;  4Z88 A;  3VRZ A;  2SEM A;  2CUD A;  4JJC A;  1ZSG A;  4RTY A;  3EG0 A;  3UAT A;  1GCQ A;  2K6D A;  3SEM A;  4OMP A;  3R6N A;  4ESR A;  5IXB A;  1W1F A;  2D8H A;  1T0H A;  4F16 A;  4IIO A;  1SSH A;  3REA B;  1M30 A;  2DRK A;  2IIM A;  2AKK A;  5L23 A;  2ECZ A;  5IXF A;  1VYV A;  2VKN A;  1FMK A;  2DJQ A;  4E6R A;  3TSZ A;  1BU1 A;  1WYX A;  2JM9 A;  2BZY A;  4LUE A;  1A0N B;  5FWC A;  2AK5 A;  1NEG A;  2K3B A;  2P4R A;  2RQW A;  4AFQ C;  1QWE A;  3UA7 A;  1X43 A;  1OOT A;  1AZE A;  2BZ8 A;  1IO6 A;  3CQT A;  3VRY A;  1M8M A;  2C0T A;  3RBB B;  3VS7 A;  1ZBJ A;  1PKT A;  2DBM A;  1I07 A;  1BB9 A;  1KFZ A;  1KIK A;  1GFC A;  2CH4 A;  3SHW A;  3KFV A;  2EYW A;  1CSK A;  2X3X D;  2CSQ A;  1WXT A;  3PVL A;  2DE0 X;  4HXJ A;  2FRW A;  2GQI A;  2AZV A;  5GJW B;  3JV3 A;  2YUQ A;  1AVZ C;  1WX6 A;  1WDX A;  1UUE A;  4RTW A;  2DBK A;  2PNI A;  2MOX A;  2LNH B;  2RQV A;  1X2K A;  2C0I A;  5EC7 A;  4LE9 A;  3IQL A;  2OJ2 A;  2YUP A;  1X2Q A;  2EYX A;  4OMN A;  4F17 A;  2DYB A;  2G6F X;  4QT7 A;  4J9I A;  2CDT A;  2ED0 A;  3A98 A;  4HVU A;  3UF4 A;  1NLO C;  2HBW A;  1JO8 A;  4LN2 A;  3REB B;  3VS3 A;  3NHN A;  1CKA A;  2SRC A;  2EGC A;  2D1X A;  1T3L A;  1NM7 A;  1N5Z A;  2V1R A;  1QWF A;  2JTE A;  1ZLM A;  1NYG A;  2K9G A;  2LP5 A;  5IHN A;  2JS2 A;  4KRT A;  2DL5 A;  2L3P A;  4DEX A;  2BTT A;  1PHT A;  1NYF A;  4HVV A;  2V1Q A;  4AFZ C;  2KXD A;  1K4U S;  1PWT A;  1X6B A;  1AOJ A;  3ULR B;  2C0O A;  1JU5 C;  2ENM A;  1I0C A;  2J06 A;  2D8J A;  1X6G A;  2HSP A;  2FEI A;  5HCK A;  2A37 A;  2XMF A;  2LMJ A;  1PRM C;  1EFN A;  2J6F A;  1Z9Z A;  4RTU A;  2L3S A;  3TSW A;  1K1Z A;  1NLP C;  1I1J A;  1BK2 A;  1W6X A;  2JW4 A;  2ESW A;  1OEB A;  3ZL7 C;  2KNB B;  4J9E A;  4F14 A;  1VYU A;  4Z8A A;  3VS1 A;  1W70 A;  4R0K A;  3H0I A;  3H0F A;  2EQI A;  1YWO A;  1SRL A;  1UHF A;  1GCP A;  2YDL A;  1ABQ A;  1SHG A;  1TG0 A;  2LJ1 A;  2GTJ A;  1AD5 A;  4FSS A;  1T3S A;  3RNJ A;  2JXB A;  4K11 A;  2KR3 A;  2LJ3 A;  5I11 A;  2KYB A;  1OPK A;  2OI3 A;  1K76 A;  1WI7 A;  2H8H A;  2YUN A;  3I35 A;  2E5K A;  2L3Q A;  4OMQ A;  1ZX6 A;  1BBZ A;  1ARK A;  4LUD A;  2BZX A;  1MV0 B;  1TUC A;  2A36 A;  2KE9 A;  4J9F A;  1OV3 A;  1K0S A;  2D0N A;  1K9A A;  1LCK A;  1SEM A;  1UHC A;  2LZ6 B;  2DM1 A;  1S1N A;  1K0X A;  1UG1 A;  3M0U A;  1YP5 A;  1UE9 A;  2EW3 A;  3VS4 A;  2O2O A;  2FPD A;  3EG2 A;  2RPN A;  2NUZ A;  1VA7 A;  4X1V A;  1AEY A;  2FPF A;  3EG1 A;  2DMO A;  2GTO A;  4Z89 A;  2F2X A;  2LQW A;  1PNJ A;  2AKL A;  2X3W D;  3PE0 A;  2J7I A;  1AWX A;  2VVK A;  2EKH A;  4HVW A;  4ZNX A;  2O88 A;  2FRY A;  1E6H A;  1V1C A;  1WFW A;  3GBQ A;  1X69 A;  3EHR A;  2ABL A;  5ECA A;  1JQQ A;  3EG3 A;  3NPF A;  4RTZ A;  2FPE A;  1XOV A;  3H0H A;  1QCF A;  1RLP C;  1KJW A;  2B86 A;  1JXM A;  2LJ0 A;  1NG2 A;  4CC4 B;  4D8K A;  2EVR A;  2DF6 A;  2O9V A;  4JZ3 A;  2J6O A;  2LX7 A;  2DX1 A;  2K7A A;  1Z9Q A;  3O5Z A;  2VWF A;  2GNC A;  4CC2 A;  1RLQ C;  3EGU A;  1WA7 A;  2RN8 A;  2W10 A;  2ROT A;  2FO0 A;  4RTX A;  2PZ1 A;  2YSQ A;  1QLY A;  2DA9 A;  4J9C A;  5FWB A;  3EHQ A;  2RNA A;  1UDL A;  3M0Q A;  2QDL A;  5IH2 A;  4A63 B;  1H3H A;  2KRO A;  2AZS A;  2I0N A;  2A08 A;  3M0R A;  4JZ4 A;  3VS2 A;  2EYY A;  1U3O A;  2KRS A;  4LNP A;  2NWM A;  4ORZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...