2DF6A

Crystal structure of the sh3 domain of betapix in complex with a high affinity peptide from pak2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
b'GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 10
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2df6A00
1XOVA 2JM8A 2RQWA 1V1CA 1YNZA 1GFDA 1PWTA 2L3SA 1QKXA 1RUWA 2AZSA 2DX1A 1K0SA 3EGUA 1S1NA 3VRZA 5FWCA 3VS3A 4HVWA 4D8KA 2RQRA 1GL5A 1G2BA 3PVQA 2F2VA 1UJYA 3NPFA 2GBQA 2XMFA 1OOTA 1PNJA 2MOXA 2JW4A 3R6NA 2DF6A 2EYWA 4JZ4A 3TSWA 2D1XA 1K4US 3M0TA 2DVJA 2L0AA 2O2OA 4LE9A 1YN8A 2CUBA 1SHFA 4RTTA 3JV3A 2CH4W 2KT8A 2LP5A 4OMMA 4ESRA 2CSQA 4OMQA 1ZLMA 1GFCA 1B3QA 3EHQA 3RBBB 1WFWA 1M3BA 2YDLA 3VS6A 2NWMA 1BB9A 4LUDA 2F2WA 1Y57A 1NEBA 2DL3A 2HSPA 2YSQA 1NLOC 2JM9A 2LJ1A 2LJ3A 3EG2A 1NYGA 1GCPA 2L3PA 4J9IA 4X1VA 2F2XA 5I22A 2KR3A 2FEIA 2BZ8A 2DRKA 3NGPA 1GBQA 3REBB 2KXCA 4E6RA 2DL7A 2ED1A 2D8HA 2YT6A 1UHCA 2J6FA 1KFZA 4RTXA 2KE9A 1TUCA 3IQLA 3M0SA 2LMJA 2EBPA 3H0FA 4J9HA 2W0ZA 2LJ0A 2EYZA 2HCKA 2YUQA 1UE9A 2JMAA 1U06A 2LNHB 2KROA 1EFNA 4IIOA 1AVZC 1JQQA 2CREA 1UFFA 2K3BA 2EQIA 2J6KA 5IHNA 1QCFA 1HD3A 1GCQC 2EGAA 4IIMA 1SSHA 4JJDA 3REAB 1E6GA 3TVTA 3I35A 2K79A 4AFSC 4LNPA 3M0QA 2JT4A 1J3TA 4ORZA 1UUEA 4RUGA 1W1FA 5L23A 4J9FA 1FMKA 1GRIA 2DL8A 2DYBA 3A98A 1MV3A 2L2PA 2GGRA 2SRCA 3NMZC 4AG2C 1WI7A 1GBRA 3H0HA 2B86A 2DA9A 2C0OA 4J9GA 1AEYA 2NUZA 2BZXA 5FW9A 2HEQA 2GNCA 2J06A 1AWWA 2ABLA 2O88A 2K2MA 3NHNA 1NLPC 2EYYA 1M8MA 2D0NA 2JMCA 2DBKA 2M51A 2CUDA 3M0PA 4K11A 1Z9QA 4OMPA 1NEGA 1UTIA 3U23A 4R0KA 2JS0A 2RN8A 2CSIA 2X3XD 2DBMA 2FPEA 2HDAA 1AD5A 2KRNA 1SPKA 1ZUUA 2CT3A 3ULRB 1Z9ZA 1SRLA 3O5ZA 1K76A 1QLYA 1UDLA 1BK2A 4RTZA 4J9EA 5FWBA 2ED0A 3H41A 4GLMA 2KNBB 2FRYA 1T0JA 3VS4A 2LZ6B 1X6BA 1YP5A 1PHTA 2PZ1A 1FYNA 2RQTA 3TSZA 1UECA 1U3OA 4JJBA 2OJ2A 2GTOA 2BZYA 2KYMA 2RPNA 2D8JA 3I5SA 3I5RA 4F17A 1WA7A 2A28A 1W6XA 1YWPA 1ZUYA 2EYXA 4FSSA 2A36A 1RLQC 3SHWA 2DNUA 3VRYA 1T3SA 2ROTA 4AG1C 2YUPA 5IXBA 2KBTA 2EPDA 1ZUKA 2LQWA 1H92A 2FO0A 3QWXX 2E5KA 4RTWA 1BBZA 1B07A 1UG1A 3UA6A 2V1RA 2I0NA 2OI3A 2W10A 3PE0A 2RMOA 4RTYA 1AWXA 2O9VA 4OMOA 3UA7A 3QWYA 1RI9A 1X2QA 3I9QA 2M0YA 2K6DA 2AKLA 2BTTA 1NM7A 2MIOA 2J05A 1WXBA 2P4RA 1W70A 2KYBA 1E6HA 2HBWA 5IHIA 2DILA 3RNJA 4A63B 1OPKA 1E7OA 2KRMA 2OAWA 1UHFA 1JO8A 4AFQC 2YUNA 1M3AA 1TUDA 4WCIA 4GBQA 1X6GA 2O31A 2LCSA 2PNIA 1KIKA 2O9SA 1AWJA 2VVKA 4J9BA 2AKKA 2CDTA 3VS1A 5I11A 5HCKA 4CC3A 3GBQA 3PVLA 3VS7A 4AFZC 2L3QA 1VA7A 4HVVA 1ZBJA 2RQVA 3EG1A 2VWFA 1UJ0A 2SEMA 2DJQA 2EW3A 5GJVB 4QT7A 1WIEA 1SHGA 1RLPC 2KGTA 1AZEA 2KXDA 2C0IA 2VKNA 2KT1A 2DMOA 1KJWA 1OPLA 2RQUA 2J7IA 4JJCA 1TG0A 5IHKA 2DLPA 1PKSA 1ABOA 1M27C 1QWEA 1WXUA 1I0CA 3THKA 3EHRA 1MUZA 1YWOA 1CSKA 4DEXA 1QKWA 5IXFA 1H3HA 1NG2A 4LN2A 1M30A 3VS0A 4J9CA 3FJ5A 2EGCA 1OV3A 2IIMA 1Y0MA 1I1JA 2AK5A 2EKHA 2QDLA 4JZ3A 1HSQA 4DEYA 3EG0A 2H8HA 4Z89A 1GCQA 1WLPB 4ZNXA 1YCSB 2PTKA 5GJWB 1LCKA 2CH4A 3H0IA 2ENMA 2RF0A 4HVUA 1JEGA 2GQIA 3LH5A 1K9AA 1WDXA 1X69A 4CC2A 1M3CA 1ARKA 1QWFA 4Z88A 1HJDA 1AZGB 4J9DA 4CC7A 1WXTA 1ABQA 2EVRA 1MV0B 2DE0X 2RNAA 1AOJA 2K9GA 2FPDA 1VYUA 1PRLC 1BU1A 4Y92A 2A08A 1WYXA 2KRSA 1N5ZA 2JXBA 1CKBA 1ZX6A 1X43A 2MCNA 2YUOA 2ESWA 3EG3A 1K0XA 4OMNA 1T0HA 2DL4A 5IH2A 1SRMA 1T3LA 2JTEA 3M0UA 1A0NB 3M0RA 4F16A 2C0TA 4HXJA 1JXOA 1KSWA 1WX6A 4HCKA 1G83A 2AZVA 1VYTA 1IO6A 2J6OA 3VS5A 1CKAA 2A37A 2G6FX 2V1QA 2K7AA 1H8KA 3SEMA 2EGEA 4RTUA 4M4ZA 3UATA 1I07A 4Z8AA 1OEBA 1PKTA 4AFUC 3VS2A 2DL5A 2DRMA 4D8DA 3C0CA 1JU5C 2KEAA 2DM1A 3CQTA 2ECZA 4RTVA 1K1ZA 1X27A 3KFVA 4EIKA 4F14A 1PRMC 2LX7A 1U5SA 2LQNA 2FPFA 2JS2A 2CT4A 2X3WD 1SEMA 2GTJA 1UGVA 4CC4B 1ZSGA 4JPBW 4LUEA 5EC7A 1VYVA 1AWOA 2ROLA 2FG0A 2FRWA 4OMLA 1JXMA 3UF4A 1NYFA 3ZL7C 5ECAA 1X2KA 4KRTA
chains in the Genus database with same CATH superfamily
1XOVA 3VUBA 1U1TA 5KE3A 2OTLA 1YNZA 1GFDA 1PWTA 2L3SA 3MEUA 1TS9A 1S1NA 3QDRB 5FWCA 3I56Q 3H8ZA 4PJOD 4FIBA 3M58A 2RQRA 4C92G 1G2BA 2NUTA 1SG5A 4CI0C 2F2VA 1UJYA 3NPFA 2HKQB 2QEXA 1LOJA 4OP0A 3WVEB 1M90C 3UWNA 2D1XA 3E9GA 4C92B 1WHKA 3G4ST 3FB9A 2L0AA 2O2OA 2OAUA 4M75D 1YN8A 3OS1A 3OY9A 3MKDA 3OS0A 2CS7A 1B34B 2EWNA 5GAOl 4OMMA 2D6FA 5M9OA 2XDPA 3BFMA 2CSQA 1ZLMA 3MP1A 1GFCA 2QTXA 1B3QA 3LGFA 3OYLA 4ZTJA 1M3BA 1WNLA 3VS6A 1D0YA 2V8KA 3P8BB 2HSPA 2YSQA 2LJ3A 2F5KA 3JB9F 3CCSQ 1GCPA 2JN0A 3QUIA 2L3PA 4J9IA 3CCRQ 4X1VA 3TEEA 3CBOA 2VYTA 3VJPA 3LGLA 1VQ5A 2DL7A 4PLLA 3V8LA 1UHCA 3E2UA 4ZN1A 2LX9A 1NZ9A 1TUCA 2E5QA 2R5MA 2W0ZA 2QYZA 1N9SA 3I56T 2HCKA 4J8OA 2YLBA 3OMCA 4EDUA 2LNHB 1YFNA 4JJNK 5GANj 4HKEA 1D09B 5KYUA 5A2QE 1OI1A 3JCMd 2EQIA 1YIJQ 2J6KA 5IHNA 1QCFA 3QO3A 3CPWA 1HD3A 1KQ1A 1GCQC 1R77A 2EGAA 3JCMX 4IIMA 3QZ9B 2FZGB 2DD5A 4AFSC 1KD1R 4Y28E 1MMGA 1WQ7A 4PJMA 2FL7A 1UUEA 5CVIA 2QGGA 1GRIA 2DL8A 1JB0E 1WI7A 2DVEA 4D6WA 4L6V5 1Q86U 3OYAA 3CC7A 1PM3A 4J9GA 2DXBA 2NUZA 2QK0A 3MP6A 1Q81U 1Q7YR 2WSEE 4C92F 2B8AA 2J06A 3CCST 4NL3A 3CCRT 5CQXA 1M8MA 2DBKA 3A8GB 2M51A 2YRCA 1SKUB 4K11A 4OMPA 1UTIA 5LJ3g 4R0KA 2E65A 3JCMJ 3CCUQ 3OYMA 4M77D 1I81A 3FEOA 2CT3A 3QXEB 2X4XA 3ULRB 3OYBA 3MEVA 3CD6Q 2EKOA 5GAN5 1K73R 4GLMA 2CZ1B 3EGXB 2FRYA 1T0JA 3GF5A 1K9MU 1YIJT 2RH2A 2DIGA 4PJLA 1FYNA 2EYQA 5GAOm 1OX9A 3M53A 3S6WA 5FLXE 3HRTA 4IKFA 2HQXA 2JVVA 1KC8U 2BZYA 4M7AE 4RCBA 1LNXA 3A8LB 1RI0A 5FROA 4F17A 4XU3A 2EYXA 4FSSA 2A36A 3DB4A 1T3SA 2ROTA 4AG1C 5KYXA 3N5BB 1PC0A 2LQWA 2XHCA 2R5AA 2GCXA 2I0NA 3OBWA 1D0XA 2W10A 4FL6A 3META 1WJSA 4RTYA 2O9VA 3FLGA 1W2BS 4M7DE 1KHCA 4JS4A 2I2LA 5LJ5h 3M4YA 4C8QG 4ELZC 2AKLA 2EIFA 3CCUT 3JSCA 2DEQA 2KYBA 2Z0WA 2XIDA 5A0LA 1M90U 4KUDK 4A63B 4X34A 5AYFA 3CD6T 2OAWA 2X35A 5CAIA 1I5LA 8ATCB 4PJJA 2LNVA 4LD9K 4J6YA 1AHJB 3PIOA 1PSFA 2K5FA 4KUIA 3CMAQ 1PD1A 1VQ6A 1GXIE 4ZGDB 2M1HA 3GLXA 3MPUB 4M78D 5CKDA 3VS1A 2F5TX 5HCKA 4CC3A 4WTOB 3GBQA 3R6OA 3VS7A 4HVVA 1ZBJA 2A7YA 1WIEA 3HHTB 1RLPC 2YRVA 2KGTA 3RKYA 1AZEA 1IRXA 5CQYA 3RKXA 5J39A 5IHKA 4M77E 2QQ9A 1M27C 4BE1A 3THKA 1M4ZA 4J7IA 3QIIA 3OW2A 3CEYA 1MUZA 1XTDA 3SD4A 3FJPA 1TSFA 2RM4A 3PTAA 4M7AA 1G3TA 4LN2A 5KYYB 3VS0A 2VASA 3V8JA 3FJ5A 4A4EA 1F1BB 4J7FA 4PFPA 4R56A 1W2BP 1NJIR 4HA8A 2KK4A 4BDYA 5LJ5g 2AK5A 4N4GA 4JZ3A 4EMKA 1HSQA 1QP2A 4DEYA 1LJOA 3CC2Q 2H8HA 1WLPB 8AT1B 2PTKA 3CMAT 2HQHA 4M7DA 2ENMA 4HVUA 1JEGA 1QVPA 1ZHIA 1M3CA 3C94A 3TCJA 1YHQQ 2OTJA 2BIVA 1TTHB 3URGA 4FU6A 4HCBA 1WXTA 1Y71A 2EVRA 4LDYA 4MZMA 4C8QF 2KMTA 2FPDA 1FMVA 3RIRA 1BU1A 2HBPA 1CKBA 5LJ5e 4L59A 1N8RR 3EG3A 3GIBA 4OMNA 4PJNA 1T0HA 5D6WA 2DL4A 2XKOC 1D3BB 4E7JA 1RABB 1A0NB 3RR6A 2EJGA 1IZ6A 3CCVT 3CCJQ 1FWZA 1JXOA 1DJ7B 1TU0B 4M78E 4HCKA 1G83A 1VYTA 1VQ9A 2A37A 3JCMf 5KH6A 4M77A 1OZ3A 1VQNA 2MF2A 2RB6A 3OSVA 3WVDB 4ME7A 1KQ2A 1Q7YC 3CC2T 4IURA 5KYWA 1OEBA 1PKTA 3HL8A 4GY5A 3VS2A 1WJQA 2KEAA 3CQTA 4IUUA 5J26A 2M16A 3KFVA 4OGCA 5LJ3j 1PRMC 2LX7A 2FPFA 3MP8A 1YHQT 1YCYA 1JJ2S 2AT1B 3BW1A 3ZFJA 1VQNQ 1H3ZA 1VQKA 4LUEA 2BKDN 3NFCA 3GP8A 3CCEA 4PFZA 3UF4A 4JRQA 1K73C 3ZL7C 2RQWA 3JB9H 5GAMd 1QKXA 2CP7A 2FVUA 2DX1A 1VQKQ 3JCMc 4O5VA 3OS5A 3OYCA 4J6WA 3E1SA 5GANe 1VIFA 2DJZA 5J3BA 3CCJT 1OQKA 4PJOC 2CZ7B 1OOTA 5KYNA 3R6NA 2DF6A 2EYWA 4JZ4A 3TSWA 1XJWB 1R8OB 4O6JA 1K4US 4FSXA 2DVJA 2QI2A 4CRIA 4LE9A 2CUBA 2E4HA 5C0MA 5HK0A 2CH4W 4M75C 2KT8A 4AT1B 1OU9A 2IG0A 4XTXA 4M78A 4MZTA 4LUDA 1Y57A 2QTVA 1NEBA 1X6OA 2QG9B 3H6ZA 3EG2A 1IGQA 3OSSC 2H3EB 5CR2A 3EAEA 1BIAA 3JCMQ 2KR3A 2FEIA 3QPHA 3CC4A 2EQMA 3DLMA 3REBB 5GAOq 4E6RA 3EFOA 2ED1A 4ZN3A 1KK7A 3BE3A 4XAXB 3IQLA 1VIEA 3M0SA 2LMJA 4J9HA 4C0DC 2BE9B 4QVCA 4X9DA 1UE9A 2DZ9A 2KROA 1EFNA 2CP0A 4FYWB 4BUGA 2ZZDA 3JRZA 3RERA 3GNGA 4FYYB 3J80E 1M8VA 3REAB 1G5VA 5GANd 2K79A 2NYSA 5GAN6 2JT4A 4PKCC 1Y96B 1VQOA 5L23A 5DLOA 1YJ9Q 4JLIA 3L2VA 4C0ZA 2DYBA 2QDYB 4JRIA 3X28B 2GGRA 2LRQA 5FU6C 4IUPA 1WHJA 1R0BG 3M5AA 3EG9A 2COYA 1G8XA 1AEYA 2K3XA 2LT1A 4Y91A 2BZXA 2ZPIB 3OBYA 2A0FB 4MDXA 2GNCA 4M7AF 4UC4A 1N9RA 1VQMQ 3NHNA 4KH0B 5CIUA 2YXYA 2RK1A 1NJIC 2D0NA 2L89A 2DPPB 3G1JA 1VQPT 3D7SB 5FRMA 2ZPFB 4Z02A 1VQ4A 2RHZA 5AT1B 1ZBXA 1Z9QA 3U23A 2RN8A 2QASA 2DBMA 2EQUA 3LH0A 2HDAA 2QQBA 1AD5A 2MAMA 1SPKA 2CZ0B 3L2RA 3O5ZA 2L3RA 4M77C 4M7DF 2OTLQ 2MMPA 1YI2T 2E12A 3VS4A 1IHVA 4N4IA 4C5GA 4OB0B 3QSUA 2DFUA 3G71A 2PZ1A 2QEXQ 3UT1A 3SWNB 4L5GA 1TOVA 1YJ9T 3LYIA 5A0GA 1X75C 2OJ2A 1TH7A 2GTOA 2E70A 1NPRA 3I5SA 4TVRA 2V8JA 5GAN8 4A4GA 1AT1B 1K8AR 1M2VB 1ZUYA 5LJ3h 1ZSZB 3EH1A 1TXQA 2JUFA 2QQRA 5IXBA 3MO8A 2EPDA 1D1AA 1VQLA 3M4GA 2FO0A 4KT0E 3AHUA 1KQSA 1VQMT 2K57A 2OI3A 4FM4B 2PVGB 1QCOA 3DKMA 1AWXA 3UA7A 3X20B 1IREB 1X2QA 3I9QA 4KGVB 2M0YA 3KXTA 2BTTA 5L8RE 3UPUA 3O8VA 1VQ5Q 3RNJA 1OPKA 1WHHA 2KY9A 1UHFA 4JS5A 4C5IA 4IUVA 2OTLT 1SSFA 2CP3A 2CZ6B 1TUDA 1H641 4GBQA 1V29B 3BDUA 4VUBA 3OYKA 3P8HA 1AWJA 2E6NA 2VVKA 2CDTA 3NTIA 2QEXT 1S72A 3V7RA 1B7TA 3PVLA 2DK3A 4M78C 2Y4XA 3PGGA 4QQ6A 4XU2A 5FU7C 5KE2A 1V76A 3MCAB 4PJOE 1G3YA 2EAYA 4LDWA 1KJWA 1OPLA 2J7IA 3OW2S 1RACB 1WXUA 3CC7Q 1I0CA 1TWBA 3EHRA 2ZAEA 3JB9D 5EG2A 4QVZA 1CSKA 5GAMf 3EFSA 1QKWA 2KVQG 4M75E 5IXFA 2DO3A 4J5YA 1I4K1 3C12A 3PIPA 1NG2A 4BDZA 4OB1B 1M1KC 2DTHA 5A0DA 3OYDA 2ZPBB 1VQ5T 1OV3A 2F69A 1IHWA 2IIMA 2X4JA 1Q82C 2X4YA 2VXEA 2QDLA 2KI7A 1WJRA 3VV0A 3I55A 2QA4A 5GAN2 4M78F 2FZKB 1WHMA 2O4XA 4F04B 5LJ3e 2CH4A 1M1GA 2K5IA 4XK8E 1X69A 4CC2A 1QWFA 4Z88A 4CC7A 3LWIA 3M59A 4C0GA 3L2ZA 5GAOp 4GLKA 5D6XA 3I55Q 1VYUA 2QA4Q 4NS5A 1RAAB 1WYXA 3UDCA 1N5ZA 2JXBA 1ZX6A 5LL6S 2XDDA 5IT9E 4KGXB 1K0XA 3CC7T 1D3BA 4C92D 3CCLA 1RAHB 2LQ8A 3M0UA 3MEWA 5DY9A 3L2UA 2MK5A 4HCCA 1LVKA 2P0QA 4C8QB 1KSWA 1WX6A 1Q86R 1QVGA 4PJOA 2AZVA 5GAOn 1IO6A 1VUBA 1NPPA 3OS2A 2G6FX 1Q81R 2K7AA 3CCLQ 2EGEA 4M4ZA 3CXCS 2L5QA 5GANf 4QW2A 5KYUB 1BCMA 1RADB 2E6ZA 2DL5A 3Q1JA 4M75A 4D8DA 4JDSA 2HQEA 2ECZA 4EIKA 4F14A 2LQNA 5CK9A 3CCQA 1VQ7A 2CT4A 1UGPB 2WSFE 3CMEA 2GTJA 2QGFB 1VQ6Q 4FYXB 1UGVA 4CC4B 5GAN7 2QXFA 5EC7A 4ZGJB 4DOVA 4DOWA 2FRWA 2G3RA 4EMHA 4F7UE 1K9MR 1VQ8A 1JXMA 3ZBDA 1X2KA 5FRNA 1HK9A 4OMFB 3CCQQ 1VQ7Q 1V1CA 3CMEQ 1RUWA 2AZSA 4E7ZA 1QVFS 4OVAA 1K0SA 3CCMA 4HVWA 1KC8R 4D8KA 2NUPA 3PVQA 2GBQA 4OF1A 2XMFA 1PNJA 3SB2A 2MOXA 5CKHA 2MWPA 4C0FA 3AT1B 4BY6B 3QHSA 3A8OB 4FT2A 3CCLT 4E7HA 5CKEA 1MGQA 4RTTA 3CCMQ 1UGSB 3CXCP 2X4WA 4RG8A 1M1FA 2RHUA 3QJYA 3RBBB 4ANJA 1WFWA 2IPOB 2YDLA 4FT4A 2NWMA 1BB9A 4MZPA 5I21A 5CO7A 2F2WA 1VQ6T 2DL3A 3FDRA 2GFUA 3EH2A 4PL6A 1NLOC 2JM9A 3X26B 1OZ2A 3OQ5A 2OTJQ 2AHJB 2F2XA 5I22A 4OB2B 2DRKA 1PCXA 2D8HA 2YT6A 1KD1C 4N4HA 1KFZA 3CCQT 3HKSA 1O75A 3BDLA 3CMET 3G6EA 1M1KU 2DAQA 3H0FA 1YITA 1JRIA 2RHXA 2LJ0A 2PQWA 1VOMA 2CP5A 2YUQA 1MNDA 4E7LA 4IIOA 3OYGA 2PUKB 1Q82U 1BIBA 1QVFP 2CREA 1W2BA 4E7KA 4F7UA 4JRKA 2BE7D 2CKKA 5D7UA 1SSHA 3DLLA 4JJDA 1E6GA 1RAEB 1J3TA 4ORZA 1FXXA 4OGEA 1VQ9Q 1W1FA 1FMKA 3LX7A 3JCMP 3A98A 2SRCA 2VC8A 2ZPHB 1YJNA 3M55A 2EJ9A 1YJWA 2B86A 4LD6A 1U1SA 2NLUA 1C6VX 3HRSA 3EGDA 2P0PA 1D1BA 2V8IA 2HEQA 4WF2A 3V8KA 3G7ZA 2ABLA 1WHLA 4R55A 2K2MA 1NLPC 2OTJT 4JUVA 4RKUE 4C8QD 2Y4YA 5LJ5d 1NEGA 3S3MA 1BI2A 5GMKh 4M7AG 2JS0A 3CCEQ 1W4SA 1WQWA 2CSIA 2X3XD 2L8DA 2KRNA 3OYFA 4C92A 2FB7A 1K76A 1SF9A 1Y07A 1HYOA 5CKFA 2RJEA 4RTZA 5FWBA 4M7AB 2QQAA 4LDVA 3H41A 2KNBB 2ZPGB 3HTRA 1B34A 1EX4A 4C0DB 2LZ6B 4ZGEB 1X01A 2MYSA 3JCMh 4DQ2A 3OYHA 1YP5A 2DIQA 2P0KA 3MHXA 3SWNA 4M7DG 2X9HA 4EMKB 1VQ9T 1O9SA 3LLRA 1UECA 1U3OA 4JJBA 3X24B 3GNFB 1VQNT 4XU0A 2D8JA 4IUTA 1ZSZA 1RAFB 2A28A 1W6XA 4M7DB 2DNUA 3J81E 4B9WA 3VRYA 1JJ2P 2YUPA 1XNIA 1KQSS 3M54A 2RI5A 3HP9A 3A5ZB 2KSSA 2E5KA 3INZA 3UA6A 3VUZA 2JJ9A 4PJOF 1Q81C 2RMOA 1VQKT 1PD0A 3QWYA 5HY6A 2XU8A 3CPWS 3G4SA 2K6DA 4FYVB 2MIOA 3CCET 5I2SA 1MMDA 2EQKA 1W70A 3CC4Q 2HBWA 4EMGA 5IHIA 2DILA 2JOYA 4M75F 1E7OA 3QYHB 4M77G 1JO8A 2XDBA 1M3AA 1ACMB 4II1A 2LCSA 1KIKA 3C95A 4DBHA 2O9SA 2HD0A 4J9BA 2AKKA 1M9SA 3RKWA 4BE0A 1MNEA 4M77B 5I11A 1K9MC 1N27A 2BUDA 1D0ZA 1VA7A 3JCMg 2RQVA 2VWFA 5KYWB 1UJ0A 4QKUA 2DJQA 2EW3A 4QT7A 1SHGA 2FHDA 3JCMV 4LDXA 4NOYA 2E64A 3OYYA 2XICA 2KXDA 4LDUA 1VQOQ 2KT1A 2KDSA 4YTLA 3I56A 2DYIA 2DETA 1KD1U 1QWEA 2DD4A 5GAMj 4DEXA 1MMNA 2F1LA 1WZOA 4XTUA 1PSEA 2P4TA 4KBMB 3EGXA 5CKBA 4J9CA 1Y7XA 4PK4A 3JCMe 3CC4T 2EGCA 1VQ4Q 1D1CA 4XTWA 1Q7YU 4KGZB 3CPWP 1Y0MA 1I1JA 1QQJA 2QAZA 2EKHA 2K2VA 1OU8A 3T9NA 1NE8A 3EG0A 4B6MA 4PLIA 3WXMB 4ZNXA 1N8RC 1YCSB 2XD0A 3KBGA 5GJWB 1LCKA 3JAME 4AMCA 3LH5A 3CCSA 1WDXA 4P5NA 1ARKA 3CCRA 3JB9J 2IVWA 1HJDA 1AZGB 5KCOA 4M78G 4MMKA 3G71Q 1MV0B 1EIFA 2DE0X 1K73U 1AOJA 3HFNA 3RUXA 1RL2A 1VQOT 3FIFA 4J83A 2MPXC 4E7SA 4M78B 1X43A 2MCNA 3S3OA 2DTIA 2LC4A 2GFAA 4M77F 1I5OB 5FU7B 1SRMA 1T3LA 2RJFA 2FYKA 4M7AD 3HPWA 3PMTA 2JTEA 3M9QA 2RJCA 1YIJA 4F7UF 1QVGS 2VB6A 4C92C 4C8QA 2A3LA 2LTOA 1VQLQ 3J7AF 3EFOB 2H3JA 1OULA 4F16A 5I2MA 2C0TA 2YWWA 1ZA1B 1BI3A 1VQ4T 2Y90A 2J6OA 4BE2A 4RG2A 1CKAA 3VYHB 3QDFA 4DBRA 2JTMA 1H8KA 3ER0A 3SWNC 3UATA 4PFOA 4BD3A 4M7DD 4Z8AA 4A4FA 2RI3A 9ATCB 4AFUC 1IGUA 2DRMA 3P8DA 3C0CA 1RAGB 4RTVA 1I8FA 5HKCA 2VV5A 1ZSZC 1X27A 3LWHA 3L2QA 2JZ2A 5GMKl 2R58A 2JS2A 2X3WD 3PT9A 2E10A 1QMCA 3G71T 4JPBW 1VYVA 1S72Q 2AIRB 3E19A 1LPLA 4OMLA 3EG9B 2PU9B 3CCUA 2DKGA 5ECAA 5KYYA 4KRTA 3CD6A 2JM8A 2DTOA 4A4HA 1M5Q1 5LJ5f 4XQ3A 2JTFA 3EGUA 3VRZA 3VS3A 4HT9A 3ASKA 1VQLT 1GL5A 3CBMA 2DXCA 3RMQA 2LCLA 3A8HB 3V7CA 1QVGP 2JW4A 2NUTB 4FCYA 1BI0A 2RJDA 3DB3A 1UEBA 2M9UA 4XTVA 1MHNA 4LXCA 3M0TA 3L42A 1U8RA 3CPFA 1SHFA 1OX8A 3FRNA 4J6XA 4HCZA 3JV3A 2LP5A 2RK2A 1C0MA 4ESRA 3L2WA 3TU4K 1IXDA 4OMQA 3EHQA 3JCMW 2P84A 1NJIU 2VXFA 3JB9I 2LJ1A 1NYGA 1S72T 2E3HA 2HZYA 5GMKj 3RDVA 2BZ8A 3NGPA 1GBQA 3OW2P 2KXCA 3M56A 2VGMA 2J6FA 1M2OA 1WHGA 2PUOB 2KE9A 4RTXA 1Q95G 2EBPA 3HSBA 5GAMh 2CGHA 4XTZA 2VGNA 3PMIA 2EYZA 3RESA 2JMAA 1U06A 4FW2A 3CMAA 1AVZC 1JQQA 4E47A 1UFFA 2EJFA 2K3BA 2O01E 4RMOA 1N8RU 3ZEHA 3TVTA 1P92A 2D9TA 3I35A 2R57A 3TQ7P 4LNPA 3M0QA 4A53A 4RUGA 4J9FA 1R0CB 3NMZC 1MV3A 2L2PA 4AG2C 1GBRA 3SDZA 5LJ3d 5GMKm 3H0HA 2HSEB 2DA9A 2C0OA 3I55T 2GF7A 1ZQ1A 2QA4T 3QYGB 1BCOA 1XQHA 5FW9A 3PNWC 3MJXA 3QKJA 1AWWA 4BB7A 2O88A 2KAFA 3CCVA 2KQWA 2EYYA 7AT1B 2JMCA 3S3NA 4N0AA 2CUDA 4QQDA 3M0PA 2K5LA 4PNOA 4C8QC 2LDMA 2LVMA 2ZPEB 2FPEA 2RO0A 5IN1A 1VQ8Q 3CC2A 3OYNA 1ZUUA 2RD1A 1Z9ZA 1SRLA 3LW5E 3MEAA 4ELYC 1QLYA 1UDLA 3CCVQ 1K8AC 4QVDA 3OB9A 1BK2A 3KUFA 4J9EA 2ED0A 4RCCA 1WGSA 5GAMg 4BACA 1NBEB 2PVOB 2D0QB 2MWOA 2DERA 2CP6A 2DEUA 1YHQA 1QW1A 1QCNA 3VYGA 1X6BA 2JNGA 2YHTA 2LT4A 1PHTA 5GANh 3OMGA 5CCAA 2RQTA 3TSZA 3QZ5B 4C5EA 3OYEA 4C92E 2KYMA 2EFIA 2RPNA 1M90R 2O4XB 3I5RA 1BKBA 1WA7A 1PG5B 1YWPA 5GAOr 1RLQC 3SHWA 2DXTA 5HK3A 3OYIA 4X9CA 1UGRB 2KBTA 4A54A 1ZUKA 1H92A 2HAXA 2MI6A 3QWXX 4RTWA 5KYXB 1BBZA 1B07A 1UG1A 5GAMe 2V1RA 3CCJA 4C5HA 1VQ7T 2OX7A 3PE0A 4FW1A 5KCHA 1BI1A 3V7SA 4OMOA 3OYJA 2EQJA 1RI9A 1MMAA 2P4RA 1NM7A 2J05A 1WXBA 4JRPA 4BY6C 5DM7R 1E6HA 2E41A 1VQ8T 4PJOG 3NTHA 4DBFA 2KRMA 1QP3A 2E3IA 2RHYA 4NL2A 3G6EQ 1Y96A 4MMLA 4AFQC 2YUNA 1YITQ 1G3WA 4BI8B 4WCIA 1X6GA 2O31A 3JCMb 4PJOB 2PNIA 3GPLA 3VU3C 3CCMT 3BY7A 3QBYA 4V2SA 4M75G 3X25B 1KHIA 4AFZC 2L3QA 2X51A 1KG1A 3CXCA 2XK0A 3EG1A 4XU1A 2SEMA 1EZZB 5GJVB 5GANg 4M75B 4IUQA 4DA4A 2C0IA 2VKNA 2DMOA 4HT8A 1IB8A 2RQUA 4JJCA 1TG0A 2VUBA 1YJNQ 2DLPA 3NTKA 2ATCB 4A4KA 1PKSA 1YJWQ 1ABOA 3ME9A 3PFSA 1OYXA 2K4YA 2CYZB 2HNIA 2QQSA 1YWOA 1TUGB 4BI3A 2CP2A 2DXUA 1H3HA 1M30A 4XTYA 2WSCE 4QQGA 5GAN4 2RHIA 1HXDA 1FX7A 2RI2A 2WACA 3OA6A 1WPYA 3L1AA 4OB3B 1QVFA 2ZCFB 2V26A 1FMWA 3HRUA 3G6ET 2NUPB 2HKNA 1YITT 2YLCA 4BI4A 2GQVA 2LCCA 4Z89A 1GCQA 3A8MB 2COWA 3VKIA 4DBQA 1M2VA 3H0IA 2RF0A 2GQIA 1K9AA 1ZA2B 1M1KR 4J9DA 4KH1B 1VQPA 1ABQA 5GAN3 1C1AA 1RAIB 2RNAA 2K9GA 2ZGWA 1Q82R 1Q86C 1PRLC 2C06A 3SFMA 5FU6B 4Y92A 2A08A 3HFOA 2KRSA 4KULA 3TREA 1G3SA 4N0AC 3E9FA 1YJNT 2DZCA 2YUOA 1YJWT 2ESWA 2PVDB 5IH2A 1VQPQ 2M02A 5C6SA 1UGQB 1YI2A 1N6AA 2COZA 4ATOA 5GMKi 3M0RA 4M7AC 1K8AU 3JB9G 3F70A 2HL5C 2HL3A 4HXJA 2E1HA 5D6YA 1UB4A 3VS5A 1YJ9A 6AT1B 3EFRA 2V1QA 4F7UG 3SEMA 3G4SQ 3H9NA 3RMSA 4RTUA 4JLGA 1I07A 4EMKC 1YI2Q 3C4SA 1JBMA 4Q5WA 2YRDA 4E2FB 1YBYA 2FZCB 4MDWA 2XG8D 1JU5C 2DM1A 4F7UB 2LQKA 2M0OA 1K1ZA 4C8QE 2K3YA 4M7DC 1BYMA 3CBPA 3FC3A 3GOXA 3A1PA 2HMAA 1U5SA 1VQMA 4ZTFA 5LJ3f 3QJ6A 2RA2A 1SEMA 1KC8C 4B9XA 1ZSGA 2XI9A 5GMKe 1AWOA 1JJ2A 5DLQE 2ROLA 2FG0A 4E7IA 1KQSP 4EPCA 5IAYA 3M57A 1NYFA 3EGDB 3QG1A 5LJ5j
chains in the Genus database with same CATH topology
1XOVA 2JM8A 2RQWA 1V1CA 1YNZA 1GFDA 1PWTA 2L3SA 1QKXA 1RUWA 2AZSA 2DX1A 1K0SA 3EGUA 1S1NA 3VRZA 5FWCA 3VS3A 4HVWA 4D8KA 2RQRA 1GL5A 1G2BA 3PVQA 2F2VA 1UJYA 3NPFA 2GBQA 2XMFA 1OOTA 1PNJA 2MOXA 2JW4A 3R6NA 2DF6A 2EYWA 4JZ4A 3TSWA 2D1XA 1K4US 3M0TA 2DVJA 2L0AA 2O2OA 4LE9A 1YN8A 2CUBA 1SHFA 4RTTA 3JV3A 2CH4W 2KT8A 2LP5A 4OMMA 4ESRA 2CSQA 4OMQA 1ZLMA 1GFCA 1B3QA 3EHQA 3RBBB 1WFWA 1M3BA 2YDLA 3VS6A 2NWMA 1BB9A 4LUDA 2F2WA 1Y57A 1NEBA 2DL3A 2HSPA 2YSQA 1NLOC 2JM9A 2LJ1A 2LJ3A 3EG2A 1NYGA 1GCPA 2L3PA 4J9IA 4X1VA 2F2XA 5I22A 2KR3A 2FEIA 2BZ8A 2DRKA 3NGPA 1GBQA 3REBB 2KXCA 4E6RA 2DL7A 2ED1A 2D8HA 2YT6A 1UHCA 2J6FA 1KFZA 4RTXA 2KE9A 1TUCA 3IQLA 3M0SA 2LMJA 2EBPA 3H0FA 4J9HA 2W0ZA 2LJ0A 2EYZA 2HCKA 2YUQA 1UE9A 2JMAA 1U06A 2LNHB 2KROA 1EFNA 4IIOA 1AVZC 1JQQA 2CREA 1UFFA 2K3BA 2EQIA 2J6KA 5IHNA 1QCFA 1HD3A 1GCQC 2EGAA 4IIMA 1SSHA 4JJDA 3REAB 1E6GA 3TVTA 3I35A 2K79A 4AFSC 4LNPA 3M0QA 2JT4A 1J3TA 4ORZA 1UUEA 4RUGA 1W1FA 5L23A 4J9FA 1FMKA 1GRIA 2DL8A 2DYBA 3A98A 1MV3A 2L2PA 2GGRA 2SRCA 3NMZC 4AG2C 1WI7A 1GBRA 3H0HA 2B86A 2DA9A 2C0OA 4J9GA 1AEYA 2NUZA 2BZXA 5FW9A 2HEQA 2GNCA 2J06A 1AWWA 2ABLA 2O88A 2K2MA 3NHNA 1NLPC 2EYYA 1M8MA 2D0NA 2JMCA 2DBKA 2M51A 2CUDA 3M0PA 4K11A 1Z9QA 4OMPA 1NEGA 1UTIA 3U23A 4R0KA 2JS0A 2RN8A 2CSIA 2X3XD 2DBMA 2FPEA 2HDAA 1AD5A 2KRNA 1SPKA 1ZUUA 2CT3A 3ULRB 1Z9ZA 1SRLA 3O5ZA 1K76A 1QLYA 1UDLA 1BK2A 4RTZA 4J9EA 5FWBA 2ED0A 3H41A 4GLMA 2KNBB 2FRYA 1T0JA 3VS4A 2LZ6B 1X6BA 1YP5A 1PHTA 2PZ1A 1FYNA 2RQTA 3TSZA 1UECA 1U3OA 4JJBA 2OJ2A 2GTOA 2BZYA 2KYMA 2RPNA 2D8JA 3I5SA 3I5RA 4F17A 1WA7A 2A28A 1W6XA 1YWPA 1ZUYA 2EYXA 4FSSA 2A36A 1RLQC 3SHWA 2DNUA 3VRYA 1T3SA 2ROTA 4AG1C 2YUPA 5IXBA 2KBTA 2EPDA 1ZUKA 2LQWA 1H92A 2FO0A 3QWXX 2E5KA 4RTWA 1BBZA 1B07A 1UG1A 3UA6A 2V1RA 2I0NA 2OI3A 2W10A 3PE0A 2RMOA 4RTYA 1AWXA 2O9VA 4OMOA 3UA7A 3QWYA 1RI9A 1X2QA 3I9QA 2M0YA 2K6DA 2AKLA 2BTTA 1NM7A 2MIOA 2J05A 1WXBA 2P4RA 1W70A 2KYBA 1E6HA 2HBWA 5IHIA 2DILA 3RNJA 4A63B 1OPKA 1E7OA 2KRMA 2OAWA 1UHFA 1JO8A 4AFQC 2YUNA 1M3AA 1TUDA 4WCIA 4GBQA 1X6GA 2O31A 2LCSA 2PNIA 1KIKA 2O9SA 1AWJA 2VVKA 4J9BA 2AKKA 2CDTA 3VS1A 5I11A 5HCKA 4CC3A 3GBQA 3PVLA 3VS7A 4AFZC 2L3QA 1VA7A 4HVVA 1ZBJA 2RQVA 3EG1A 2VWFA 1UJ0A 2SEMA 2DJQA 2EW3A 5GJVB 4QT7A 1WIEA 1SHGA 1RLPC 2KGTA 1AZEA 2KXDA 2C0IA 2VKNA 2KT1A 2DMOA 1KJWA 1OPLA 2RQUA 2J7IA 4JJCA 1TG0A 5IHKA 2DLPA 1PKSA 1ABOA 1M27C 1QWEA 1WXUA 1I0CA 3THKA 3EHRA 1MUZA 1YWOA 1CSKA 4DEXA 1QKWA 5IXFA 1H3HA 1NG2A 4LN2A 1M30A 3VS0A 4J9CA 3FJ5A 2EGCA 1OV3A 2IIMA 1Y0MA 1I1JA 2AK5A 2EKHA 2QDLA 4JZ3A 1HSQA 4DEYA 3EG0A 2H8HA 4Z89A 1GCQA 1WLPB 4ZNXA 1YCSB 2PTKA 5GJWB 1LCKA 2CH4A 3H0IA 2ENMA 2RF0A 4HVUA 1JEGA 2GQIA 3LH5A 1K9AA 1WDXA 1X69A 4CC2A 1M3CA 1ARKA 1QWFA 4Z88A 1HJDA 1AZGB 4J9DA 4CC7A 1WXTA 1ABQA 2EVRA 1MV0B 2DE0X 2RNAA 1AOJA 2K9GA 2FPDA 1VYUA 1PRLC 1BU1A 4Y92A 2A08A 1WYXA 2KRSA 1N5ZA 2JXBA 1CKBA 1ZX6A 1X43A 2MCNA 2YUOA 2ESWA 3EG3A 1K0XA 4OMNA 1T0HA 2DL4A 5IH2A 1SRMA 1T3LA 2JTEA 3M0UA 1A0NB 3M0RA 4F16A 2C0TA 4HXJA 1JXOA 1KSWA 1WX6A 4HCKA 1G83A 2AZVA 1VYTA 1IO6A 2J6OA 3VS5A 1CKAA 2A37A 2G6FX 2V1QA 2K7AA 1H8KA 3SEMA 2EGEA 4RTUA 4M4ZA 3UATA 1I07A 4Z8AA 1OEBA 1PKTA 4AFUC 3VS2A 2DL5A 2DRMA 4D8DA 3C0CA 1JU5C 2KEAA 2DM1A 3CQTA 2ECZA 4RTVA 1K1ZA 1X27A 3KFVA 4EIKA 4F14A 1PRMC 2LX7A 1U5SA 2LQNA 2FPFA 2JS2A 2CT4A 2X3WD 1SEMA 2GTJA 1UGVA 4CC4B 1ZSGA 4JPBW 4LUEA 5EC7A 1VYVA 1AWOA 2ROLA 2FG0A 2FRWA 4OMLA 1JXMA 3UF4A 1NYFA 3ZL7C 5ECAA 1X2KA 4KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOV A;  2JM8 A;  2RQW A;  1V1C A;  1YNZ A;  1GFD A;  1PWT A;  2L3S A;  1QKX A;  1RUW A;  2AZS A;  2DX1 A;  1K0S A;  3EGU A;  1S1N A;  3VRZ A;  5FWC A;  3VS3 A;  4HVW A;  4D8K A;  2RQR A;  1GL5 A;  1G2B A;  3PVQ A;  2F2V A;  1UJY A;  3NPF A;  2GBQ A;  2XMF A;  1OOT A;  1PNJ A;  2MOX A;  2JW4 A;  3R6N A;  2DF6 A;  2EYW A;  4JZ4 A;  3TSW A;  2D1X A;  1K4U S;  3M0T A;  2DVJ A;  2L0A A;  2O2O A;  4LE9 A;  1YN8 A;  2CUB A;  1SHF A;  4RTT A;  3JV3 A;  2CH4 W;  2KT8 A;  2LP5 A;  4OMM A;  4ESR A;  2CSQ A;  4OMQ A;  1ZLM A;  1GFC A;  1B3Q A;  3EHQ A;  3RBB B;  1WFW A;  1M3B A;  2YDL A;  3VS6 A;  2NWM A;  1BB9 A;  4LUD A;  2F2W A;  1Y57 A;  1NEB A;  2DL3 A;  2HSP A;  2YSQ A;  1NLO C;  2JM9 A;  2LJ1 A;  2LJ3 A;  3EG2 A;  1NYG A;  1GCP A;  2L3P A;  4J9I A;  4X1V A;  2F2X A;  5I22 A;  2KR3 A;  2FEI A;  2BZ8 A;  2DRK A;  3NGP A;  1GBQ A;  3REB B;  2KXC A;  4E6R A;  2DL7 A;  2ED1 A;  2D8H A;  2YT6 A;  1UHC A;  2J6F A;  1KFZ A;  4RTX A;  2KE9 A;  1TUC A;  3IQL A;  3M0S A;  2LMJ A;  2EBP A;  3H0F A;  4J9H A;  2W0Z A;  2LJ0 A;  2EYZ A;  2HCK A;  2YUQ A;  1UE9 A;  2JMA A;  1U06 A;  2LNH B;  2KRO A;  1EFN A;  4IIO A;  1AVZ C;  1JQQ A;  2CRE A;  1UFF A;  2K3B A;  2EQI A;  2J6K A;  5IHN A;  1QCF A;  1HD3 A;  1GCQ C;  2EGA A;  4IIM A;  1SSH A;  4JJD A;  3REA B;  1E6G A;  3TVT A;  3I35 A;  2K79 A;  4AFS C;  4LNP A;  3M0Q A;  2JT4 A;  1J3T A;  4ORZ A;  1UUE A;  4RUG A;  1W1F A;  5L23 A;  4J9F A;  1FMK A;  1GRI A;  2DL8 A;  2DYB A;  3A98 A;  1MV3 A;  2L2P A;  2GGR A;  2SRC A;  3NMZ C;  4AG2 C;  1WI7 A;  1GBR A;  3H0H A;  2B86 A;  2DA9 A;  2C0O A;  4J9G A;  1AEY A;  2NUZ A;  2BZX A;  5FW9 A;  2HEQ A;  2GNC A;  2J06 A;  1AWW A;  2ABL A;  2O88 A;  2K2M A;  3NHN A;  1NLP C;  2EYY A;  1M8M A;  2D0N A;  2JMC A;  2DBK A;  2M51 A;  2CUD A;  3M0P A;  4K11 A;  1Z9Q A;  4OMP A;  1NEG A;  1UTI A;  3U23 A;  4R0K A;  2JS0 A;  2RN8 A;  2CSI A;  2X3X D;  2DBM A;  2FPE A;  2HDA A;  1AD5 A;  2KRN A;  1SPK A;  1ZUU A;  2CT3 A;  3ULR B;  1Z9Z A;  1SRL A;  3O5Z A;  1K76 A;  1QLY A;  1UDL A;  1BK2 A;  4RTZ A;  4J9E A;  5FWB A;  2ED0 A;  3H41 A;  4GLM A;  2KNB B;  2FRY A;  1T0J A;  3VS4 A;  2LZ6 B;  1X6B A;  1YP5 A;  1PHT A;  2PZ1 A;  1FYN A;  2RQT A;  3TSZ A;  1UEC A;  1U3O A;  4JJB A;  2OJ2 A;  2GTO A;  2BZY A;  2KYM A;  2RPN A;  2D8J A;  3I5S A;  3I5R A;  4F17 A;  1WA7 A;  2A28 A;  1W6X A;  1YWP A;  1ZUY A;  2EYX A;  4FSS A;  2A36 A;  1RLQ C;  3SHW A;  2DNU A;  3VRY A;  1T3S A;  2ROT A;  4AG1 C;  2YUP A;  5IXB A;  2KBT A;  2EPD A;  1ZUK A;  2LQW A;  1H92 A;  2FO0 A;  3QWX X;  2E5K A;  4RTW A;  1BBZ A;  1B07 A;  1UG1 A;  3UA6 A;  2V1R A;  2I0N A;  2OI3 A;  2W10 A;  3PE0 A;  2RMO A;  4RTY A;  1AWX A;  2O9V A;  4OMO A;  3UA7 A;  3QWY A;  1RI9 A;  1X2Q A;  3I9Q A;  2M0Y A;  2K6D A;  2AKL A;  2BTT A;  1NM7 A;  2MIO A;  2J05 A;  1WXB A;  2P4R A;  1W70 A;  2KYB A;  1E6H A;  2HBW A;  5IHI A;  2DIL A;  3RNJ A;  4A63 B;  1OPK A;  1E7O A;  2KRM A;  2OAW A;  1UHF A;  1JO8 A;  4AFQ C;  2YUN A;  1M3A A;  1TUD A;  4WCI A;  4GBQ A;  1X6G A;  2O31 A;  2LCS A;  2PNI A;  1KIK A;  2O9S A;  1AWJ A;  2VVK A;  4J9B A;  2AKK A;  2CDT A;  3VS1 A;  5I11 A;  5HCK A;  4CC3 A;  3GBQ A;  3PVL A;  3VS7 A;  4AFZ C;  2L3Q A;  1VA7 A;  4HVV A;  1ZBJ A;  2RQV A;  3EG1 A;  2VWF A;  1UJ0 A;  2SEM A;  2DJQ A;  2EW3 A;  5GJV B;  4QT7 A;  1WIE A;  1SHG A;  1RLP C;  2KGT A;  1AZE A;  2KXD A;  2C0I A;  2VKN A;  2KT1 A;  2DMO A;  1KJW A;  1OPL A;  2RQU A;  2J7I A;  4JJC A;  1TG0 A;  5IHK A;  2DLP A;  1PKS A;  1ABO A;  1M27 C;  1QWE A;  1WXU A;  1I0C A;  3THK A;  3EHR A;  1MUZ A;  1YWO A;  1CSK A;  4DEX A;  1QKW A;  5IXF A;  1H3H A;  1NG2 A;  4LN2 A;  1M30 A;  3VS0 A;  4J9C A;  3FJ5 A;  2EGC A;  1OV3 A;  2IIM A;  1Y0M A;  1I1J A;  2AK5 A;  2EKH A;  2QDL A;  4JZ3 A;  1HSQ A;  4DEY A;  3EG0 A;  2H8H A;  4Z89 A;  1GCQ A;  1WLP B;  4ZNX A;  1YCS B;  2PTK A;  5GJW B;  1LCK A;  2CH4 A;  3H0I A;  2ENM A;  2RF0 A;  4HVU A;  1JEG A;  2GQI A;  3LH5 A;  1K9A A;  1WDX A;  1X69 A;  4CC2 A;  1M3C A;  1ARK A;  1QWF A;  4Z88 A;  1HJD A;  1AZG B;  4J9D A;  4CC7 A;  1WXT A;  1ABQ A;  2EVR A;  1MV0 B;  2DE0 X;  2RNA A;  1AOJ A;  2K9G A;  2FPD A;  1VYU A;  1PRL C;  1BU1 A;  4Y92 A;  2A08 A;  1WYX A;  2KRS A;  1N5Z A;  2JXB A;  1CKB A;  1ZX6 A;  1X43 A;  2MCN A;  2YUO A;  2ESW A;  3EG3 A;  1K0X A;  4OMN A;  1T0H A;  2DL4 A;  5IH2 A;  1SRM A;  1T3L A;  2JTE A;  3M0U A;  1A0N B;  3M0R A;  4F16 A;  2C0T A;  4HXJ A;  1JXO A;  1KSW A;  1WX6 A;  4HCK A;  1G83 A;  2AZV A;  1VYT A;  1IO6 A;  2J6O A;  3VS5 A;  1CKA A;  2A37 A;  2G6F X;  2V1Q A;  2K7A A;  1H8K A;  3SEM A;  2EGE A;  4RTU A;  4M4Z A;  3UAT A;  1I07 A;  4Z8A A;  1OEB A;  1PKT A;  4AFU C;  3VS2 A;  2DL5 A;  2DRM A;  4D8D A;  3C0C A;  1JU5 C;  2KEA A;  2DM1 A;  3CQT A;  2ECZ A;  4RTV A;  1K1Z A;  1X27 A;  3KFV A;  4EIK A;  4F14 A;  1PRM C;  2LX7 A;  1U5S A;  2LQN A;  2FPF A;  2JS2 A;  2CT4 A;  2X3W D;  1SEM A;  2GTJ A;  1UGV A;  4CC4 B;  1ZSG A;  4JPB W;  4LUE A;  5EC7 A;  1VYV A;  1AWO A;  2ROL A;  2FG0 A;  2FRW A;  4OML A;  1JXM A;  3UF4 A;  1NYF A;  3ZL7 C;  5ECA A;  1X2K A;  4KRT A; 
#chains in the Genus database with same CATH topology
 1XOV A;  3VUB A;  1U1T A;  5KE3 A;  2OTL A;  1YNZ A;  1GFD A;  1PWT A;  2L3S A;  3MEU A;  1TS9 A;  1S1N A;  3QDR B;  5FWC A;  3I56 Q;  3H8Z A;  4PJO D;  4FIB A;  3M58 A;  2RQR A;  4C92 G;  1G2B A;  2NUT A;  1SG5 A;  4CI0 C;  2F2V A;  1UJY A;  3NPF A;  2HKQ B;  2QEX A;  1LOJ A;  4OP0 A;  3WVE B;  1M90 C;  3UWN A;  2D1X A;  3E9G A;  4C92 B;  1WHK A;  3G4S T;  3FB9 A;  2L0A A;  2O2O A;  2OAU A;  4M75 D;  1YN8 A;  3OS1 A;  3OY9 A;  3MKD A;  3OS0 A;  2CS7 A;  1B34 B;  2EWN A;  5GAO l;  4OMM A;  2D6F A;  5M9O A;  2XDP A;  3BFM A;  2CSQ A;  1ZLM A;  3MP1 A;  1GFC A;  2QTX A;  1B3Q A;  3LGF A;  3OYL A;  4ZTJ A;  1M3B A;  1WNL A;  3VS6 A;  1D0Y A;  2V8K A;  3P8B B;  2HSP A;  2YSQ A;  2LJ3 A;  2F5K A;  3JB9 F;  3CCS Q;  1GCP A;  2JN0 A;  3QUI A;  2L3P A;  4J9I A;  3CCR Q;  4X1V A;  3TEE A;  3CBO A;  2VYT A;  3VJP A;  3LGL A;  1VQ5 A;  2DL7 A;  4PLL A;  3V8L A;  1UHC A;  3E2U A;  4ZN1 A;  2LX9 A;  1NZ9 A;  1TUC A;  2E5Q A;  2R5M A;  2W0Z A;  2QYZ A;  1N9S A;  3I56 T;  2HCK A;  4J8O A;  2YLB A;  3OMC A;  4EDU A;  2LNH B;  1YFN A;  4JJN K;  5GAN j;  4HKE A;  1D09 B;  5KYU A;  5A2Q E;  1OI1 A;  3JCM d;  2EQI A;  1YIJ Q;  2J6K A;  5IHN A;  1QCF A;  3QO3 A;  3CPW A;  1HD3 A;  1KQ1 A;  1GCQ C;  1R77 A;  2EGA A;  3JCM X;  4IIM A;  3QZ9 B;  2FZG B;  2DD5 A;  4AFS C;  1KD1 R;  4Y28 E;  1MMG A;  1WQ7 A;  4PJM A;  2FL7 A;  1UUE A;  5CVI A;  2QGG A;  1GRI A;  2DL8 A;  1JB0 E;  1WI7 A;  2DVE A;  4D6W A;  4L6V 5;  1Q86 U;  3OYA A;  3CC7 A;  1PM3 A;  4J9G A;  2DXB A;  2NUZ A;  2QK0 A;  3MP6 A;  1Q81 U;  1Q7Y R;  2WSE E;  4C92 F;  2B8A A;  2J06 A;  3CCS T;  4NL3 A;  3CCR T;  5CQX A;  1M8M A;  2DBK A;  3A8G B;  2M51 A;  2YRC A;  1SKU B;  4K11 A;  4OMP A;  1UTI A;  5LJ3 g;  4R0K A;  2E65 A;  3JCM J;  3CCU Q;  3OYM A;  4M77 D;  1I81 A;  3FEO A;  2CT3 A;  3QXE B;  2X4X A;  3ULR B;  3OYB A;  3MEV A;  3CD6 Q;  2EKO A;  5GAN 5;  1K73 R;  4GLM A;  2CZ1 B;  3EGX B;  2FRY A;  1T0J A;  3GF5 A;  1K9M U;  1YIJ T;  2RH2 A;  2DIG A;  4PJL A;  1FYN A;  2EYQ A;  5GAO m;  1OX9 A;  3M53 A;  3S6W A;  5FLX E;  3HRT A;  4IKF A;  2HQX A;  2JVV A;  1KC8 U;  2BZY A;  4M7A E;  4RCB A;  1LNX A;  3A8L B;  1RI0 A;  5FRO A;  4F17 A;  4XU3 A;  2EYX A;  4FSS A;  2A36 A;  3DB4 A;  1T3S A;  2ROT A;  4AG1 C;  5KYX A;  3N5B B;  1PC0 A;  2LQW A;  2XHC A;  2R5A A;  2GCX A;  2I0N A;  3OBW A;  1D0X A;  2W10 A;  4FL6 A;  3MET A;  1WJS A;  4RTY A;  2O9V A;  3FLG A;  1W2B S;  4M7D E;  1KHC A;  4JS4 A;  2I2L A;  5LJ5 h;  3M4Y A;  4C8Q G;  4ELZ C;  2AKL A;  2EIF A;  3CCU T;  3JSC A;  2DEQ A;  2KYB A;  2Z0W A;  2XID A;  5A0L A;  1M90 U;  4KUD K;  4A63 B;  4X34 A;  5AYF A;  3CD6 T;  2OAW A;  2X35 A;  5CAI A;  1I5L A;  8ATC B;  4PJJ A;  2LNV A;  4LD9 K;  4J6Y A;  1AHJ B;  3PIO A;  1PSF A;  2K5F A;  4KUI A;  3CMA Q;  1PD1 A;  1VQ6 A;  1GXI E;  4ZGD B;  2M1H A;  3GLX A;  3MPU B;  4M78 D;  5CKD A;  3VS1 A;  2F5T X;  5HCK A;  4CC3 A;  4WTO B;  3GBQ A;  3R6O A;  3VS7 A;  4HVV A;  1ZBJ A;  2A7Y A;  1WIE A;  3HHT B;  1RLP C;  2YRV A;  2KGT A;  3RKY A;  1AZE A;  1IRX A;  5CQY A;  3RKX A;  5J39 A;  5IHK A;  4M77 E;  2QQ9 A;  1M27 C;  4BE1 A;  3THK A;  1M4Z A;  4J7I A;  3QII A;  3OW2 A;  3CEY A;  1MUZ A;  1XTD A;  3SD4 A;  3FJP A;  1TSF A;  2RM4 A;  3PTA A;  4M7A A;  1G3T A;  4LN2 A;  5KYY B;  3VS0 A;  2VAS A;  3V8J A;  3FJ5 A;  4A4E A;  1F1B B;  4J7F A;  4PFP A;  4R56 A;  1W2B P;  1NJI R;  4HA8 A;  2KK4 A;  4BDY A;  5LJ5 g;  2AK5 A;  4N4G A;  4JZ3 A;  4EMK A;  1HSQ A;  1QP2 A;  4DEY A;  1LJO A;  3CC2 Q;  2H8H A;  1WLP B;  8AT1 B;  2PTK A;  3CMA T;  2HQH A;  4M7D A;  2ENM A;  4HVU A;  1JEG A;  1QVP A;  1ZHI A;  1M3C A;  3C94 A;  3TCJ A;  1YHQ Q;  2OTJ A;  2BIV A;  1TTH B;  3URG A;  4FU6 A;  4HCB A;  1WXT A;  1Y71 A;  2EVR A;  4LDY A;  4MZM A;  4C8Q F;  2KMT A;  2FPD A;  1FMV A;  3RIR A;  1BU1 A;  2HBP A;  1CKB A;  5LJ5 e;  4L59 A;  1N8R R;  3EG3 A;  3GIB A;  4OMN A;  4PJN A;  1T0H A;  5D6W A;  2DL4 A;  2XKO C;  1D3B B;  4E7J A;  1RAB B;  1A0N B;  3RR6 A;  2EJG A;  1IZ6 A;  3CCV T;  3CCJ Q;  1FWZ A;  1JXO A;  1DJ7 B;  1TU0 B;  4M78 E;  4HCK A;  1G83 A;  1VYT A;  1VQ9 A;  2A37 A;  3JCM f;  5KH6 A;  4M77 A;  1OZ3 A;  1VQN A;  2MF2 A;  2RB6 A;  3OSV A;  3WVD B;  4ME7 A;  1KQ2 A;  1Q7Y C;  3CC2 T;  4IUR A;  5KYW A;  1OEB A;  1PKT A;  3HL8 A;  4GY5 A;  3VS2 A;  1WJQ A;  2KEA A;  3CQT A;  4IUU A;  5J26 A;  2M16 A;  3KFV A;  4OGC A;  5LJ3 j;  1PRM C;  2LX7 A;  2FPF A;  3MP8 A;  1YHQ T;  1YCY A;  1JJ2 S;  2AT1 B;  3BW1 A;  3ZFJ A;  1VQN Q;  1H3Z A;  1VQK A;  4LUE A;  2BKD N;  3NFC A;  3GP8 A;  3CCE A;  4PFZ A;  3UF4 A;  4JRQ A;  1K73 C;  3ZL7 C;  2RQW A;  3JB9 H;  5GAM d;  1QKX A;  2CP7 A;  2FVU A;  2DX1 A;  1VQK Q;  3JCM c;  4O5V A;  3OS5 A;  3OYC A;  4J6W A;  3E1S A;  5GAN e;  1VIF A;  2DJZ A;  5J3B A;  3CCJ T;  1OQK A;  4PJO C;  2CZ7 B;  1OOT A;  5KYN A;  3R6N A;  2DF6 A;  2EYW A;  4JZ4 A;  3TSW A;  1XJW B;  1R8O B;  4O6J A;  1K4U S;  4FSX A;  2DVJ A;  2QI2 A;  4CRI A;  4LE9 A;  2CUB A;  2E4H A;  5C0M A;  5HK0 A;  2CH4 W;  4M75 C;  2KT8 A;  4AT1 B;  1OU9 A;  2IG0 A;  4XTX A;  4M78 A;  4MZT A;  4LUD A;  1Y57 A;  2QTV A;  1NEB A;  1X6O A;  2QG9 B;  3H6Z A;  3EG2 A;  1IGQ A;  3OSS C;  2H3E B;  5CR2 A;  3EAE A;  1BIA A;  3JCM Q;  2KR3 A;  2FEI A;  3QPH A;  3CC4 A;  2EQM A;  3DLM A;  3REB B;  5GAO q;  4E6R A;  3EFO A;  2ED1 A;  4ZN3 A;  1KK7 A;  3BE3 A;  4XAX B;  3IQL A;  1VIE A;  3M0S A;  2LMJ A;  4J9H A;  4C0D C;  2BE9 B;  4QVC A;  4X9D A;  1UE9 A;  2DZ9 A;  2KRO A;  1EFN A;  2CP0 A;  4FYW B;  4BUG A;  2ZZD A;  3JRZ A;  3RER A;  3GNG A;  4FYY B;  3J80 E;  1M8V A;  3REA B;  1G5V A;  5GAN d;  2K79 A;  2NYS A;  5GAN 6;  2JT4 A;  4PKC C;  1Y96 B;  1VQO A;  5L23 A;  5DLO A;  1YJ9 Q;  4JLI A;  3L2V A;  4C0Z A;  2DYB A;  2QDY B;  4JRI A;  3X28 B;  2GGR A;  2LRQ A;  5FU6 C;  4IUP A;  1WHJ A;  1R0B G;  3M5A A;  3EG9 A;  2COY A;  1G8X A;  1AEY A;  2K3X A;  2LT1 A;  4Y91 A;  2BZX A;  2ZPI B;  3OBY A;  2A0F B;  4MDX A;  2GNC A;  4M7A F;  4UC4 A;  1N9R A;  1VQM Q;  3NHN A;  4KH0 B;  5CIU A;  2YXY A;  2RK1 A;  1NJI C;  2D0N A;  2L89 A;  2DPP B;  3G1J A;  1VQP T;  3D7S B;  5FRM A;  2ZPF B;  4Z02 A;  1VQ4 A;  2RHZ A;  5AT1 B;  1ZBX A;  1Z9Q A;  3U23 A;  2RN8 A;  2QAS A;  2DBM A;  2EQU A;  3LH0 A;  2HDA A;  2QQB A;  1AD5 A;  2MAM A;  1SPK A;  2CZ0 B;  3L2R A;  3O5Z A;  2L3R A;  4M77 C;  4M7D F;  2OTL Q;  2MMP A;  1YI2 T;  2E12 A;  3VS4 A;  1IHV A;  4N4I A;  4C5G A;  4OB0 B;  3QSU A;  2DFU A;  3G71 A;  2PZ1 A;  2QEX Q;  3UT1 A;  3SWN B;  4L5G A;  1TOV A;  1YJ9 T;  3LYI A;  5A0G A;  1X75 C;  2OJ2 A;  1TH7 A;  2GTO A;  2E70 A;  1NPR A;  3I5S A;  4TVR A;  2V8J A;  5GAN 8;  4A4G A;  1AT1 B;  1K8A R;  1M2V B;  1ZUY A;  5LJ3 h;  1ZSZ B;  3EH1 A;  1TXQ A;  2JUF A;  2QQR A;  5IXB A;  3MO8 A;  2EPD A;  1D1A A;  1VQL A;  3M4G A;  2FO0 A;  4KT0 E;  3AHU A;  1KQS A;  1VQM T;  2K57 A;  2OI3 A;  4FM4 B;  2PVG B;  1QCO A;  3DKM A;  1AWX A;  3UA7 A;  3X20 B;  1IRE B;  1X2Q A;  3I9Q A;  4KGV B;  2M0Y A;  3KXT A;  2BTT A;  5L8R E;  3UPU A;  3O8V A;  1VQ5 Q;  3RNJ A;  1OPK A;  1WHH A;  2KY9 A;  1UHF A;  4JS5 A;  4C5I A;  4IUV A;  2OTL T;  1SSF A;  2CP3 A;  2CZ6 B;  1TUD A;  1H64 1;  4GBQ A;  1V29 B;  3BDU A;  4VUB A;  3OYK A;  3P8H A;  1AWJ A;  2E6N A;  2VVK A;  2CDT A;  3NTI A;  2QEX T;  1S72 A;  3V7R A;  1B7T A;  3PVL A;  2DK3 A;  4M78 C;  2Y4X A;  3PGG A;  4QQ6 A;  4XU2 A;  5FU7 C;  5KE2 A;  1V76 A;  3MCA B;  4PJO E;  1G3Y A;  2EAY A;  4LDW A;  1KJW A;  1OPL A;  2J7I A;  3OW2 S;  1RAC B;  1WXU A;  3CC7 Q;  1I0C A;  1TWB A;  3EHR A;  2ZAE A;  3JB9 D;  5EG2 A;  4QVZ A;  1CSK A;  5GAM f;  3EFS A;  1QKW A;  2KVQ G;  4M75 E;  5IXF A;  2DO3 A;  4J5Y A;  1I4K 1;  3C12 A;  3PIP A;  1NG2 A;  4BDZ A;  4OB1 B;  1M1K C;  2DTH A;  5A0D A;  3OYD A;  2ZPB B;  1VQ5 T;  1OV3 A;  2F69 A;  1IHW A;  2IIM A;  2X4J A;  1Q82 C;  2X4Y A;  2VXE A;  2QDL A;  2KI7 A;  1WJR A;  3VV0 A;  3I55 A;  2QA4 A;  5GAN 2;  4M78 F;  2FZK B;  1WHM A;  2O4X A;  4F04 B;  5LJ3 e;  2CH4 A;  1M1G A;  2K5I A;  4XK8 E;  1X69 A;  4CC2 A;  1QWF A;  4Z88 A;  4CC7 A;  3LWI A;  3M59 A;  4C0G A;  3L2Z A;  5GAO p;  4GLK A;  5D6X A;  3I55 Q;  1VYU A;  2QA4 Q;  4NS5 A;  1RAA B;  1WYX A;  3UDC A;  1N5Z A;  2JXB A;  1ZX6 A;  5LL6 S;  2XDD A;  5IT9 E;  4KGX B;  1K0X A;  3CC7 T;  1D3B A;  4C92 D;  3CCL A;  1RAH B;  2LQ8 A;  3M0U A;  3MEW A;  5DY9 A;  3L2U A;  2MK5 A;  4HCC A;  1LVK A;  2P0Q A;  4C8Q B;  1KSW A;  1WX6 A;  1Q86 R;  1QVG A;  4PJO A;  2AZV A;  5GAO n;  1IO6 A;  1VUB A;  1NPP A;  3OS2 A;  2G6F X;  1Q81 R;  2K7A A;  3CCL Q;  2EGE A;  4M4Z A;  3CXC S;  2L5Q A;  5GAN f;  4QW2 A;  5KYU B;  1BCM A;  1RAD B;  2E6Z A;  2DL5 A;  3Q1J A;  4M75 A;  4D8D A;  4JDS A;  2HQE A;  2ECZ A;  4EIK A;  4F14 A;  2LQN A;  5CK9 A;  3CCQ A;  1VQ7 A;  2CT4 A;  1UGP B;  2WSF E;  3CME A;  2GTJ A;  2QGF B;  1VQ6 Q;  4FYX B;  1UGV A;  4CC4 B;  5GAN 7;  2QXF A;  5EC7 A;  4ZGJ B;  4DOV A;  4DOW A;  2FRW A;  2G3R A;  4EMH A;  4F7U E;  1K9M R;  1VQ8 A;  1JXM A;  3ZBD A;  1X2K A;  5FRN A;  1HK9 A;  4OMF B;  3CCQ Q;  1VQ7 Q;  1V1C A;  3CME Q;  1RUW A;  2AZS A;  4E7Z A;  1QVF S;  4OVA A;  1K0S A;  3CCM A;  4HVW A;  1KC8 R;  4D8K A;  2NUP A;  3PVQ A;  2GBQ A;  4OF1 A;  2XMF A;  1PNJ A;  3SB2 A;  2MOX A;  5CKH A;  2MWP A;  4C0F A;  3AT1 B;  4BY6 B;  3QHS A;  3A8O B;  4FT2 A;  3CCL T;  4E7H A;  5CKE A;  1MGQ A;  4RTT A;  3CCM Q;  1UGS B;  3CXC P;  2X4W A;  4RG8 A;  1M1F A;  2RHU A;  3QJY A;  3RBB B;  4ANJ A;  1WFW A;  2IPO B;  2YDL A;  4FT4 A;  2NWM A;  1BB9 A;  4MZP A;  5I21 A;  5CO7 A;  2F2W A;  1VQ6 T;  2DL3 A;  3FDR A;  2GFU A;  3EH2 A;  4PL6 A;  1NLO C;  2JM9 A;  3X26 B;  1OZ2 A;  3OQ5 A;  2OTJ Q;  2AHJ B;  2F2X A;  5I22 A;  4OB2 B;  2DRK A;  1PCX A;  2D8H A;  2YT6 A;  1KD1 C;  4N4H A;  1KFZ A;  3CCQ T;  3HKS A;  1O75 A;  3BDL A;  3CME T;  3G6E A;  1M1K U;  2DAQ A;  3H0F A;  1YIT A;  1JRI A;  2RHX A;  2LJ0 A;  2PQW A;  1VOM A;  2CP5 A;  2YUQ A;  1MND A;  4E7L A;  4IIO A;  3OYG A;  2PUK B;  1Q82 U;  1BIB A;  1QVF P;  2CRE A;  1W2B A;  4E7K A;  4F7U A;  4JRK A;  2BE7 D;  2CKK A;  5D7U A;  1SSH A;  3DLL A;  4JJD A;  1E6G A;  1RAE B;  1J3T A;  4ORZ A;  1FXX A;  4OGE A;  1VQ9 Q;  1W1F A;  1FMK A;  3LX7 A;  3JCM P;  3A98 A;  2SRC A;  2VC8 A;  2ZPH B;  1YJN A;  3M55 A;  2EJ9 A;  1YJW A;  2B86 A;  4LD6 A;  1U1S A;  2NLU A;  1C6V X;  3HRS A;  3EGD A;  2P0P A;  1D1B A;  2V8I A;  2HEQ A;  4WF2 A;  3V8K A;  3G7Z A;  2ABL A;  1WHL A;  4R55 A;  2K2M A;  1NLP C;  2OTJ T;  4JUV A;  4RKU E;  4C8Q D;  2Y4Y A;  5LJ5 d;  1NEG A;  3S3M A;  1BI2 A;  5GMK h;  4M7A G;  2JS0 A;  3CCE Q;  1W4S A;  1WQW A;  2CSI A;  2X3X D;  2L8D A;  2KRN A;  3OYF A;  4C92 A;  2FB7 A;  1K76 A;  1SF9 A;  1Y07 A;  1HYO A;  5CKF A;  2RJE A;  4RTZ A;  5FWB A;  4M7A B;  2QQA A;  4LDV A;  3H41 A;  2KNB B;  2ZPG B;  3HTR A;  1B34 A;  1EX4 A;  4C0D B;  2LZ6 B;  4ZGE B;  1X01 A;  2MYS A;  3JCM h;  4DQ2 A;  3OYH A;  1YP5 A;  2DIQ A;  2P0K A;  3MHX A;  3SWN A;  4M7D G;  2X9H A;  4EMK B;  1VQ9 T;  1O9S A;  3LLR A;  1UEC A;  1U3O A;  4JJB A;  3X24 B;  3GNF B;  1VQN T;  4XU0 A;  2D8J A;  4IUT A;  1ZSZ A;  1RAF B;  2A28 A;  1W6X A;  4M7D B;  2DNU A;  3J81 E;  4B9W A;  3VRY A;  1JJ2 P;  2YUP A;  1XNI A;  1KQS S;  3M54 A;  2RI5 A;  3HP9 A;  3A5Z B;  2KSS A;  2E5K A;  3INZ A;  3UA6 A;  3VUZ A;  2JJ9 A;  4PJO F;  1Q81 C;  2RMO A;  1VQK T;  1PD0 A;  3QWY A;  5HY6 A;  2XU8 A;  3CPW S;  3G4S A;  2K6D A;  4FYV B;  2MIO A;  3CCE T;  5I2S A;  1MMD A;  2EQK A;  1W70 A;  3CC4 Q;  2HBW A;  4EMG A;  5IHI A;  2DIL A;  2JOY A;  4M75 F;  1E7O A;  3QYH B;  4M77 G;  1JO8 A;  2XDB A;  1M3A A;  1ACM B;  4II1 A;  2LCS A;  1KIK A;  3C95 A;  4DBH A;  2O9S A;  2HD0 A;  4J9B A;  2AKK A;  1M9S A;  3RKW A;  4BE0 A;  1MNE A;  4M77 B;  5I11 A;  1K9M C;  1N27 A;  2BUD A;  1D0Z A;  1VA7 A;  3JCM g;  2RQV A;  2VWF A;  5KYW B;  1UJ0 A;  4QKU A;  2DJQ A;  2EW3 A;  4QT7 A;  1SHG A;  2FHD A;  3JCM V;  4LDX A;  4NOY A;  2E64 A;  3OYY A;  2XIC A;  2KXD A;  4LDU A;  1VQO Q;  2KT1 A;  2KDS A;  4YTL A;  3I56 A;  2DYI A;  2DET A;  1KD1 U;  1QWE A;  2DD4 A;  5GAM j;  4DEX A;  1MMN A;  2F1L A;  1WZO A;  4XTU A;  1PSE A;  2P4T A;  4KBM B;  3EGX A;  5CKB A;  4J9C A;  1Y7X A;  4PK4 A;  3JCM e;  3CC4 T;  2EGC A;  1VQ4 Q;  1D1C A;  4XTW A;  1Q7Y U;  4KGZ B;  3CPW P;  1Y0M A;  1I1J A;  1QQJ A;  2QAZ A;  2EKH A;  2K2V A;  1OU8 A;  3T9N A;  1NE8 A;  3EG0 A;  4B6M A;  4PLI A;  3WXM B;  4ZNX A;  1N8R C;  1YCS B;  2XD0 A;  3KBG A;  5GJW B;  1LCK A;  3JAM E;  4AMC A;  3LH5 A;  3CCS A;  1WDX A;  4P5N A;  1ARK A;  3CCR A;  3JB9 J;  2IVW A;  1HJD A;  1AZG B;  5KCO A;  4M78 G;  4MMK A;  3G71 Q;  1MV0 B;  1EIF A;  2DE0 X;  1K73 U;  1AOJ A;  3HFN A;  3RUX A;  1RL2 A;  1VQO T;  3FIF A;  4J83 A;  2MPX C;  4E7S A;  4M78 B;  1X43 A;  2MCN A;  3S3O A;  2DTI A;  2LC4 A;  2GFA A;  4M77 F;  1I5O B;  5FU7 B;  1SRM A;  1T3L A;  2RJF A;  2FYK A;  4M7A D;  3HPW A;  3PMT A;  2JTE A;  3M9Q A;  2RJC A;  1YIJ A;  4F7U F;  1QVG S;  2VB6 A;  4C92 C;  4C8Q A;  2A3L A;  2LTO A;  1VQL Q;  3J7A F;  3EFO B;  2H3J A;  1OUL A;  4F16 A;  5I2M A;  2C0T A;  2YWW A;  1ZA1 B;  1BI3 A;  1VQ4 T;  2Y90 A;  2J6O A;  4BE2 A;  4RG2 A;  1CKA A;  3VYH B;  3QDF A;  4DBR A;  2JTM A;  1H8K A;  3ER0 A;  3SWN C;  3UAT A;  4PFO A;  4BD3 A;  4M7D D;  4Z8A A;  4A4F A;  2RI3 A;  9ATC B;  4AFU C;  1IGU A;  2DRM A;  3P8D A;  3C0C A;  1RAG B;  4RTV A;  1I8F A;  5HKC A;  2VV5 A;  1ZSZ C;  1X27 A;  3LWH A;  3L2Q A;  2JZ2 A;  5GMK l;  2R58 A;  2JS2 A;  2X3W D;  3PT9 A;  2E10 A;  1QMC A;  3G71 T;  4JPB W;  1VYV A;  1S72 Q;  2AIR B;  3E19 A;  1LPL A;  4OML A;  3EG9 B;  2PU9 B;  3CCU A;  2DKG A;  5ECA A;  5KYY A;  4KRT A;  3CD6 A;  2JM8 A;  2DTO A;  4A4H A;  1M5Q 1;  5LJ5 f;  4XQ3 A;  2JTF A;  3EGU A;  3VRZ A;  3VS3 A;  4HT9 A;  3ASK A;  1VQL T;  1GL5 A;  3CBM A;  2DXC A;  3RMQ A;  2LCL A;  3A8H B;  3V7C A;  1QVG P;  2JW4 A;  2NUT B;  4FCY A;  1BI0 A;  2RJD A;  3DB3 A;  1UEB A;  2M9U A;  4XTV A;  1MHN A;  4LXC A;  3M0T A;  3L42 A;  1U8R A;  3CPF A;  1SHF A;  1OX8 A;  3FRN A;  4J6X A;  4HCZ A;  3JV3 A;  2LP5 A;  2RK2 A;  1C0M A;  4ESR A;  3L2W A;  3TU4 K;  1IXD A;  4OMQ A;  3EHQ A;  3JCM W;  2P84 A;  1NJI U;  2VXF A;  3JB9 I;  2LJ1 A;  1NYG A;  1S72 T;  2E3H A;  2HZY A;  5GMK j;  3RDV A;  2BZ8 A;  3NGP A;  1GBQ A;  3OW2 P;  2KXC A;  3M56 A;  2VGM A;  2J6F A;  1M2O A;  1WHG A;  2PUO B;  2KE9 A;  4RTX A;  1Q95 G;  2EBP A;  3HSB A;  5GAM h;  2CGH A;  4XTZ A;  2VGN A;  3PMI A;  2EYZ A;  3RES A;  2JMA A;  1U06 A;  4FW2 A;  3CMA A;  1AVZ C;  1JQQ A;  4E47 A;  1UFF A;  2EJF A;  2K3B A;  2O01 E;  4RMO A;  1N8R U;  3ZEH A;  3TVT A;  1P92 A;  2D9T A;  3I35 A;  2R57 A;  3TQ7 P;  4LNP A;  3M0Q A;  4A53 A;  4RUG A;  4J9F A;  1R0C B;  3NMZ C;  1MV3 A;  2L2P A;  4AG2 C;  1GBR A;  3SDZ A;  5LJ3 d;  5GMK m;  3H0H A;  2HSE B;  2DA9 A;  2C0O A;  3I55 T;  2GF7 A;  1ZQ1 A;  2QA4 T;  3QYG B;  1BCO A;  1XQH A;  5FW9 A;  3PNW C;  3MJX A;  3QKJ A;  1AWW A;  4BB7 A;  2O88 A;  2KAF A;  3CCV A;  2KQW A;  2EYY A;  7AT1 B;  2JMC A;  3S3N A;  4N0A A;  2CUD A;  4QQD A;  3M0P A;  2K5L A;  4PNO A;  4C8Q C;  2LDM A;  2LVM A;  2ZPE B;  2FPE A;  2RO0 A;  5IN1 A;  1VQ8 Q;  3CC2 A;  3OYN A;  1ZUU A;  2RD1 A;  1Z9Z A;  1SRL A;  3LW5 E;  3MEA A;  4ELY C;  1QLY A;  1UDL A;  3CCV Q;  1K8A C;  4QVD A;  3OB9 A;  1BK2 A;  3KUF A;  4J9E A;  2ED0 A;  4RCC A;  1WGS A;  5GAM g;  4BAC A;  1NBE B;  2PVO B;  2D0Q B;  2MWO A;  2DER A;  2CP6 A;  2DEU A;  1YHQ A;  1QW1 A;  1QCN A;  3VYG A;  1X6B A;  2JNG A;  2YHT A;  2LT4 A;  1PHT A;  5GAN h;  3OMG A;  5CCA A;  2RQT A;  3TSZ A;  3QZ5 B;  4C5E A;  3OYE A;  4C92 E;  2KYM A;  2EFI A;  2RPN A;  1M90 R;  2O4X B;  3I5R A;  1BKB A;  1WA7 A;  1PG5 B;  1YWP A;  5GAO r;  1RLQ C;  3SHW A;  2DXT A;  5HK3 A;  3OYI A;  4X9C A;  1UGR B;  2KBT A;  4A54 A;  1ZUK A;  1H92 A;  2HAX A;  2MI6 A;  3QWX X;  4RTW A;  5KYX B;  1BBZ A;  1B07 A;  1UG1 A;  5GAM e;  2V1R A;  3CCJ A;  4C5H A;  1VQ7 T;  2OX7 A;  3PE0 A;  4FW1 A;  5KCH A;  1BI1 A;  3V7S A;  4OMO A;  3OYJ A;  2EQJ A;  1RI9 A;  1MMA A;  2P4R A;  1NM7 A;  2J05 A;  1WXB A;  4JRP A;  4BY6 C;  5DM7 R;  1E6H A;  2E41 A;  1VQ8 T;  4PJO G;  3NTH A;  4DBF A;  2KRM A;  1QP3 A;  2E3I A;  2RHY A;  4NL2 A;  3G6E Q;  1Y96 A;  4MML A;  4AFQ C;  2YUN A;  1YIT Q;  1G3W A;  4BI8 B;  4WCI A;  1X6G A;  2O31 A;  3JCM b;  4PJO B;  2PNI A;  3GPL A;  3VU3 C;  3CCM T;  3BY7 A;  3QBY A;  4V2S A;  4M75 G;  3X25 B;  1KHI A;  4AFZ C;  2L3Q A;  2X51 A;  1KG1 A;  3CXC A;  2XK0 A;  3EG1 A;  4XU1 A;  2SEM A;  1EZZ B;  5GJV B;  5GAN g;  4M75 B;  4IUQ A;  4DA4 A;  2C0I A;  2VKN A;  2DMO A;  4HT8 A;  1IB8 A;  2RQU A;  4JJC A;  1TG0 A;  2VUB A;  1YJN Q;  2DLP A;  3NTK A;  2ATC B;  4A4K A;  1PKS A;  1YJW Q;  1ABO A;  3ME9 A;  3PFS A;  1OYX A;  2K4Y A;  2CYZ B;  2HNI A;  2QQS A;  1YWO A;  1TUG B;  4BI3 A;  2CP2 A;  2DXU A;  1H3H A;  1M30 A;  4XTY A;  2WSC E;  4QQG A;  5GAN 4;  2RHI A;  1HXD A;  1FX7 A;  2RI2 A;  2WAC A;  3OA6 A;  1WPY A;  3L1A A;  4OB3 B;  1QVF A;  2ZCF B;  2V26 A;  1FMW A;  3HRU A;  3G6E T;  2NUP B;  2HKN A;  1YIT T;  2YLC A;  4BI4 A;  2GQV A;  2LCC A;  4Z89 A;  1GCQ A;  3A8M B;  2COW A;  3VKI A;  4DBQ A;  1M2V A;  3H0I A;  2RF0 A;  2GQI A;  1K9A A;  1ZA2 B;  1M1K R;  4J9D A;  4KH1 B;  1VQP A;  1ABQ A;  5GAN 3;  1C1A A;  1RAI B;  2RNA A;  2K9G A;  2ZGW A;  1Q82 R;  1Q86 C;  1PRL C;  2C06 A;  3SFM A;  5FU6 B;  4Y92 A;  2A08 A;  3HFO A;  2KRS A;  4KUL A;  3TRE A;  1G3S A;  4N0A C;  3E9F A;  1YJN T;  2DZC A;  2YUO A;  1YJW T;  2ESW A;  2PVD B;  5IH2 A;  1VQP Q;  2M02 A;  5C6S A;  1UGQ B;  1YI2 A;  1N6A A;  2COZ A;  4ATO A;  5GMK i;  3M0R A;  4M7A C;  1K8A U;  3JB9 G;  3F70 A;  2HL5 C;  2HL3 A;  4HXJ A;  2E1H A;  5D6Y A;  1UB4 A;  3VS5 A;  1YJ9 A;  6AT1 B;  3EFR A;  2V1Q A;  4F7U G;  3SEM A;  3G4S Q;  3H9N A;  3RMS A;  4RTU A;  4JLG A;  1I07 A;  4EMK C;  1YI2 Q;  3C4S A;  1JBM A;  4Q5W A;  2YRD A;  4E2F B;  1YBY A;  2FZC B;  4MDW A;  2XG8 D;  1JU5 C;  2DM1 A;  4F7U B;  2LQK A;  2M0O A;  1K1Z A;  4C8Q E;  2K3Y A;  4M7D C;  1BYM A;  3CBP A;  3FC3 A;  3GOX A;  3A1P A;  2HMA A;  1U5S A;  1VQM A;  4ZTF A;  5LJ3 f;  3QJ6 A;  2RA2 A;  1SEM A;  1KC8 C;  4B9X A;  1ZSG A;  2XI9 A;  5GMK e;  1AWO A;  1JJ2 A;  5DLQ E;  2ROL A;  2FG0 A;  4E7I A;  1KQS P;  4EPC A;  5IAY A;  3M57 A;  1NYF A;  3EGD B;  3QG1 A;  5LJ5 j; 
#chains in the Genus database with same CATH homology
 1XOV A;  2JM8 A;  2RQW A;  1V1C A;  1YNZ A;  1GFD A;  1PWT A;  2L3S A;  1QKX A;  1RUW A;  2AZS A;  2DX1 A;  1K0S A;  3EGU A;  1S1N A;  3VRZ A;  5FWC A;  3VS3 A;  4HVW A;  4D8K A;  2RQR A;  1GL5 A;  1G2B A;  3PVQ A;  2F2V A;  1UJY A;  3NPF A;  2GBQ A;  2XMF A;  1OOT A;  1PNJ A;  2MOX A;  2JW4 A;  3R6N A;  2DF6 A;  2EYW A;  4JZ4 A;  3TSW A;  2D1X A;  1K4U S;  3M0T A;  2DVJ A;  2L0A A;  2O2O A;  4LE9 A;  1YN8 A;  2CUB A;  1SHF A;  4RTT A;  3JV3 A;  2CH4 W;  2KT8 A;  2LP5 A;  4OMM A;  4ESR A;  2CSQ A;  4OMQ A;  1ZLM A;  1GFC A;  1B3Q A;  3EHQ A;  3RBB B;  1WFW A;  1M3B A;  2YDL A;  3VS6 A;  2NWM A;  1BB9 A;  4LUD A;  2F2W A;  1Y57 A;  1NEB A;  2DL3 A;  2HSP A;  2YSQ A;  1NLO C;  2JM9 A;  2LJ1 A;  2LJ3 A;  3EG2 A;  1NYG A;  1GCP A;  2L3P A;  4J9I A;  4X1V A;  2F2X A;  5I22 A;  2KR3 A;  2FEI A;  2BZ8 A;  2DRK A;  3NGP A;  1GBQ A;  3REB B;  2KXC A;  4E6R A;  2DL7 A;  2ED1 A;  2D8H A;  2YT6 A;  1UHC A;  2J6F A;  1KFZ A;  4RTX A;  2KE9 A;  1TUC A;  3IQL A;  3M0S A;  2LMJ A;  2EBP A;  3H0F A;  4J9H A;  2W0Z A;  2LJ0 A;  2EYZ A;  2HCK A;  2YUQ A;  1UE9 A;  2JMA A;  1U06 A;  2LNH B;  2KRO A;  1EFN A;  4IIO A;  1AVZ C;  1JQQ A;  2CRE A;  1UFF A;  2K3B A;  2EQI A;  2J6K A;  5IHN A;  1QCF A;  1HD3 A;  1GCQ C;  2EGA A;  4IIM A;  1SSH A;  4JJD A;  3REA B;  1E6G A;  3TVT A;  3I35 A;  2K79 A;  4AFS C;  4LNP A;  3M0Q A;  2JT4 A;  1J3T A;  4ORZ A;  1UUE A;  4RUG A;  1W1F A;  5L23 A;  4J9F A;  1FMK A;  1GRI A;  2DL8 A;  2DYB A;  3A98 A;  1MV3 A;  2L2P A;  2GGR A;  2SRC A;  3NMZ C;  4AG2 C;  1WI7 A;  1GBR A;  3H0H A;  2B86 A;  2DA9 A;  2C0O A;  4J9G A;  1AEY A;  2NUZ A;  2BZX A;  5FW9 A;  2HEQ A;  2GNC A;  2J06 A;  1AWW A;  2ABL A;  2O88 A;  2K2M A;  3NHN A;  1NLP C;  2EYY A;  1M8M A;  2D0N A;  2JMC A;  2DBK A;  2M51 A;  2CUD A;  3M0P A;  4K11 A;  1Z9Q A;  4OMP A;  1NEG A;  1UTI A;  3U23 A;  4R0K A;  2JS0 A;  2RN8 A;  2CSI A;  2X3X D;  2DBM A;  2FPE A;  2HDA A;  1AD5 A;  2KRN A;  1SPK A;  1ZUU A;  2CT3 A;  3ULR B;  1Z9Z A;  1SRL A;  3O5Z A;  1K76 A;  1QLY A;  1UDL A;  1BK2 A;  4RTZ A;  4J9E A;  5FWB A;  2ED0 A;  3H41 A;  4GLM A;  2KNB B;  2FRY A;  1T0J A;  3VS4 A;  2LZ6 B;  1X6B A;  1YP5 A;  1PHT A;  2PZ1 A;  1FYN A;  2RQT A;  3TSZ A;  1UEC A;  1U3O A;  4JJB A;  2OJ2 A;  2GTO A;  2BZY A;  2KYM A;  2RPN A;  2D8J A;  3I5S A;  3I5R A;  4F17 A;  1WA7 A;  2A28 A;  1W6X A;  1YWP A;  1ZUY A;  2EYX A;  4FSS A;  2A36 A;  1RLQ C;  3SHW A;  2DNU A;  3VRY A;  1T3S A;  2ROT A;  4AG1 C;  2YUP A;  5IXB A;  2KBT A;  2EPD A;  1ZUK A;  2LQW A;  1H92 A;  2FO0 A;  3QWX X;  2E5K A;  4RTW A;  1BBZ A;  1B07 A;  1UG1 A;  3UA6 A;  2V1R A;  2I0N A;  2OI3 A;  2W10 A;  3PE0 A;  2RMO A;  4RTY A;  1AWX A;  2O9V A;  4OMO A;  3UA7 A;  3QWY A;  1RI9 A;  1X2Q A;  3I9Q A;  2M0Y A;  2K6D A;  2AKL A;  2BTT A;  1NM7 A;  2MIO A;  2J05 A;  1WXB A;  2P4R A;  1W70 A;  2KYB A;  1E6H A;  2HBW A;  5IHI A;  2DIL A;  3RNJ A;  4A63 B;  1OPK A;  1E7O A;  2KRM A;  2OAW A;  1UHF A;  1JO8 A;  4AFQ C;  2YUN A;  1M3A A;  1TUD A;  4WCI A;  4GBQ A;  1X6G A;  2O31 A;  2LCS A;  2PNI A;  1KIK A;  2O9S A;  1AWJ A;  2VVK A;  4J9B A;  2AKK A;  2CDT A;  3VS1 A;  5I11 A;  5HCK A;  4CC3 A;  3GBQ A;  3PVL A;  3VS7 A;  4AFZ C;  2L3Q A;  1VA7 A;  4HVV A;  1ZBJ A;  2RQV A;  3EG1 A;  2VWF A;  1UJ0 A;  2SEM A;  2DJQ A;  2EW3 A;  5GJV B;  4QT7 A;  1WIE A;  1SHG A;  1RLP C;  2KGT A;  1AZE A;  2KXD A;  2C0I A;  2VKN A;  2KT1 A;  2DMO A;  1KJW A;  1OPL A;  2RQU A;  2J7I A;  4JJC A;  1TG0 A;  5IHK A;  2DLP A;  1PKS A;  1ABO A;  1M27 C;  1QWE A;  1WXU A;  1I0C A;  3THK A;  3EHR A;  1MUZ A;  1YWO A;  1CSK A;  4DEX A;  1QKW A;  5IXF A;  1H3H A;  1NG2 A;  4LN2 A;  1M30 A;  3VS0 A;  4J9C A;  3FJ5 A;  2EGC A;  1OV3 A;  2IIM A;  1Y0M A;  1I1J A;  2AK5 A;  2EKH A;  2QDL A;  4JZ3 A;  1HSQ A;  4DEY A;  3EG0 A;  2H8H A;  4Z89 A;  1GCQ A;  1WLP B;  4ZNX A;  1YCS B;  2PTK A;  5GJW B;  1LCK A;  2CH4 A;  3H0I A;  2ENM A;  2RF0 A;  4HVU A;  1JEG A;  2GQI A;  3LH5 A;  1K9A A;  1WDX A;  1X69 A;  4CC2 A;  1M3C A;  1ARK A;  1QWF A;  4Z88 A;  1HJD A;  1AZG B;  4J9D A;  4CC7 A;  1WXT A;  1ABQ A;  2EVR A;  1MV0 B;  2DE0 X;  2RNA A;  1AOJ A;  2K9G A;  2FPD A;  1VYU A;  1PRL C;  1BU1 A;  4Y92 A;  2A08 A;  1WYX A;  2KRS A;  1N5Z A;  2JXB A;  1CKB A;  1ZX6 A;  1X43 A;  2MCN A;  2YUO A;  2ESW A;  3EG3 A;  1K0X A;  4OMN A;  1T0H A;  2DL4 A;  5IH2 A;  1SRM A;  1T3L A;  2JTE A;  3M0U A;  1A0N B;  3M0R A;  4F16 A;  2C0T A;  4HXJ A;  1JXO A;  1KSW A;  1WX6 A;  4HCK A;  1G83 A;  2AZV A;  1VYT A;  1IO6 A;  2J6O A;  3VS5 A;  1CKA A;  2A37 A;  2G6F X;  2V1Q A;  2K7A A;  1H8K A;  3SEM A;  2EGE A;  4RTU A;  4M4Z A;  3UAT A;  1I07 A;  4Z8A A;  1OEB A;  1PKT A;  4AFU C;  3VS2 A;  2DL5 A;  2DRM A;  4D8D A;  3C0C A;  1JU5 C;  2KEA A;  2DM1 A;  3CQT A;  2ECZ A;  4RTV A;  1K1Z A;  1X27 A;  3KFV A;  4EIK A;  4F14 A;  1PRM C;  2LX7 A;  1U5S A;  2LQN A;  2FPF A;  2JS2 A;  2CT4 A;  2X3W D;  1SEM A;  2GTJ A;  1UGV A;  4CC4 B;  1ZSG A;  4JPB W;  4LUE A;  5EC7 A;  1VYV A;  1AWO A;  2ROL A;  2FG0 A;  2FRW A;  4OML A;  1JXM A;  3UF4 A;  1NYF A;  3ZL7 C;  5ECA A;  1X2K A;  4KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...