2DF6A

Crystal structure of the sh3 domain of betapix in complex with a high affinity peptide from pak2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
pubmed doi rcsb
molecule keywords Rho guanine nucleotide exchange factor 7
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 10
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2df6A00
2RQTA 2BZYA 2A37A 4J9GA 4QT7A 1GCPA 2LX7A 3GBQA 4RTZA 4HXJA 1SSHA 1GCQA 4JPBW 2O9VA 3M0QA 2FG0A 2FPEA 3KFVA 2EYYA 1ZUKA 1UE9A 3ULRB 1TG0A 1UJYA 1V1CA 4J9CA 2DX1A 2VWFA 3NGPA 2KT1A 3TSZA 4ORZA 1H92A 2ENMA 1CKAA 1GCQC 1QKWA 1UTIA 1WYXA 1VA7A 1WDXA 2RQVA 4Y92A 5GJWB 1LCKA 2DL5A 1E7OA 1UUEA 1PRLC 1K0SA 1Z9QA 2RNAA 2O31A 2J05A 3I5SA 5HCKA 3FJ5A 2FRWA 1ZUYA 1GFCA 4AFUC 2P4RA 1WXBA 2PTKA 4K11A 2DBKA 1PRMC 2XMFA 1NEGA 1UG1A 2J7IA 2CSQA 2KRNA 2OI3A 2HEQA 2AKKA 2LP5A 1ZSGA 1PWTA 2FRYA 1PHTA 1FMKA 2DMOA 1U06A 3VS4A 3C0CA 1SRLA 2LQWA 1UHFA 1T0HA 2CH4A 1N5ZA 2SEMA 2KYMA 1AWOA 1WXTA 2K2MA 4RTVA 2O9SA 3M0UA 3THKA 2DRMA 2CT3A 1NM7A 1GRIA 2KNBB 2D8HA 2F2VA 3M0SA 1KFZA 1JXOA 1WFWA 2ESWA 5IXFA 2YDLA 1CSKA 4RTYA 1AOJA 2KYBA 4X1VA 1X69A 2O88A 2ROTA 4D8KA 3EHRA 1X6GA 4LUEA 2F2WA 2H8HA 2RQUA 1MV0B 1M3CA 2OJ2A 2LJ1A 1GL5A 1XOVA 1VYUA 3UATA 1PKTA 4AFZC 2RQRA 3UF4A 3VRYA 1SRMA 3VRZA 1UDLA 2VKNA 3VS0A 3H0FA 1A0NB 2BZXA 2EGCA 1JU5C 2X3WD 3SEMA 1RLPC 1UGVA 2DYBA 2EYWA 2RPNA 2GTOA 2KT8A 2GNCA 1JQQA 4GLMA 1BB9A 1Y0MA 4RUGA 4WCIA 2GGRA 3TSWA 1BK2A 1YWPA 3PVQA 2C0OA 3H41A 4A63B 2YT6A 3NPFA 2SRCA 1M3AA 4JZ3A 2J6OA 2HDAA 3VS2A 2FEIA 2JW4A 1Y57A 1YP5A 1OPKA 1JEGA 1AEYA 1PKSA 3I35A 3I9QA 1AZEA 1ARKA 3VS5A 2MOXA 4ZNXA 1M8MA 2QDLA 3VS3A 2ED0A 2EYXA 2LQNA 2LJ3A 5IHIA 1JXMA 3SHWA 2JXBA 4OMLA 1SHFA 4F14A 1WA7A 5FWBA 2L3PA 1K1ZA 3H0IA 4J9BA 2CUBA 2MIOA 2LJ0A 1AVZC 4HCKA 2EPDA 2JM9A 4J9HA 4OMOA 2V1QA 4Z88A 1OPLA 2W10A 1AWWA 1K4US 1UECA 2DL3A 2M0YA 1ABOA 1AD5A 2A08A 3I5RA 4LE9A 2DJQA 3R6NA 5IHKA 1AZGB 1H8KA 1NEBA 1H3HA 2K9GA 2EYZA 2I0NA 4GBQA 2EVRA 1AWJA 2ABLA 2YSQA 1WIEA 2YUPA 4IIMA 2J6KA 5IHNA 1I1JA 1MUZA 1NYFA 1QLYA 2CREA 2OAWA 2EKHA 1IO6A 3EHQA 4DEXA 2DL4A 1KSWA 2D8JA 3UA6A 1MV3A 3PE0A 2EGEA 4OMPA 3M0TA 1I0CA 1T3LA 1W6XA 2FO0A 2LMJA 1RLQC 3VS1A 2LCSA 2L0AA 2CDTA 2CT4A 4J9DA 1W1FA 4F17A 4J9IA 1WI7A 2G6FX 2A36A 2DA9A 2JM8A 1ZUUA 3H0HA 4RTWA 1ZBJA 1Z9ZA 2KE9A 1E6GA 1UJ0A 2EW3A 1HD3A 4AFQC 2DL8A 1T0JA 2KXDA 4E6RA 2JMAA 4Z8AA 1SPKA 1ZLMA 1RI9A 4J9FA 3IQLA 2K7AA 1G83A 2AK5A 1HSQA 5ECAA 2K6DA 2RN8A 3REAB 4DEYA 4LN2A 4D8DA 1W70A 2DL7A 3M0PA 4CC4B 2JS0A 1E6HA 4AG1C 5I11A 2L3SA 1B07A 2HCKA 2DILA 3RNJA 5I22A 1CKBA 1NG2A 2PZ1A 2C0IA 1UFFA 2YUNA 2GTJA 4IIOA 2DRKA 2L3QA 1TUCA 1YWOA 1HJDA 2D1XA 2LZ6B 2K79A 2J06A 1UHCA 2O2OA 1NLOC 4KRTA 1T3SA 2DBMA 2B86A 1X43A 1GFDA 3REBB 2ROLA 2K3BA 1YCSB 1X6BA 4ESRA 2DLPA 2RMOA 3EG2A 1WLPB 1U5SA 1ZX6A 1WX6A 4LUDA 5GJVB 3ZL7C 4CC7A 2CSIA 2F2XA 3QWXX 3NMZC 2C0TA 2E5KA 2DNUA 1VYTA 3U23A 1SEMA 4AFSC 4OMNA 5EC7A 2KEAA 2ECZA 4CC3A 1U3OA 2RQWA 5IH2A 2LNHB 1X2KA 1QWEA 3O5ZA 2KBTA 1TUDA 1VYVA 3UA7A 2VVKA 3EG0A 3A98A 1OOTA 2KXCA 2JMCA 1S1NA 3PVLA 4M4ZA 1SHGA 2YUQA 1JO8A 4R0KA 2KROA 1GBQA 4EIKA 4F16A 4J9EA 4AG2C 2PNIA 1ABQA 2JT4A 3CQTA 3VS7A 2DVJA 5FWCA 1EFNA 3EGUA 2W0ZA 3LH5A 2L2PA 1NLPC 3RBBB 4CC2A 2KRSA 2KGTA 2JTEA 1YNZA 2DM1A 2GQIA 2KR3A 4OMQA 4Z89A 5IXBA 1X27A 2D0NA 2ED1A 2JS2A 1M30A 1KIKA 2CH4W 2J6FA 4LNPA 3M0RA 2BTTA 1OV3A 1G2BA 2NWMA 1BBZA 4HVVA 1M27C 2EBPA 1K76A 4RTUA 4FSSA 2HBWA 1M3BA 2X3XD 3NHNA 1BU1A 1FYNA 1K9AA 4JZ4A 2EGAA 2BZ8A 2MCNA 3VS6A 4HVWA 2CUDA 2IIMA 2FPFA 2M51A 2DE0X 1RUWA 2GBQA 2KRMA 3EG1A 1KJWA 4OMMA 1GBRA 1YN8A 3TVTA 2AKLA 1WXUA 4HVUA 2V1RA 2NUZA 1B3QA 3EG3A 2AZVA 4RTTA 5L23A 1OEBA 2AZSA 1AWXA 2A28A 4RTXA 3JV3A 2FPDA 4JJCA 1X2QA 1QWFA 2RF0A 1I07A 3QWYA 1QKXA 4JJBA 2EQIA 1QCFA 1PNJA 1J3TA 2YUOA 5FW9A 1NYGA 1K0XA 4JJDA 2DF6A 2HSPA
chains in the Genus database with same CATH superfamily
4XU3A 1BI1A 2RHYA 3EFSA 4J9GA 2CP5A 4DA4A 2DD4A 3M56A 4D6WA 1MNEA 5GAOm 4HXJA 2YRVA 4PLIA 2O9VA 4C0ZA 4ZTJA 1PD1A 2EYYA 1X01A 5LL6S 1V1CA 1BCOA 2CP7A 4VUBA 2VWFA 2FZKB 2BUDA 3CEYA 1JJ2P 2E5QA 2QGGA 1E7OA 3DLLA 2PVGB 3QJ6A 3CMEA 4NOYA 2O31A 3I5SA 3BDLA 3OYEA 4O5VA 1GFCA 2EQMA 2FYKA 5LJ3e 4LDUA 1VQ7T 2P4RA 3V7SA 2D6FA 2M0OA 4K11A 4DBRA 3MEUA 2XD0A 2XMFA 4C92G 5A0DA 1YHQA 3I55T 2RI2A 3QYGB 1QVGA 1BKBA 3D7SB 2RJCA 3MP1A 1RAEB 5GAN5 2BE7D 1IB8A 4DOWA 4XQ3A 1FMKA 1EIFA 1U06A 1SRLA 2LQWA 1VQ7Q 2PVDB 4DBQA 1OYXA 1MNDA 2DXUA 1T0HA 1N5ZA 1AWOA 3CCSQ 2O9SA 4BI4A 2AT1B 2E3HA 3OMGA 2QEXQ 4BB7A 2LC4A 3OMCA 5HY6A 2D8HA 2F2VA 8ATCB 4QVZA 1OX8A 2ESWA 3BY7A 1Q7YR 1JBMA 1Y96B 2EFIA 5CQXA 3EAEA 3V8JA 5GAN4 1X69A 2LDMA 3J7AF 4M7AE 4D8KA 3EHRA 2F2WA 3HHTB 2DERA 1MV0B 3JCMf 1UGPB 1XOVA 1VYUA 1I5OB 2RQRA 2L8DA 3VRYA 4CI0C 1BIBA 3H0FA 3FEOA 2ZAEA 1X6OA 1UGSB 5D7UA 3QZ5B 2EGCA 2FHDA 3GLXA 2X3WD 4C8QD 3EGXB 4E7HA 2GNCA 3P8DA 5GAN6 3CCLT 4RUGA 3EG9A 1BK2A 2COZA 2C0OA 2K4YA 1QVPA 2HQXA 3A8LB 4E2FB 2OAUA 4KGVB 2J6OA 2FEIA 3PT9A 1G3YA 4L59A 3Q1JA 5CKFA 3CCLQ 3L42A 1JEGA 3I35A 3I9QA 1AZEA 3CC2A 1OZ3A 4N0AC 4E7JA 1WHLA 2DXCA 4ZN3A 3OYFA 3JB9F 3CXCP 2EYXA 3V8KA 1IREB 3CC2T 2ZPHB 4JUVA 3SHWA 1YIJQ 2JXBA 3DKMA 3C95A 3VUZA 4FM4B 2ZCFB 2RI3A 3MEAA 4HA8A 2L3PA 2CUBA 1AVZC 4HCKA 4R56A 1C6VX 1PSFA 5GMKi 5M9OA 1K4US 1UECA 3FRNA 1H3ZA 1ZHIA 1HYOA 2AIRB 4C8QA 1R0BG 3I5RA 4BD3A 1AZGB 2L89A 3EH2A 1NEBA 5GANj 2I0NA 2LTOA 1YI2A 2YSQA 1QVFP 1WIEA 4BE0A 2XDBA 3BDUA 5IHNA 1RAIB 1UEBA 2VV5A 1K73U 3CMET 2DL4A 1TOVA 1KSWA 2D8JA 3UA6A 1MV3A 2D9TA 4OMPA 2EGEA 3VUBA 3PIPA 3OW2S 1T3LA 1M2VA 1I5LA 1KQSP 3VS1A 2KDSA 2RJEA 4J9DA 5HK0A 1MMAA 4J9IA 3GPLA 2G6FX 2A36A 1YHQT 1RI0A 1ZBJA 2QYZA 2XDPA 2K5LA 2V8KA 5KYXA 4M7AB 3CMEQ 3CCVA 4N4HA 1E6GA 1UJ0A 1K8AC 4HKEA 1SPKA 1ZLMA 1RI9A 1XNIA 2K7AA 5GANf 5ECAA 4ZGJB 2X51A 2HKNA 4M75E 2LT1A 4DEYA 3JCMW 2GF7A 4LN2A 1Q86C 2XKOC 1YBYA 3QDFA 1G3SA 5I11A 2L3SA 2AHJB 2H3JA 4JDSA 4OGCA 3HKSA 2WSEE 3O8VA 2HMAA 3OBYA 2YUNA 2RHIA 3M4GA 2DRKA 3HFOA 5GAN2 1W4SA 2LZ6B 2LVMA 2VXFA 1K8AR 2DBMA 4PFZA 2B86A 3S6WA 4PJLA 1LJOA 3REBB 2HL3A 3HTRA 3HRUA 4YTLA 4ZN1A 4F04B 1ZQ1A 1IHWA 2DTHA 1WHMA 1WPYA 2DLPA 1M90R 1U5SA 3ER0A 1Q86R 1VQMA 4WF2A 1LPLA 2QK0A 4A54A 4OMNA 1C1AA 2QQSA 1OI1A 1NJIR 3CCJQ 1HXDA 3GP8A 4ELZC 1VIEA 4PNOA 2BKDN 4MZMA 2LNHB 5CKDA 5CIUA 1ZA1B 5C0MA 2XDDA 1KD1C 2VVKA 3A98A 2CP6A 1IHVA 4M4ZA 5GAN8 5KYUB 2YUQA 5AYFA 2CS7A 3SWNC 5C6SA 1KC8R 2JVVA 3L1AA 2PNIA 2JT4A 3G1JA 3L2WA 3AT1B 4XU0A 5FWCA 3LH5A 1VQ6Q 3RBBB 4CC2A 3CBPA 2DM1A 2GQIA 2KR3A 2EQKA 4Z89A 4EMKC 1D0YA 1M30A 2BIVA 3OBWA 2P0PA 1XQHA 5FU6C 2OTJA 3M0RA 1N9RA 5GMKe 2NWMA 3QYHB 1BBZA 2EBPA 1KD1R 5FRMA 1YI2T 4M7DE 4M7AC 1N27A 2HBWA 5DLOA 1M3BA 1BU1A 5LJ5j 3A8HB 4QW2A 4JZ4A 4M75B 3V7RA 4A4GA 3JB9G 4EDUA 3TREA 2ZPFB 4HVWA 3CPFA 3EGXA 2DXTA 2K5FA 3OS5A 1G3TA 1VQ9Q 2DE0X 1RUWA 5IN1A 4FT2A 2YRCA 4M7AF 4OMMA 1WXUA 3HRSA 1PM3A 1B3QA 3CBMA 1KQ1A 3EFOA 3EG3A 2CZ6B 1Q81C 1R77A 3OB9A 3CCVT 4R55A 1OEBA 4KGXB 2FPDA 2Y90A 1X2QA 4JJCA 3CPWA 1KD1U 1O75A 2PUOB 1QKXA 2MI6A 2VUBA 5KYYB 2E64A 1M2OA 1PNJA 5LJ5f 1YJNQ 1K0XA 4M7AD 2X4WA 3M4YA 2IVWA 1OZ2A 3S3OA 3LGLA 4PJMA 2BZYA 1D3BB 3EG9B 5D6YA 2KI7A 1GCPA 1QCOA 4A53A 4JPBW 2YRDA 2FG0A 2FPEA 3KFVA 1ZUKA 1ZSZB 3ULRB 2PU9B 4OB2B 4J9CA 4PJJA 2DX1A 4JRKA 3CPWS 2ENMA 3CCMA 1QKWA 1K9MR 2KK4A 4A4FA 3X25B 1VA7A 2RQVA 4BI3A 1VQ8Q 4UC4A 3OW2P 2RNAA 5HCKA 1VQMT 4NL2A 3RIRA 2PTKA 2RJDA 4J7FA 4BE2A 1VQKA 1XJWB 1PRMC 3CCQQ 1NEGA 3RDVA 1M9SA 2YLBA 4E7LA 3JCMJ 5CAIA 3KUFA 1Y7XA 2FRYA 3V7CA 4KH0B 2QTXA 3A8GB 1Q81U 4C8QB 4M7AA 4LDWA 2DMOA 3CMAA 3C0CA 5I2MA 1M1KC 1WHKA 1G8XA 2X9HA 3M57A 4RCBA 4M7DB 2CZ1B 2LCCA 2DD5A 4C5EA 2DRMA 1IRXA 1NM7A 1QW1A 2EJGA 2D0QB 4DBHA 2LNVA 4XTVA 1KFZA 1JXOA 2YDLA 4QQDA 4RTYA 2LQ8A 2QA4A 1UGRB 3QIIA 4IUVA 2YWWA 1KQSS 5GAMj 2MMPA 5KYXB 2RHZA 2EJFA 2OTJT 2LJ1A 1V29B 1GL5A 1H641 1SF9A 4L6V5 4HCCA 3VRZA 1M1KR 1UDLA 2VKNA 3VS0A 3VU3C 2BZXA 1WJQA 2JJ9A 3SFMA 4JS4A 4C5HA 2LRQA 3RR6A 3X26B 1F1BB 5IT9E 1UGVA 2DYBA 1W2BA 2KT8A 4ZGDB 4M78E 3OS2A 2H3EB 3M5AA 4BDZA 1BB9A 4WCIA 4E7KA 4F7UE 3H41A 4A63B 2YT6A 2VGNA 1HK9A 4PJOE 1YJWA 2SRCA 1M3AA 5FU7B 4KULA 2DJZA 4X9DA 4M75D 2JW4A 4E7SA 4FW2A 5GAMf 2LX9A 4ZGEB 1D1AA 4PL6A 1VQLQ 4LDVA 1MHNA 3M55A 3UPUA 1YFNA 5KYUA 1NZ9A 3G6EA 2Y4XA 2QDLA 2F5TX 1NBEB 1TXQA 4FYXB 3UDCA 3OYDA 2LQNA 3QJYA 4KUDK 2EYQA 4LD6A 4C5GA 4OMLA 1SHFA 4PFPA 4F14A 3FLGA 2EIFA 2RK2A 2NYSA 4J9HA 2XU8A 1Q7YC 9ATCB 3CC7A 2M0YA 1PD0A 4JS5A 1RAHB 3OQ5A 2DJQA 4N4IA 2LCLA 3CCUA 4NS5A 5LJ3j 2K9GA 2EYZA 3CCMT 1AWJA 5I2SA 1NYFA 4C8QC 1WJRA 4Z02A 4PLLA 3I55Q 1QCNA 3M0TA 4M75A 1I0CA 2JN0A 2FO0A 1RLQC 2MWOA 2CGHA 1FX7A 2CT4A 3CCMQ 1VQKT 1W1FA 4F17A 4FYWB 1RACB 2E3IA 4C8QF 1ZUUA 5KE2A 1Z9ZA 3PNWC 3OYMA 1QVGS 4BE1A 1KQ2A 5KYNA 2JMAA 3M59A 3CMAT 2QXFA 5LJ3f 5CKBA 3OYCA 3DB3A 1HSQA 1VUBA 3KBGA 2DAQA 2KAFA 1UGQB 3CC4A 3QUIA 5KYYA 4D8DA 2X4XA 3M0PA 4CC4B 1E6HA 4M77A 4M78B 3CMAQ 4C92E 1WQ7A 4CRIA 1D3BA 3CD6A 4M7DD 1CKBA 2QA4T 4PJOB 3LYIA 1LVKA 2C0IA 2HAXA 4OF1A 4IIOA 2E4HA 1JB0E 1Q7YU 2DFUA 1V76A 3CPWP 3EFOB 1G3WA 3QDRB 1ZSZA 3OSSC 1NLOC 3L2ZA 2DIQA 1T3SA 5FU7C 1TU0B 2ROLA 4FU6A 2K3BA 4QQGA 5CQYA 2QA4Q 1GXIE 4DQ2A 3P8HA 4AT1B 4E47A 5KH6A 4FCYA 4WTOB 1WX6A 4LUDA 5GJVB 1VIFA 3ZL7C 5GMKh 1I81A 4XK8E 2C0TA 1VYTA 3U23A 4ELYC 4P5NA 3BFMA 4QVDA 2KEAA 1YJWT 2ECZA 1QP2A 2QI2A 3OSVA 4KH1B 1M4ZA 1PC0A 2YLCA 1D09B 2CYZB 8AT1B 1NPRA 3G4SA 2JZ2A 1VYVA 3HL8A 5LJ5h 2B8AA 3SD4A 1OOTA 2KXCA 5D6WA 1IGUA 3MJXA 3CC2Q 4R0KA 2BE9B 1YJWQ 1B7TA 5DLQE 4J9EA 4A4KA 2QQRA 3G6ET 2M02A 1D1BA 5GMKl 4M7DA 1ABQA 3VS7A 1EFNA 3EGUA 2W0ZA 3MO8A 1NLPC 4B6MA 3JCMg 1YNZA 2NUPB 2LQKA 4OMQA 5IXBA 3S3MA 1U1SA 3CC7T 4BDYA 4XTZA 2CH4W 3PTAA 1VQ4A 4LNPA 4OB3B 2BTTA 5CK9A 4HVVA 3CCUT 2M16A 2PUKB 2ZPIB 3WVDB 1YITA 4FSSA 3ME9A 3E2UA 1Q82R 4IUPA 2QG9B 3JCMb 3NHNA 1IXDA 4X34A 2BZ8A 1M90C 1YHQQ 2CUDA 2FPFA 3QSUA 4FIBA 2GBQA 1VQ5A 4ANJA 4PJNA 2KRMA 1AHJB 3MP8A 4C92B 1Q95G 1NE8A 1NJIC 4M78C 2ZGWA 1IGQA 3JRZA 2CKKA 5AT1B 2AZVA 1M8VA 2AZSA 2K2VA 3OS0A 3VV0A 4E7IA 4JJBA 3OYJA 4M78F 1J3TA 2YUOA 3MPUB 3I56A 3CC4T 4HT9A 1C0MA 5FW9A 1KC8C 1IZ6A 5GAOn 4JJDA 1VQNA 2DF6A 4M77E 1Y71A 4IUTA 3UT1A 1TUGB 2KSSA 6AT1B 1OU9A 4RTZA 3GBQA 1SSHA 3VYHB 2M9UA 1GCQA 2EQUA 3CD6T 4C8QG 2A3LA 1TG0A 1UJYA 3V8LA 2E12A 4DOVA 3NGPA 4M78D 4OVAA 4ORZA 1H92A 1CKAA 2FB7A 5IAYA 3M53A 4A4HA 1UTIA 1WYXA 1WDXA 4Y92A 1RL2A 5GJWB 1JJ2A 1K8AU 1PRLC 4FL6A 3H8ZA 4PJOD 3CD6Q 4O6JA 2J05A 4LD9K 4BY6B 2FRWA 1ZUYA 1RAGB 1SG5A 1VQOA 1M90U 1WXBA 3C12A 3X20B 2RHXA 1Q86U 2O01E 1UG1A 3J80E 2DIGA 3GNFB 3MEWA 4Y28E 5GANg 2K57A 1QVGP 2CZ7B 2HEQA 4B9WA 2LP5A 1PWTA 1NJIU 1PHTA 2LT4A 3G4ST 3PFSA 3VS4A 4MDWA 2X4YA 2E10A 1UHFA 1TS9A 4PK4A 2KYMA 1WXTA 2ZPEB 2DEUA 4RTVA 3PMTA 3TCJA 3M0UA 2GQVA 3G71A 3THKA 2CT3A 5KCOA 1VQPA 2KNBB 1KC8U 3CCEA 3OYHA 1FWZA 3M0SA 1WFWA 5IXFA 4JRPA 4M78A 5LJ5e 2M1HA 3LGFA 5J3BA 2A0FB 2O88A 2ROTA 1S72A 4F7UA 1X6GA 1Y07A 1YI2Q 4N4GA 4PJOA 2RQUA 1VQ4T 3OYNA 2R5AA 5GAOr 3HFNA 3PMIA 4JRIA 1PKTA 2CP0A 1SRMA 1A0NB 2VGMA 1K9MC 1YITT 3M58A 1JU5C 4TVRA 1WNLA 2E65A 2NUTB 2PVOB 4C5IA 1LOJA 2RPNA 4QVCA 2GTOA 3QO3A 3VKIA 2OTLA 4OB1B 1N8RR 3PGGA 4M77B 1JQQA 4GLMA 2VC8A 1U1TA 1M1GA 1YWPA 1VQ5T 3CCVQ 1AT1B 2K3YA 4JRQA 3L2RA 3JCMh 4JZ3A 2HDAA 3VS2A 4JLIA 1WJSA 4Q5WA 1OPKA 1TTHB 1PKSA 1P92A 1VQ5Q 1ARKA 2MOXA 4C92D 1M8MA 3MKDA 1PCXA 3I56T 2A7YA 2HZYA 4XTYA 3FC3A 4BACA 2VB6A 1OX9A 2DK3A 1VQNT 4II1A 2PQWA 3CCSA 3RMQA 4KUIA 3H6ZA 1WA7A 1WZOA 4OB0B 2QEXA 2LJ0A 2EPDA 1RAAB 4OMOA 4Z88A 4BY6C 2NUPA 1AWWA 4FW1A 4MMLA 4J83A 1WGSA 3R6NA 3OA6A 1H8KA 3BW1A 4GBQA 2EVRA 2HQEA 5GAN3 2YUPA 1VQMQ 2VYTA 2O4XB 3FDRA 3FJPA 3TQ7P 5HK3A 1I1JA 2JTMA 2FZGB 2CREA 2OAWA 1K9MU 2V8JA 1IO6A 4DEXA 2ATCB 3PE0A 3E19A 2LMJA 2HQHA 2OX7A 3JB9J 1VQOT 2L0AA 4HCBA 1KK7A 2HKQB 1WI7A 5EG2A 4JJNK 2DA9A 3HSBA 2JTFA 1EZZB 2Z0WA 4M75C 4C92A 1WHHA 2NLUA 2IPOB 5DY9A 2KE9A 2EW3A 1HD3A 4AFQC 5LJ5g 4XU2A 4J9FA 2V26A 3T9NA 2KY9A 1G83A 2AK5A 3MHXA 2K6DA 5GAMe 4RKUE 2QTVA 4M75F 3M54A 1QQJA 2WACA 3WXMB 3G71T 3OYAA 2K5IA 2DL7A 3DB4A 4AMCA 3JCMP 1VQPT 3A5ZB 3CCET 2MK5A 3NFCA 2OTJQ 3JCMd 1YJ9A 2HCKA 2DILA 3RNJA 3LWHA 4OMFB 5I22A 3OYIA 2PZ1A 1YIJA 3WVEB 1ACMB 1M5Q1 4M77C 2GTJA 1S72T 3ZFJA 2XIDA 1TUCA 2VXEA 2RHUA 5GANh 3AHUA 1HJDA 2D1XA 3E1SA 2HSEB 1UHCA 3NTHA 3CCEQ 4E7ZA 1X43A 4M77F 3LLRA 1M1KU 1ZSZC 3FB9A 3H9NA 4FSXA 2RO0A 1S72Q 1WLPB 1N6AA 1ZX6A 2F2XA 3QWXX 1W2BS 2OTLT 3A1PA 2E5KA 1M1FA 2QQBA 2DNUA 2XHCA 1SEMA 4AFSC 2HL5C 4CC3A 2HD0A 3ZEHA 1U3OA 2RQWA 5IH2A 3GIBA 4MZTA 4M7AG 1YCYA 1QWEA 1N9SA 3O5ZA 3LWIA 4X9CA 2KBTA 1TUDA 2ZPBB 4XTXA 3N5BB 4M77D 2OTLQ 4ME7A 2JMCA 2KVQG 2DEQA 2KROA 3QXEB 3CQTA 2DVJA 2FZCB 3E9FA 3JCMe 4FYYB 5CCAA 3CCST 2KRSA 2KGTA 2P84A 2JTEA 4ATOA 2E6NA 2QEXT 3L2QA 2MWPA 1R8OB 4M7DC 1MMGA 1X27A 2ED1A 2HNIA 4PFOA 1KIKA 2R5MA 2DZ9A 2MYSA 2J6FA 3MEVA 4J6XA 1G2BA 3EGDA 1I4K1 1QMCA 2DXBA 1BCMA 1EX4A 1K76A 2RM4A 2E6ZA 2CP3A 2JUFA 4M7DF 2DYIA 2RB6A 3EFRA 1B34A 1K9AA 3RESA 1VQKQ 2EGAA 3X28B 2MCNA 1D0ZA 3TEEA 3VJPA 2IIMA 3HRTA 1FXXA 5GAMg 2NUTA 1BI2A 2IG0A 1KJWA 5L8RE 1GBRA 4HVUA 1PG5B 3NTKA 5GANd 4IKFA 3MP6A 2YHTA 4F7UB 1FMVA 3RERA 4XTWA 1AWXA 2A28A 4J5YA 4RTXA 3CCJA 3JV3A 1K73C 4IUUA 3KXTA 3MCAB 3QWYA 3OYGA 2EQIA 1QCFA 3ASKA 1TH7A 3JSCA 2HSPA 3HP9A 3LW5E 2RQTA 2A37A 4V2SA 4J8OA 2XK0A 4QT7A 1YJ9T 2LX7A 4GLKA 4EMGA 3M0QA 5A0LA 3M9QA 4RCCA 1VQ6A 2EJ9A 1YIJT 3F70A 1UE9A 4QKUA 2KQWA 1JRIA 2KT1A 2KMTA 3TSZA 1GCQC 1BIAA 3HPWA 1R0CB 1K73R 5KCHA 4LXCA 1YJ9Q 1LCKA 2DL5A 1UUEA 1K0SA 2I2LA 1Z9QA 2O4XA 4M75G 1Q82C 3A8MB 3OW2A 3FJ5A 3OYLA 5FROA 2DKGA 3QHSA 5GANe 4AFUC 2DBKA 5LJ3g 2J7IA 2CSQA 2DTIA 2KRNA 3SWNB 2OI3A 1VQ9A 2AKKA 2JOYA 3JB9D 1ZSGA 4MDXA 2CP2A 2COYA 5DM7R 2E41A 3G6EQ 1BYMA 2K3XA 3GF5A 2CH4A 4XTUA 2SEMA 2K2MA 5GAOl 7AT1B 1MGQA 3X24B 4M77G 4EMKB 1GRIA 1UB4A 2JNGA 5FU6B 2R57A 3CC7Q 2C06A 4PKCC 2HBPA 3RKXA 2DO3A 1YJNA 1SSFA 1MMDA 1CSKA 5KYWB 1AOJA 2KYBA 2QAZA 4X1VA 3CCUQ 5FRNA 4LUEA 5GAN7 2H8HA 1M3CA 2OJ2A 3TU4K 3CBOA 3UATA 3UWNA 4AFZC 1XTDA 3UF4A 3A8OB 5A2QE 2XICA 3QG1A 4PJOC 2XI9A 3ZBDA 1W2BP 3SEMA 3JAME 1RLPC 2EYWA 3RKYA 1Q82U 4RG8A 4BI8B 2L5QA 5J39A 1Y0MA 3TSWA 2GGRA 3GOXA 2MPXC 1VQ8A 3PVQA 4F7UF 2P0KA 2QQAA 3NPFA 4PJOF 4LDYA 2DZCA 3JCMX 5GAOp 4IURA 3CCRA 4N0AA 1Y57A 1YP5A 3CCQA 1I8FA 3CC4Q 4C0DB 5CR2A 5LJ5d 3DLMA 3CCJT 1AEYA 3SB2A 3QPHA 3VS5A 4ZNXA 4M7DG 3QKJA 3VS3A 2ED0A 2ZZDA 2LJ3A 5IHIA 1JXMA 5CKEA 3P8BB 4OP0A 2X35A 5FWBA 1K1ZA 2RA2A 3H0IA 4J9BA 5HKCA 2MIOA 5GAMh 4RMOA 2JM9A 2V1QA 1OPLA 2CZ0B 2W10A 3JCMV 2RK1A 1VQ6T 2DL3A 1WQWA 4QQ6A 3JCMc 1KG1A 1ABOA 1AD5A 2A08A 4LE9A 5IHKA 3GNGA 1H3HA 2RH2A 2ABLA 1OU8A 4IIMA 2DPPB 2J6KA 1TSFA 3OYBA 4GY5A 1MUZA 1WHGA 1JJ2S 1QLYA 2EKHA 3EHQA 2E70A 1W6XA 1VOMA 1SKUB 2QGFB 2LCSA 1N8RC 4IUQA 2CDTA 5GMKj 1D0XA 2DVEA 3META 2RJFA 1Y96A 3G4SQ 4J7IA 2P4TA 4C8QE 2JM8A 3H0HA 4RTWA 5D6XA 2COWA 1VQ9T 2EQJA 1O9SA 2DL8A 1T0JA 2KXDA 4E6RA 4Z8AA 2ZPGB 3NTIA 3EGDB 3IQLA 5FLXE 1RABB 2GFUA 5J26A 5A0GA 4C92C 2RN8A 3REAB 4L5GA 2P0QA 3INZA 3FIFA 1B34B 2FL7A 1VQLA 1KHCA 3L2VA 1W70A 1FMWA 2JS0A 4AG1C 4B9XA 3J81E 3S3NA 4EPCA 1VQ4Q 4C92F 1YJNT 1B07A 1NG2A 4LDXA 1UFFA 1X75C 5LJ3h 2L3QA 3RMSA 1YITQ 5GAOq 1YWOA 2K79A 2J06A 2WSFE 5CKHA 2O2OA 4KRTA 1GFDA 2EAYA 4JLGA 1YCSB 1X6BA 2XG8D 1RADB 4ESRA 4C0DC 2RMOA 1RAFB 3JCMQ 3EG2A 3RKWA 4FT4A 4CC7A 2CSIA 3JB9H 3NMZC 3CXCA 5GAMd 2MF2A 3OS1A 1VQ7A 3L2UA 3JB9I 1VQ8T 2GFAA 2QQ9A 5EC7A 1N8RU 4C0FA 3I55A 1Q81R 4Y91A 3C4SA 3CCRT 2DTOA 1X2KA 2EKOA 3SWNA 1WHJA 2V8IA 3UA7A 3CCQT 1OQKA 2F1LA 3I56Q 4EMHA 3EG0A 1S1NA 5CVIA 3PVLA 1VQNQ 1SHGA 3OY9A 4XU1A 4MMKA 2EWNA 1D1CA 1JO8A 1BI0A 4F16A 1GBQA 4EIKA 4ZTFA 4BUGA 4HT8A 2Y4YA 4AG2C 3CCRQ 1QVFA 2QDYB 1ZA2B 3CXCS 3BE3A 4KT0E 4EMKA 1MMNA 3EH1A 4M78G 1QP3A 2L2PA 3OYKA 2MAMA 2FVUA 2F69A 4OGEA 2YXYA 4DBFA 4F7UG 2G3RA 2D0NA 1KQSA 4PJOG 1BI3A 2JS2A 4A4EA 2L3RA 5KYWA 3VYGA 4KBMB 1OV3A 1DJ7B 2WSCE 1M27C 3OYYA 1PSEA 2DETA 2RD1A 3RUXA 2X4JA 4C0GA 4RTUA 1LNXA 1VQOQ 2X3XD 1OULA 1FYNA 1QVFS 2F5KA 3QBYA 4J6YA 3LH0A 1TWBA 3VS6A 1M2VB 2GCXA 3URGA 3CCLA 1KHIA 2M51A 3C94A 3PIOA 3EG1A 4MZPA 3G7ZA 1YN8A 3LX7A 3TVTA 2AKLA 1NPPA 2RI5A 5LJ3d 4NL3A 2V1RA 2NUZA 3QZ9B 2E1HA 2R58A 4KGZB 1U8RA 3SDZA 4RG2A 4RTTA 5L23A 5I21A 5GMKm 3G71Q 5KE3A 4HCZA 1G5VA 1VQPQ 4J6WA 2VASA 1QWFA 1ZBXA 2RF0A 1I07A 2QASA 4FYVB 3E9GA 5CO7A 1NYGA 3R6OA 1VQLT 4XAXB
chains in the Genus database with same CATH topology
2RQTA 2BZYA 2A37A 4J9GA 4QT7A 1GCPA 2LX7A 3GBQA 4RTZA 4HXJA 1SSHA 1GCQA 4JPBW 2O9VA 3M0QA 2FG0A 2FPEA 3KFVA 2EYYA 1ZUKA 1UE9A 3ULRB 1TG0A 1UJYA 1V1CA 4J9CA 2DX1A 2VWFA 3NGPA 2KT1A 3TSZA 4ORZA 1H92A 2ENMA 1CKAA 1GCQC 1QKWA 1UTIA 1WYXA 1VA7A 1WDXA 2RQVA 4Y92A 5GJWB 1LCKA 2DL5A 1E7OA 1UUEA 1PRLC 1K0SA 1Z9QA 2RNAA 2O31A 2J05A 3I5SA 5HCKA 3FJ5A 2FRWA 1ZUYA 1GFCA 4AFUC 2P4RA 1WXBA 2PTKA 4K11A 2DBKA 1PRMC 2XMFA 1NEGA 1UG1A 2J7IA 2CSQA 2KRNA 2OI3A 2HEQA 2AKKA 2LP5A 1ZSGA 1PWTA 2FRYA 1PHTA 1FMKA 2DMOA 1U06A 3VS4A 3C0CA 1SRLA 2LQWA 1UHFA 1T0HA 2CH4A 1N5ZA 2SEMA 2KYMA 1AWOA 1WXTA 2K2MA 4RTVA 2O9SA 3M0UA 3THKA 2DRMA 2CT3A 1NM7A 1GRIA 2KNBB 2D8HA 2F2VA 3M0SA 1KFZA 1JXOA 1WFWA 2ESWA 5IXFA 2YDLA 1CSKA 4RTYA 1AOJA 2KYBA 4X1VA 1X69A 2O88A 2ROTA 4D8KA 3EHRA 1X6GA 4LUEA 2F2WA 2H8HA 2RQUA 1MV0B 1M3CA 2OJ2A 2LJ1A 1GL5A 1XOVA 1VYUA 3UATA 1PKTA 4AFZC 2RQRA 3UF4A 3VRYA 1SRMA 3VRZA 1UDLA 2VKNA 3VS0A 3H0FA 1A0NB 2BZXA 2EGCA 1JU5C 2X3WD 3SEMA 1RLPC 1UGVA 2DYBA 2EYWA 2RPNA 2GTOA 2KT8A 2GNCA 1JQQA 4GLMA 1BB9A 1Y0MA 4RUGA 4WCIA 2GGRA 3TSWA 1BK2A 1YWPA 3PVQA 2C0OA 3H41A 4A63B 2YT6A 3NPFA 2SRCA 1M3AA 4JZ3A 2J6OA 2HDAA 3VS2A 2FEIA 2JW4A 1Y57A 1YP5A 1OPKA 1JEGA 1AEYA 1PKSA 3I35A 3I9QA 1AZEA 1ARKA 3VS5A 2MOXA 4ZNXA 1M8MA 2QDLA 3VS3A 2ED0A 2EYXA 2LQNA 2LJ3A 5IHIA 1JXMA 3SHWA 2JXBA 4OMLA 1SHFA 4F14A 1WA7A 5FWBA 2L3PA 1K1ZA 3H0IA 4J9BA 2CUBA 2MIOA 2LJ0A 1AVZC 4HCKA 2EPDA 2JM9A 4J9HA 4OMOA 2V1QA 4Z88A 1OPLA 2W10A 1AWWA 1K4US 1UECA 2DL3A 2M0YA 1ABOA 1AD5A 2A08A 3I5RA 4LE9A 2DJQA 3R6NA 5IHKA 1AZGB 1H8KA 1NEBA 1H3HA 2K9GA 2EYZA 2I0NA 4GBQA 2EVRA 1AWJA 2ABLA 2YSQA 1WIEA 2YUPA 4IIMA 2J6KA 5IHNA 1I1JA 1MUZA 1NYFA 1QLYA 2CREA 2OAWA 2EKHA 1IO6A 3EHQA 4DEXA 2DL4A 1KSWA 2D8JA 3UA6A 1MV3A 3PE0A 2EGEA 4OMPA 3M0TA 1I0CA 1T3LA 1W6XA 2FO0A 2LMJA 1RLQC 3VS1A 2LCSA 2L0AA 2CDTA 2CT4A 4J9DA 1W1FA 4F17A 4J9IA 1WI7A 2G6FX 2A36A 2DA9A 2JM8A 1ZUUA 3H0HA 4RTWA 1ZBJA 1Z9ZA 2KE9A 1E6GA 1UJ0A 2EW3A 1HD3A 4AFQC 2DL8A 1T0JA 2KXDA 4E6RA 2JMAA 4Z8AA 1SPKA 1ZLMA 1RI9A 4J9FA 3IQLA 2K7AA 1G83A 2AK5A 1HSQA 5ECAA 2K6DA 2RN8A 3REAB 4DEYA 4LN2A 4D8DA 1W70A 2DL7A 3M0PA 4CC4B 2JS0A 1E6HA 4AG1C 5I11A 2L3SA 1B07A 2HCKA 2DILA 3RNJA 5I22A 1CKBA 1NG2A 2PZ1A 2C0IA 1UFFA 2YUNA 2GTJA 4IIOA 2DRKA 2L3QA 1TUCA 1YWOA 1HJDA 2D1XA 2LZ6B 2K79A 2J06A 1UHCA 2O2OA 1NLOC 4KRTA 1T3SA 2DBMA 2B86A 1X43A 1GFDA 3REBB 2ROLA 2K3BA 1YCSB 1X6BA 4ESRA 2DLPA 2RMOA 3EG2A 1WLPB 1U5SA 1ZX6A 1WX6A 4LUDA 5GJVB 3ZL7C 4CC7A 2CSIA 2F2XA 3QWXX 3NMZC 2C0TA 2E5KA 2DNUA 1VYTA 3U23A 1SEMA 4AFSC 4OMNA 5EC7A 2KEAA 2ECZA 4CC3A 1U3OA 2RQWA 5IH2A 2LNHB 1X2KA 1QWEA 3O5ZA 2KBTA 1TUDA 1VYVA 3UA7A 2VVKA 3EG0A 3A98A 1OOTA 2KXCA 2JMCA 1S1NA 3PVLA 4M4ZA 1SHGA 2YUQA 1JO8A 4R0KA 2KROA 1GBQA 4EIKA 4F16A 4J9EA 4AG2C 2PNIA 1ABQA 2JT4A 3CQTA 3VS7A 2DVJA 5FWCA 1EFNA 3EGUA 2W0ZA 3LH5A 2L2PA 1NLPC 3RBBB 4CC2A 2KRSA 2KGTA 2JTEA 1YNZA 2DM1A 2GQIA 2KR3A 4OMQA 4Z89A 5IXBA 1X27A 2D0NA 2ED1A 2JS2A 1M30A 1KIKA 2CH4W 2J6FA 4LNPA 3M0RA 2BTTA 1OV3A 1G2BA 2NWMA 1BBZA 4HVVA 1M27C 2EBPA 1K76A 4RTUA 4FSSA 2HBWA 1M3BA 2X3XD 3NHNA 1BU1A 1FYNA 1K9AA 4JZ4A 2EGAA 2BZ8A 2MCNA 3VS6A 4HVWA 2CUDA 2IIMA 2FPFA 2M51A 2DE0X 1RUWA 2GBQA 2KRMA 3EG1A 1KJWA 4OMMA 1GBRA 1YN8A 3TVTA 2AKLA 1WXUA 4HVUA 2V1RA 2NUZA 1B3QA 3EG3A 2AZVA 4RTTA 5L23A 1OEBA 2AZSA 1AWXA 2A28A 4RTXA 3JV3A 2FPDA 4JJCA 1X2QA 1QWFA 2RF0A 1I07A 3QWYA 1QKXA 4JJBA 2EQIA 1QCFA 1PNJA 1J3TA 2YUOA 5FW9A 1NYGA 1K0XA 4JJDA 2DF6A 2HSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQT A;  2BZY A;  2A37 A;  4J9G A;  4QT7 A;  1GCP A;  2LX7 A;  3GBQ A;  4RTZ A;  4HXJ A;  1SSH A;  1GCQ A;  4JPB W;  2O9V A;  3M0Q A;  2FG0 A;  2FPE A;  3KFV A;  2EYY A;  1ZUK A;  1UE9 A;  3ULR B;  1TG0 A;  1UJY A;  1V1C A;  4J9C A;  2DX1 A;  2VWF A;  3NGP A;  2KT1 A;  3TSZ A;  4ORZ A;  1H92 A;  2ENM A;  1CKA A;  1GCQ C;  1QKW A;  1UTI A;  1WYX A;  1VA7 A;  1WDX A;  2RQV A;  4Y92 A;  5GJW B;  1LCK A;  2DL5 A;  1E7O A;  1UUE A;  1PRL C;  1K0S A;  1Z9Q A;  2RNA A;  2O31 A;  2J05 A;  3I5S A;  5HCK A;  3FJ5 A;  2FRW A;  1ZUY A;  1GFC A;  4AFU C;  2P4R A;  1WXB A;  2PTK A;  4K11 A;  2DBK A;  1PRM C;  2XMF A;  1NEG A;  1UG1 A;  2J7I A;  2CSQ A;  2KRN A;  2OI3 A;  2HEQ A;  2AKK A;  2LP5 A;  1ZSG A;  1PWT A;  2FRY A;  1PHT A;  1FMK A;  2DMO A;  1U06 A;  3VS4 A;  3C0C A;  1SRL A;  2LQW A;  1UHF A;  1T0H A;  2CH4 A;  1N5Z A;  2SEM A;  2KYM A;  1AWO A;  1WXT A;  2K2M A;  4RTV A;  2O9S A;  3M0U A;  3THK A;  2DRM A;  2CT3 A;  1NM7 A;  1GRI A;  2KNB B;  2D8H A;  2F2V A;  3M0S A;  1KFZ A;  1JXO A;  1WFW A;  2ESW A;  5IXF A;  2YDL A;  1CSK A;  4RTY A;  1AOJ A;  2KYB A;  4X1V A;  1X69 A;  2O88 A;  2ROT A;  4D8K A;  3EHR A;  1X6G A;  4LUE A;  2F2W A;  2H8H A;  2RQU A;  1MV0 B;  1M3C A;  2OJ2 A;  2LJ1 A;  1GL5 A;  1XOV A;  1VYU A;  3UAT A;  1PKT A;  4AFZ C;  2RQR A;  3UF4 A;  3VRY A;  1SRM A;  3VRZ A;  1UDL A;  2VKN A;  3VS0 A;  3H0F A;  1A0N B;  2BZX A;  2EGC A;  1JU5 C;  2X3W D;  3SEM A;  1RLP C;  1UGV A;  2DYB A;  2EYW A;  2RPN A;  2GTO A;  2KT8 A;  2GNC A;  1JQQ A;  4GLM A;  1BB9 A;  1Y0M A;  4RUG A;  4WCI A;  2GGR A;  3TSW A;  1BK2 A;  1YWP A;  3PVQ A;  2C0O A;  3H41 A;  4A63 B;  2YT6 A;  3NPF A;  2SRC A;  1M3A A;  4JZ3 A;  2J6O A;  2HDA A;  3VS2 A;  2FEI A;  2JW4 A;  1Y57 A;  1YP5 A;  1OPK A;  1JEG A;  1AEY A;  1PKS A;  3I35 A;  3I9Q A;  1AZE A;  1ARK A;  3VS5 A;  2MOX A;  4ZNX A;  1M8M A;  2QDL A;  3VS3 A;  2ED0 A;  2EYX A;  2LQN A;  2LJ3 A;  5IHI A;  1JXM A;  3SHW A;  2JXB A;  4OML A;  1SHF A;  4F14 A;  1WA7 A;  5FWB A;  2L3P A;  1K1Z A;  3H0I A;  4J9B A;  2CUB A;  2MIO A;  2LJ0 A;  1AVZ C;  4HCK A;  2EPD A;  2JM9 A;  4J9H A;  4OMO A;  2V1Q A;  4Z88 A;  1OPL A;  2W10 A;  1AWW A;  1K4U S;  1UEC A;  2DL3 A;  2M0Y A;  1ABO A;  1AD5 A;  2A08 A;  3I5R A;  4LE9 A;  2DJQ A;  3R6N A;  5IHK A;  1AZG B;  1H8K A;  1NEB A;  1H3H A;  2K9G A;  2EYZ A;  2I0N A;  4GBQ A;  2EVR A;  1AWJ A;  2ABL A;  2YSQ A;  1WIE A;  2YUP A;  4IIM A;  2J6K A;  5IHN A;  1I1J A;  1MUZ A;  1NYF A;  1QLY A;  2CRE A;  2OAW A;  2EKH A;  1IO6 A;  3EHQ A;  4DEX A;  2DL4 A;  1KSW A;  2D8J A;  3UA6 A;  1MV3 A;  3PE0 A;  2EGE A;  4OMP A;  3M0T A;  1I0C A;  1T3L A;  1W6X A;  2FO0 A;  2LMJ A;  1RLQ C;  3VS1 A;  2LCS A;  2L0A A;  2CDT A;  2CT4 A;  4J9D A;  1W1F A;  4F17 A;  4J9I A;  1WI7 A;  2G6F X;  2A36 A;  2DA9 A;  2JM8 A;  1ZUU A;  3H0H A;  4RTW A;  1ZBJ A;  1Z9Z A;  2KE9 A;  1E6G A;  1UJ0 A;  2EW3 A;  1HD3 A;  4AFQ C;  2DL8 A;  1T0J A;  2KXD A;  4E6R A;  2JMA A;  4Z8A A;  1SPK A;  1ZLM A;  1RI9 A;  4J9F A;  3IQL A;  2K7A A;  1G83 A;  2AK5 A;  1HSQ A;  5ECA A;  2K6D A;  2RN8 A;  3REA B;  4DEY A;  4LN2 A;  4D8D A;  1W70 A;  2DL7 A;  3M0P A;  4CC4 B;  2JS0 A;  1E6H A;  4AG1 C;  5I11 A;  2L3S A;  1B07 A;  2HCK A;  2DIL A;  3RNJ A;  5I22 A;  1CKB A;  1NG2 A;  2PZ1 A;  2C0I A;  1UFF A;  2YUN A;  2GTJ A;  4IIO A;  2DRK A;  2L3Q A;  1TUC A;  1YWO A;  1HJD A;  2D1X A;  2LZ6 B;  2K79 A;  2J06 A;  1UHC A;  2O2O A;  1NLO C;  4KRT A;  1T3S A;  2DBM A;  2B86 A;  1X43 A;  1GFD A;  3REB B;  2ROL A;  2K3B A;  1YCS B;  1X6B A;  4ESR A;  2DLP A;  2RMO A;  3EG2 A;  1WLP B;  1U5S A;  1ZX6 A;  1WX6 A;  4LUD A;  5GJV B;  3ZL7 C;  4CC7 A;  2CSI A;  2F2X A;  3QWX X;  3NMZ C;  2C0T A;  2E5K A;  2DNU A;  1VYT A;  3U23 A;  1SEM A;  4AFS C;  4OMN A;  5EC7 A;  2KEA A;  2ECZ A;  4CC3 A;  1U3O A;  2RQW A;  5IH2 A;  2LNH B;  1X2K A;  1QWE A;  3O5Z A;  2KBT A;  1TUD A;  1VYV A;  3UA7 A;  2VVK A;  3EG0 A;  3A98 A;  1OOT A;  2KXC A;  2JMC A;  1S1N A;  3PVL A;  4M4Z A;  1SHG A;  2YUQ A;  1JO8 A;  4R0K A;  2KRO A;  1GBQ A;  4EIK A;  4F16 A;  4J9E A;  4AG2 C;  2PNI A;  1ABQ A;  2JT4 A;  3CQT A;  3VS7 A;  2DVJ A;  5FWC A;  1EFN A;  3EGU A;  2W0Z A;  3LH5 A;  2L2P A;  1NLP C;  3RBB B;  4CC2 A;  2KRS A;  2KGT A;  2JTE A;  1YNZ A;  2DM1 A;  2GQI A;  2KR3 A;  4OMQ A;  4Z89 A;  5IXB A;  1X27 A;  2D0N A;  2ED1 A;  2JS2 A;  1M30 A;  1KIK A;  2CH4 W;  2J6F A;  4LNP A;  3M0R A;  2BTT A;  1OV3 A;  1G2B A;  2NWM A;  1BBZ A;  4HVV A;  1M27 C;  2EBP A;  1K76 A;  4RTU A;  4FSS A;  2HBW A;  1M3B A;  2X3X D;  3NHN A;  1BU1 A;  1FYN A;  1K9A A;  4JZ4 A;  2EGA A;  2BZ8 A;  2MCN A;  3VS6 A;  4HVW A;  2CUD A;  2IIM A;  2FPF A;  2M51 A;  2DE0 X;  1RUW A;  2GBQ A;  2KRM A;  3EG1 A;  1KJW A;  4OMM A;  1GBR A;  1YN8 A;  3TVT A;  2AKL A;  1WXU A;  4HVU A;  2V1R A;  2NUZ A;  1B3Q A;  3EG3 A;  2AZV A;  4RTT A;  5L23 A;  1OEB A;  2AZS A;  1AWX A;  2A28 A;  4RTX A;  3JV3 A;  2FPD A;  4JJC A;  1X2Q A;  1QWF A;  2RF0 A;  1I07 A;  3QWY A;  1QKX A;  4JJB A;  2EQI A;  1QCF A;  1PNJ A;  1J3T A;  2YUO A;  5FW9 A;  1NYG A;  1K0X A;  4JJD A;  2DF6 A;  2HSP A; 
#chains in the Genus database with same CATH topology
 4XU3 A;  1BI1 A;  2RHY A;  3EFS A;  4J9G A;  2CP5 A;  4DA4 A;  2DD4 A;  3M56 A;  4D6W A;  1MNE A;  5GAO m;  4HXJ A;  2YRV A;  4PLI A;  2O9V A;  4C0Z A;  4ZTJ A;  1PD1 A;  2EYY A;  1X01 A;  5LL6 S;  1V1C A;  1BCO A;  2CP7 A;  4VUB A;  2VWF A;  2FZK B;  2BUD A;  3CEY A;  1JJ2 P;  2E5Q A;  2QGG A;  1E7O A;  3DLL A;  2PVG B;  3QJ6 A;  3CME A;  4NOY A;  2O31 A;  3I5S A;  3BDL A;  3OYE A;  4O5V A;  1GFC A;  2EQM A;  2FYK A;  5LJ3 e;  4LDU A;  1VQ7 T;  2P4R A;  3V7S A;  2D6F A;  2M0O A;  4K11 A;  4DBR A;  3MEU A;  2XD0 A;  2XMF A;  4C92 G;  5A0D A;  1YHQ A;  3I55 T;  2RI2 A;  3QYG B;  1QVG A;  1BKB A;  3D7S B;  2RJC A;  3MP1 A;  1RAE B;  5GAN 5;  2BE7 D;  1IB8 A;  4DOW A;  4XQ3 A;  1FMK A;  1EIF A;  1U06 A;  1SRL A;  2LQW A;  1VQ7 Q;  2PVD B;  4DBQ A;  1OYX A;  1MND A;  2DXU A;  1T0H A;  1N5Z A;  1AWO A;  3CCS Q;  2O9S A;  4BI4 A;  2AT1 B;  2E3H A;  3OMG A;  2QEX Q;  4BB7 A;  2LC4 A;  3OMC A;  5HY6 A;  2D8H A;  2F2V A;  8ATC B;  4QVZ A;  1OX8 A;  2ESW A;  3BY7 A;  1Q7Y R;  1JBM A;  1Y96 B;  2EFI A;  5CQX A;  3EAE A;  3V8J A;  5GAN 4;  1X69 A;  2LDM A;  3J7A F;  4M7A E;  4D8K A;  3EHR A;  2F2W A;  3HHT B;  2DER A;  1MV0 B;  3JCM f;  1UGP B;  1XOV A;  1VYU A;  1I5O B;  2RQR A;  2L8D A;  3VRY A;  4CI0 C;  1BIB A;  3H0F A;  3FEO A;  2ZAE A;  1X6O A;  1UGS B;  5D7U A;  3QZ5 B;  2EGC A;  2FHD A;  3GLX A;  2X3W D;  4C8Q D;  3EGX B;  4E7H A;  2GNC A;  3P8D A;  5GAN 6;  3CCL T;  4RUG A;  3EG9 A;  1BK2 A;  2COZ A;  2C0O A;  2K4Y A;  1QVP A;  2HQX A;  3A8L B;  4E2F B;  2OAU A;  4KGV B;  2J6O A;  2FEI A;  3PT9 A;  1G3Y A;  4L59 A;  3Q1J A;  5CKF A;  3CCL Q;  3L42 A;  1JEG A;  3I35 A;  3I9Q A;  1AZE A;  3CC2 A;  1OZ3 A;  4N0A C;  4E7J A;  1WHL A;  2DXC A;  4ZN3 A;  3OYF A;  3JB9 F;  3CXC P;  2EYX A;  3V8K A;  1IRE B;  3CC2 T;  2ZPH B;  4JUV A;  3SHW A;  1YIJ Q;  2JXB A;  3DKM A;  3C95 A;  3VUZ A;  4FM4 B;  2ZCF B;  2RI3 A;  3MEA A;  4HA8 A;  2L3P A;  2CUB A;  1AVZ C;  4HCK A;  4R56 A;  1C6V X;  1PSF A;  5GMK i;  5M9O A;  1K4U S;  1UEC A;  3FRN A;  1H3Z A;  1ZHI A;  1HYO A;  2AIR B;  4C8Q A;  1R0B G;  3I5R A;  4BD3 A;  1AZG B;  2L89 A;  3EH2 A;  1NEB A;  5GAN j;  2I0N A;  2LTO A;  1YI2 A;  2YSQ A;  1QVF P;  1WIE A;  4BE0 A;  2XDB A;  3BDU A;  5IHN A;  1RAI B;  1UEB A;  2VV5 A;  1K73 U;  3CME T;  2DL4 A;  1TOV A;  1KSW A;  2D8J A;  3UA6 A;  1MV3 A;  2D9T A;  4OMP A;  2EGE A;  3VUB A;  3PIP A;  3OW2 S;  1T3L A;  1M2V A;  1I5L A;  1KQS P;  3VS1 A;  2KDS A;  2RJE A;  4J9D A;  5HK0 A;  1MMA A;  4J9I A;  3GPL A;  2G6F X;  2A36 A;  1YHQ T;  1RI0 A;  1ZBJ A;  2QYZ A;  2XDP A;  2K5L A;  2V8K A;  5KYX A;  4M7A B;  3CME Q;  3CCV A;  4N4H A;  1E6G A;  1UJ0 A;  1K8A C;  4HKE A;  1SPK A;  1ZLM A;  1RI9 A;  1XNI A;  2K7A A;  5GAN f;  5ECA A;  4ZGJ B;  2X51 A;  2HKN A;  4M75 E;  2LT1 A;  4DEY A;  3JCM W;  2GF7 A;  4LN2 A;  1Q86 C;  2XKO C;  1YBY A;  3QDF A;  1G3S A;  5I11 A;  2L3S A;  2AHJ B;  2H3J A;  4JDS A;  4OGC A;  3HKS A;  2WSE E;  3O8V A;  2HMA A;  3OBY A;  2YUN A;  2RHI A;  3M4G A;  2DRK A;  3HFO A;  5GAN 2;  1W4S A;  2LZ6 B;  2LVM A;  2VXF A;  1K8A R;  2DBM A;  4PFZ A;  2B86 A;  3S6W A;  4PJL A;  1LJO A;  3REB B;  2HL3 A;  3HTR A;  3HRU A;  4YTL A;  4ZN1 A;  4F04 B;  1ZQ1 A;  1IHW A;  2DTH A;  1WHM A;  1WPY A;  2DLP A;  1M90 R;  1U5S A;  3ER0 A;  1Q86 R;  1VQM A;  4WF2 A;  1LPL A;  2QK0 A;  4A54 A;  4OMN A;  1C1A A;  2QQS A;  1OI1 A;  1NJI R;  3CCJ Q;  1HXD A;  3GP8 A;  4ELZ C;  1VIE A;  4PNO A;  2BKD N;  4MZM A;  2LNH B;  5CKD A;  5CIU A;  1ZA1 B;  5C0M A;  2XDD A;  1KD1 C;  2VVK A;  3A98 A;  2CP6 A;  1IHV A;  4M4Z A;  5GAN 8;  5KYU B;  2YUQ A;  5AYF A;  2CS7 A;  3SWN C;  5C6S A;  1KC8 R;  2JVV A;  3L1A A;  2PNI A;  2JT4 A;  3G1J A;  3L2W A;  3AT1 B;  4XU0 A;  5FWC A;  3LH5 A;  1VQ6 Q;  3RBB B;  4CC2 A;  3CBP A;  2DM1 A;  2GQI A;  2KR3 A;  2EQK A;  4Z89 A;  4EMK C;  1D0Y A;  1M30 A;  2BIV A;  3OBW A;  2P0P A;  1XQH A;  5FU6 C;  2OTJ A;  3M0R A;  1N9R A;  5GMK e;  2NWM A;  3QYH B;  1BBZ A;  2EBP A;  1KD1 R;  5FRM A;  1YI2 T;  4M7D E;  4M7A C;  1N27 A;  2HBW A;  5DLO A;  1M3B A;  1BU1 A;  5LJ5 j;  3A8H B;  4QW2 A;  4JZ4 A;  4M75 B;  3V7R A;  4A4G A;  3JB9 G;  4EDU A;  3TRE A;  2ZPF B;  4HVW A;  3CPF A;  3EGX A;  2DXT A;  2K5F A;  3OS5 A;  1G3T A;  1VQ9 Q;  2DE0 X;  1RUW A;  5IN1 A;  4FT2 A;  2YRC A;  4M7A F;  4OMM A;  1WXU A;  3HRS A;  1PM3 A;  1B3Q A;  3CBM A;  1KQ1 A;  3EFO A;  3EG3 A;  2CZ6 B;  1Q81 C;  1R77 A;  3OB9 A;  3CCV T;  4R55 A;  1OEB A;  4KGX B;  2FPD A;  2Y90 A;  1X2Q A;  4JJC A;  3CPW A;  1KD1 U;  1O75 A;  2PUO B;  1QKX A;  2MI6 A;  2VUB A;  5KYY B;  2E64 A;  1M2O A;  1PNJ A;  5LJ5 f;  1YJN Q;  1K0X A;  4M7A D;  2X4W A;  3M4Y A;  2IVW A;  1OZ2 A;  3S3O A;  3LGL A;  4PJM A;  2BZY A;  1D3B B;  3EG9 B;  5D6Y A;  2KI7 A;  1GCP A;  1QCO A;  4A53 A;  4JPB W;  2YRD A;  2FG0 A;  2FPE A;  3KFV A;  1ZUK A;  1ZSZ B;  3ULR B;  2PU9 B;  4OB2 B;  4J9C A;  4PJJ A;  2DX1 A;  4JRK A;  3CPW S;  2ENM A;  3CCM A;  1QKW A;  1K9M R;  2KK4 A;  4A4F A;  3X25 B;  1VA7 A;  2RQV A;  4BI3 A;  1VQ8 Q;  4UC4 A;  3OW2 P;  2RNA A;  5HCK A;  1VQM T;  4NL2 A;  3RIR A;  2PTK A;  2RJD A;  4J7F A;  4BE2 A;  1VQK A;  1XJW B;  1PRM C;  3CCQ Q;  1NEG A;  3RDV A;  1M9S A;  2YLB A;  4E7L A;  3JCM J;  5CAI A;  3KUF A;  1Y7X A;  2FRY A;  3V7C A;  4KH0 B;  2QTX A;  3A8G B;  1Q81 U;  4C8Q B;  4M7A A;  4LDW A;  2DMO A;  3CMA A;  3C0C A;  5I2M A;  1M1K C;  1WHK A;  1G8X A;  2X9H A;  3M57 A;  4RCB A;  4M7D B;  2CZ1 B;  2LCC A;  2DD5 A;  4C5E A;  2DRM A;  1IRX A;  1NM7 A;  1QW1 A;  2EJG A;  2D0Q B;  4DBH A;  2LNV A;  4XTV A;  1KFZ A;  1JXO A;  2YDL A;  4QQD A;  4RTY A;  2LQ8 A;  2QA4 A;  1UGR B;  3QII A;  4IUV A;  2YWW A;  1KQS S;  5GAM j;  2MMP A;  5KYX B;  2RHZ A;  2EJF A;  2OTJ T;  2LJ1 A;  1V29 B;  1GL5 A;  1H64 1;  1SF9 A;  4L6V 5;  4HCC A;  3VRZ A;  1M1K R;  1UDL A;  2VKN A;  3VS0 A;  3VU3 C;  2BZX A;  1WJQ A;  2JJ9 A;  3SFM A;  4JS4 A;  4C5H A;  2LRQ A;  3RR6 A;  3X26 B;  1F1B B;  5IT9 E;  1UGV A;  2DYB A;  1W2B A;  2KT8 A;  4ZGD B;  4M78 E;  3OS2 A;  2H3E B;  3M5A A;  4BDZ A;  1BB9 A;  4WCI A;  4E7K A;  4F7U E;  3H41 A;  4A63 B;  2YT6 A;  2VGN A;  1HK9 A;  4PJO E;  1YJW A;  2SRC A;  1M3A A;  5FU7 B;  4KUL A;  2DJZ A;  4X9D A;  4M75 D;  2JW4 A;  4E7S A;  4FW2 A;  5GAM f;  2LX9 A;  4ZGE B;  1D1A A;  4PL6 A;  1VQL Q;  4LDV A;  1MHN A;  3M55 A;  3UPU A;  1YFN A;  5KYU A;  1NZ9 A;  3G6E A;  2Y4X A;  2QDL A;  2F5T X;  1NBE B;  1TXQ A;  4FYX B;  3UDC A;  3OYD A;  2LQN A;  3QJY A;  4KUD K;  2EYQ A;  4LD6 A;  4C5G A;  4OML A;  1SHF A;  4PFP A;  4F14 A;  3FLG A;  2EIF A;  2RK2 A;  2NYS A;  4J9H A;  2XU8 A;  1Q7Y C;  9ATC B;  3CC7 A;  2M0Y A;  1PD0 A;  4JS5 A;  1RAH B;  3OQ5 A;  2DJQ A;  4N4I A;  2LCL A;  3CCU A;  4NS5 A;  5LJ3 j;  2K9G A;  2EYZ A;  3CCM T;  1AWJ A;  5I2S A;  1NYF A;  4C8Q C;  1WJR A;  4Z02 A;  4PLL A;  3I55 Q;  1QCN A;  3M0T A;  4M75 A;  1I0C A;  2JN0 A;  2FO0 A;  1RLQ C;  2MWO A;  2CGH A;  1FX7 A;  2CT4 A;  3CCM Q;  1VQK T;  1W1F A;  4F17 A;  4FYW B;  1RAC B;  2E3I A;  4C8Q F;  1ZUU A;  5KE2 A;  1Z9Z A;  3PNW C;  3OYM A;  1QVG S;  4BE1 A;  1KQ2 A;  5KYN A;  2JMA A;  3M59 A;  3CMA T;  2QXF A;  5LJ3 f;  5CKB A;  3OYC A;  3DB3 A;  1HSQ A;  1VUB A;  3KBG A;  2DAQ A;  2KAF A;  1UGQ B;  3CC4 A;  3QUI A;  5KYY A;  4D8D A;  2X4X A;  3M0P A;  4CC4 B;  1E6H A;  4M77 A;  4M78 B;  3CMA Q;  4C92 E;  1WQ7 A;  4CRI A;  1D3B A;  3CD6 A;  4M7D D;  1CKB A;  2QA4 T;  4PJO B;  3LYI A;  1LVK A;  2C0I A;  2HAX A;  4OF1 A;  4IIO A;  2E4H A;  1JB0 E;  1Q7Y U;  2DFU A;  1V76 A;  3CPW P;  3EFO B;  1G3W A;  3QDR B;  1ZSZ A;  3OSS C;  1NLO C;  3L2Z A;  2DIQ A;  1T3S A;  5FU7 C;  1TU0 B;  2ROL A;  4FU6 A;  2K3B A;  4QQG A;  5CQY A;  2QA4 Q;  1GXI E;  4DQ2 A;  3P8H A;  4AT1 B;  4E47 A;  5KH6 A;  4FCY A;  4WTO B;  1WX6 A;  4LUD A;  5GJV B;  1VIF A;  3ZL7 C;  5GMK h;  1I81 A;  4XK8 E;  2C0T A;  1VYT A;  3U23 A;  4ELY C;  4P5N A;  3BFM A;  4QVD A;  2KEA A;  1YJW T;  2ECZ A;  1QP2 A;  2QI2 A;  3OSV A;  4KH1 B;  1M4Z A;  1PC0 A;  2YLC A;  1D09 B;  2CYZ B;  8AT1 B;  1NPR A;  3G4S A;  2JZ2 A;  1VYV A;  3HL8 A;  5LJ5 h;  2B8A A;  3SD4 A;  1OOT A;  2KXC A;  5D6W A;  1IGU A;  3MJX A;  3CC2 Q;  4R0K A;  2BE9 B;  1YJW Q;  1B7T A;  5DLQ E;  4J9E A;  4A4K A;  2QQR A;  3G6E T;  2M02 A;  1D1B A;  5GMK l;  4M7D A;  1ABQ A;  3VS7 A;  1EFN A;  3EGU A;  2W0Z A;  3MO8 A;  1NLP C;  4B6M A;  3JCM g;  1YNZ A;  2NUP B;  2LQK A;  4OMQ A;  5IXB A;  3S3M A;  1U1S A;  3CC7 T;  4BDY A;  4XTZ A;  2CH4 W;  3PTA A;  1VQ4 A;  4LNP A;  4OB3 B;  2BTT A;  5CK9 A;  4HVV A;  3CCU T;  2M16 A;  2PUK B;  2ZPI B;  3WVD B;  1YIT A;  4FSS A;  3ME9 A;  3E2U A;  1Q82 R;  4IUP A;  2QG9 B;  3JCM b;  3NHN A;  1IXD A;  4X34 A;  2BZ8 A;  1M90 C;  1YHQ Q;  2CUD A;  2FPF A;  3QSU A;  4FIB A;  2GBQ A;  1VQ5 A;  4ANJ A;  4PJN A;  2KRM A;  1AHJ B;  3MP8 A;  4C92 B;  1Q95 G;  1NE8 A;  1NJI C;  4M78 C;  2ZGW A;  1IGQ A;  3JRZ A;  2CKK A;  5AT1 B;  2AZV A;  1M8V A;  2AZS A;  2K2V A;  3OS0 A;  3VV0 A;  4E7I A;  4JJB A;  3OYJ A;  4M78 F;  1J3T A;  2YUO A;  3MPU B;  3I56 A;  3CC4 T;  4HT9 A;  1C0M A;  5FW9 A;  1KC8 C;  1IZ6 A;  5GAO n;  4JJD A;  1VQN A;  2DF6 A;  4M77 E;  1Y71 A;  4IUT A;  3UT1 A;  1TUG B;  2KSS A;  6AT1 B;  1OU9 A;  4RTZ A;  3GBQ A;  1SSH A;  3VYH B;  2M9U A;  1GCQ A;  2EQU A;  3CD6 T;  4C8Q G;  2A3L A;  1TG0 A;  1UJY A;  3V8L A;  2E12 A;  4DOV A;  3NGP A;  4M78 D;  4OVA A;  4ORZ A;  1H92 A;  1CKA A;  2FB7 A;  5IAY A;  3M53 A;  4A4H A;  1UTI A;  1WYX A;  1WDX A;  4Y92 A;  1RL2 A;  5GJW B;  1JJ2 A;  1K8A U;  1PRL C;  4FL6 A;  3H8Z A;  4PJO D;  3CD6 Q;  4O6J A;  2J05 A;  4LD9 K;  4BY6 B;  2FRW A;  1ZUY A;  1RAG B;  1SG5 A;  1VQO A;  1M90 U;  1WXB A;  3C12 A;  3X20 B;  2RHX A;  1Q86 U;  2O01 E;  1UG1 A;  3J80 E;  2DIG A;  3GNF B;  3MEW A;  4Y28 E;  5GAN g;  2K57 A;  1QVG P;  2CZ7 B;  2HEQ A;  4B9W A;  2LP5 A;  1PWT A;  1NJI U;  1PHT A;  2LT4 A;  3G4S T;  3PFS A;  3VS4 A;  4MDW A;  2X4Y A;  2E10 A;  1UHF A;  1TS9 A;  4PK4 A;  2KYM A;  1WXT A;  2ZPE B;  2DEU A;  4RTV A;  3PMT A;  3TCJ A;  3M0U A;  2GQV A;  3G71 A;  3THK A;  2CT3 A;  5KCO A;  1VQP A;  2KNB B;  1KC8 U;  3CCE A;  3OYH A;  1FWZ A;  3M0S A;  1WFW A;  5IXF A;  4JRP A;  4M78 A;  5LJ5 e;  2M1H A;  3LGF A;  5J3B A;  2A0F B;  2O88 A;  2ROT A;  1S72 A;  4F7U A;  1X6G A;  1Y07 A;  1YI2 Q;  4N4G A;  4PJO A;  2RQU A;  1VQ4 T;  3OYN A;  2R5A A;  5GAO r;  3HFN A;  3PMI A;  4JRI A;  1PKT A;  2CP0 A;  1SRM A;  1A0N B;  2VGM A;  1K9M C;  1YIT T;  3M58 A;  1JU5 C;  4TVR A;  1WNL A;  2E65 A;  2NUT B;  2PVO B;  4C5I A;  1LOJ A;  2RPN A;  4QVC A;  2GTO A;  3QO3 A;  3VKI A;  2OTL A;  4OB1 B;  1N8R R;  3PGG A;  4M77 B;  1JQQ A;  4GLM A;  2VC8 A;  1U1T A;  1M1G A;  1YWP A;  1VQ5 T;  3CCV Q;  1AT1 B;  2K3Y A;  4JRQ A;  3L2R A;  3JCM h;  4JZ3 A;  2HDA A;  3VS2 A;  4JLI A;  1WJS A;  4Q5W A;  1OPK A;  1TTH B;  1PKS A;  1P92 A;  1VQ5 Q;  1ARK A;  2MOX A;  4C92 D;  1M8M A;  3MKD A;  1PCX A;  3I56 T;  2A7Y A;  2HZY A;  4XTY A;  3FC3 A;  4BAC A;  2VB6 A;  1OX9 A;  2DK3 A;  1VQN T;  4II1 A;  2PQW A;  3CCS A;  3RMQ A;  4KUI A;  3H6Z A;  1WA7 A;  1WZO A;  4OB0 B;  2QEX A;  2LJ0 A;  2EPD A;  1RAA B;  4OMO A;  4Z88 A;  4BY6 C;  2NUP A;  1AWW A;  4FW1 A;  4MML A;  4J83 A;  1WGS A;  3R6N A;  3OA6 A;  1H8K A;  3BW1 A;  4GBQ A;  2EVR A;  2HQE A;  5GAN 3;  2YUP A;  1VQM Q;  2VYT A;  2O4X B;  3FDR A;  3FJP A;  3TQ7 P;  5HK3 A;  1I1J A;  2JTM A;  2FZG B;  2CRE A;  2OAW A;  1K9M U;  2V8J A;  1IO6 A;  4DEX A;  2ATC B;  3PE0 A;  3E19 A;  2LMJ A;  2HQH A;  2OX7 A;  3JB9 J;  1VQO T;  2L0A A;  4HCB A;  1KK7 A;  2HKQ B;  1WI7 A;  5EG2 A;  4JJN K;  2DA9 A;  3HSB A;  2JTF A;  1EZZ B;  2Z0W A;  4M75 C;  4C92 A;  1WHH A;  2NLU A;  2IPO B;  5DY9 A;  2KE9 A;  2EW3 A;  1HD3 A;  4AFQ C;  5LJ5 g;  4XU2 A;  4J9F A;  2V26 A;  3T9N A;  2KY9 A;  1G83 A;  2AK5 A;  3MHX A;  2K6D A;  5GAM e;  4RKU E;  2QTV A;  4M75 F;  3M54 A;  1QQJ A;  2WAC A;  3WXM B;  3G71 T;  3OYA A;  2K5I A;  2DL7 A;  3DB4 A;  4AMC A;  3JCM P;  1VQP T;  3A5Z B;  3CCE T;  2MK5 A;  3NFC A;  2OTJ Q;  3JCM d;  1YJ9 A;  2HCK A;  2DIL A;  3RNJ A;  3LWH A;  4OMF B;  5I22 A;  3OYI A;  2PZ1 A;  1YIJ A;  3WVE B;  1ACM B;  1M5Q 1;  4M77 C;  2GTJ A;  1S72 T;  3ZFJ A;  2XID A;  1TUC A;  2VXE A;  2RHU A;  5GAN h;  3AHU A;  1HJD A;  2D1X A;  3E1S A;  2HSE B;  1UHC A;  3NTH A;  3CCE Q;  4E7Z A;  1X43 A;  4M77 F;  3LLR A;  1M1K U;  1ZSZ C;  3FB9 A;  3H9N A;  4FSX A;  2RO0 A;  1S72 Q;  1WLP B;  1N6A A;  1ZX6 A;  2F2X A;  3QWX X;  1W2B S;  2OTL T;  3A1P A;  2E5K A;  1M1F A;  2QQB A;  2DNU A;  2XHC A;  1SEM A;  4AFS C;  2HL5 C;  4CC3 A;  2HD0 A;  3ZEH A;  1U3O A;  2RQW A;  5IH2 A;  3GIB A;  4MZT A;  4M7A G;  1YCY A;  1QWE A;  1N9S A;  3O5Z A;  3LWI A;  4X9C A;  2KBT A;  1TUD A;  2ZPB B;  4XTX A;  3N5B B;  4M77 D;  2OTL Q;  4ME7 A;  2JMC A;  2KVQ G;  2DEQ A;  2KRO A;  3QXE B;  3CQT A;  2DVJ A;  2FZC B;  3E9F A;  3JCM e;  4FYY B;  5CCA A;  3CCS T;  2KRS A;  2KGT A;  2P84 A;  2JTE A;  4ATO A;  2E6N A;  2QEX T;  3L2Q A;  2MWP A;  1R8O B;  4M7D C;  1MMG A;  1X27 A;  2ED1 A;  2HNI A;  4PFO A;  1KIK A;  2R5M A;  2DZ9 A;  2MYS A;  2J6F A;  3MEV A;  4J6X A;  1G2B A;  3EGD A;  1I4K 1;  1QMC A;  2DXB A;  1BCM A;  1EX4 A;  1K76 A;  2RM4 A;  2E6Z A;  2CP3 A;  2JUF A;  4M7D F;  2DYI A;  2RB6 A;  3EFR A;  1B34 A;  1K9A A;  3RES A;  1VQK Q;  2EGA A;  3X28 B;  2MCN A;  1D0Z A;  3TEE A;  3VJP A;  2IIM A;  3HRT A;  1FXX A;  5GAM g;  2NUT A;  1BI2 A;  2IG0 A;  1KJW A;  5L8R E;  1GBR A;  4HVU A;  1PG5 B;  3NTK A;  5GAN d;  4IKF A;  3MP6 A;  2YHT A;  4F7U B;  1FMV A;  3RER A;  4XTW A;  1AWX A;  2A28 A;  4J5Y A;  4RTX A;  3CCJ A;  3JV3 A;  1K73 C;  4IUU A;  3KXT A;  3MCA B;  3QWY A;  3OYG A;  2EQI A;  1QCF A;  3ASK A;  1TH7 A;  3JSC A;  2HSP A;  3HP9 A;  3LW5 E;  2RQT A;  2A37 A;  4V2S A;  4J8O A;  2XK0 A;  4QT7 A;  1YJ9 T;  2LX7 A;  4GLK A;  4EMG A;  3M0Q A;  5A0L A;  3M9Q A;  4RCC A;  1VQ6 A;  2EJ9 A;  1YIJ T;  3F70 A;  1UE9 A;  4QKU A;  2KQW A;  1JRI A;  2KT1 A;  2KMT A;  3TSZ A;  1GCQ C;  1BIA A;  3HPW A;  1R0C B;  1K73 R;  5KCH A;  4LXC A;  1YJ9 Q;  1LCK A;  2DL5 A;  1UUE A;  1K0S A;  2I2L A;  1Z9Q A;  2O4X A;  4M75 G;  1Q82 C;  3A8M B;  3OW2 A;  3FJ5 A;  3OYL A;  5FRO A;  2DKG A;  3QHS A;  5GAN e;  4AFU C;  2DBK A;  5LJ3 g;  2J7I A;  2CSQ A;  2DTI A;  2KRN A;  3SWN B;  2OI3 A;  1VQ9 A;  2AKK A;  2JOY A;  3JB9 D;  1ZSG A;  4MDX A;  2CP2 A;  2COY A;  5DM7 R;  2E41 A;  3G6E Q;  1BYM A;  2K3X A;  3GF5 A;  2CH4 A;  4XTU A;  2SEM A;  2K2M A;  5GAO l;  7AT1 B;  1MGQ A;  3X24 B;  4M77 G;  4EMK B;  1GRI A;  1UB4 A;  2JNG A;  5FU6 B;  2R57 A;  3CC7 Q;  2C06 A;  4PKC C;  2HBP A;  3RKX A;  2DO3 A;  1YJN A;  1SSF A;  1MMD A;  1CSK A;  5KYW B;  1AOJ A;  2KYB A;  2QAZ A;  4X1V A;  3CCU Q;  5FRN A;  4LUE A;  5GAN 7;  2H8H A;  1M3C A;  2OJ2 A;  3TU4 K;  3CBO A;  3UAT A;  3UWN A;  4AFZ C;  1XTD A;  3UF4 A;  3A8O B;  5A2Q E;  2XIC A;  3QG1 A;  4PJO C;  2XI9 A;  3ZBD A;  1W2B P;  3SEM A;  3JAM E;  1RLP C;  2EYW A;  3RKY A;  1Q82 U;  4RG8 A;  4BI8 B;  2L5Q A;  5J39 A;  1Y0M A;  3TSW A;  2GGR A;  3GOX A;  2MPX C;  1VQ8 A;  3PVQ A;  4F7U F;  2P0K A;  2QQA A;  3NPF A;  4PJO F;  4LDY A;  2DZC A;  3JCM X;  5GAO p;  4IUR A;  3CCR A;  4N0A A;  1Y57 A;  1YP5 A;  3CCQ A;  1I8F A;  3CC4 Q;  4C0D B;  5CR2 A;  5LJ5 d;  3DLM A;  3CCJ T;  1AEY A;  3SB2 A;  3QPH A;  3VS5 A;  4ZNX A;  4M7D G;  3QKJ A;  3VS3 A;  2ED0 A;  2ZZD A;  2LJ3 A;  5IHI A;  1JXM A;  5CKE A;  3P8B B;  4OP0 A;  2X35 A;  5FWB A;  1K1Z A;  2RA2 A;  3H0I A;  4J9B A;  5HKC A;  2MIO A;  5GAM h;  4RMO A;  2JM9 A;  2V1Q A;  1OPL A;  2CZ0 B;  2W10 A;  3JCM V;  2RK1 A;  1VQ6 T;  2DL3 A;  1WQW A;  4QQ6 A;  3JCM c;  1KG1 A;  1ABO A;  1AD5 A;  2A08 A;  4LE9 A;  5IHK A;  3GNG A;  1H3H A;  2RH2 A;  2ABL A;  1OU8 A;  4IIM A;  2DPP B;  2J6K A;  1TSF A;  3OYB A;  4GY5 A;  1MUZ A;  1WHG A;  1JJ2 S;  1QLY A;  2EKH A;  3EHQ A;  2E70 A;  1W6X A;  1VOM A;  1SKU B;  2QGF B;  2LCS A;  1N8R C;  4IUQ A;  2CDT A;  5GMK j;  1D0X A;  2DVE A;  3MET A;  2RJF A;  1Y96 A;  3G4S Q;  4J7I A;  2P4T A;  4C8Q E;  2JM8 A;  3H0H A;  4RTW A;  5D6X A;  2COW A;  1VQ9 T;  2EQJ A;  1O9S A;  2DL8 A;  1T0J A;  2KXD A;  4E6R A;  4Z8A A;  2ZPG B;  3NTI A;  3EGD B;  3IQL A;  5FLX E;  1RAB B;  2GFU A;  5J26 A;  5A0G A;  4C92 C;  2RN8 A;  3REA B;  4L5G A;  2P0Q A;  3INZ A;  3FIF A;  1B34 B;  2FL7 A;  1VQL A;  1KHC A;  3L2V A;  1W70 A;  1FMW A;  2JS0 A;  4AG1 C;  4B9X A;  3J81 E;  3S3N A;  4EPC A;  1VQ4 Q;  4C92 F;  1YJN T;  1B07 A;  1NG2 A;  4LDX A;  1UFF A;  1X75 C;  5LJ3 h;  2L3Q A;  3RMS A;  1YIT Q;  5GAO q;  1YWO A;  2K79 A;  2J06 A;  2WSF E;  5CKH A;  2O2O A;  4KRT A;  1GFD A;  2EAY A;  4JLG A;  1YCS B;  1X6B A;  2XG8 D;  1RAD B;  4ESR A;  4C0D C;  2RMO A;  1RAF B;  3JCM Q;  3EG2 A;  3RKW A;  4FT4 A;  4CC7 A;  2CSI A;  3JB9 H;  3NMZ C;  3CXC A;  5GAM d;  2MF2 A;  3OS1 A;  1VQ7 A;  3L2U A;  3JB9 I;  1VQ8 T;  2GFA A;  2QQ9 A;  5EC7 A;  1N8R U;  4C0F A;  3I55 A;  1Q81 R;  4Y91 A;  3C4S A;  3CCR T;  2DTO A;  1X2K A;  2EKO A;  3SWN A;  1WHJ A;  2V8I A;  3UA7 A;  3CCQ T;  1OQK A;  2F1L A;  3I56 Q;  4EMH A;  3EG0 A;  1S1N A;  5CVI A;  3PVL A;  1VQN Q;  1SHG A;  3OY9 A;  4XU1 A;  4MMK A;  2EWN A;  1D1C A;  1JO8 A;  1BI0 A;  4F16 A;  1GBQ A;  4EIK A;  4ZTF A;  4BUG A;  4HT8 A;  2Y4Y A;  4AG2 C;  3CCR Q;  1QVF A;  2QDY B;  1ZA2 B;  3CXC S;  3BE3 A;  4KT0 E;  4EMK A;  1MMN A;  3EH1 A;  4M78 G;  1QP3 A;  2L2P A;  3OYK A;  2MAM A;  2FVU A;  2F69 A;  4OGE A;  2YXY A;  4DBF A;  4F7U G;  2G3R A;  2D0N A;  1KQS A;  4PJO G;  1BI3 A;  2JS2 A;  4A4E A;  2L3R A;  5KYW A;  3VYG A;  4KBM B;  1OV3 A;  1DJ7 B;  2WSC E;  1M27 C;  3OYY A;  1PSE A;  2DET A;  2RD1 A;  3RUX A;  2X4J A;  4C0G A;  4RTU A;  1LNX A;  1VQO Q;  2X3X D;  1OUL A;  1FYN A;  1QVF S;  2F5K A;  3QBY A;  4J6Y A;  3LH0 A;  1TWB A;  3VS6 A;  1M2V B;  2GCX A;  3URG A;  3CCL A;  1KHI A;  2M51 A;  3C94 A;  3PIO A;  3EG1 A;  4MZP A;  3G7Z A;  1YN8 A;  3LX7 A;  3TVT A;  2AKL A;  1NPP A;  2RI5 A;  5LJ3 d;  4NL3 A;  2V1R A;  2NUZ A;  3QZ9 B;  2E1H A;  2R58 A;  4KGZ B;  1U8R A;  3SDZ A;  4RG2 A;  4RTT A;  5L23 A;  5I21 A;  5GMK m;  3G71 Q;  5KE3 A;  4HCZ A;  1G5V A;  1VQP Q;  4J6W A;  2VAS A;  1QWF A;  1ZBX A;  2RF0 A;  1I07 A;  2QAS A;  4FYV B;  3E9G A;  5CO7 A;  1NYG A;  3R6O A;  1VQL T;  4XAX B; 
#chains in the Genus database with same CATH homology
 2RQT A;  2BZY A;  2A37 A;  4J9G A;  4QT7 A;  1GCP A;  2LX7 A;  3GBQ A;  4RTZ A;  4HXJ A;  1SSH A;  1GCQ A;  4JPB W;  2O9V A;  3M0Q A;  2FG0 A;  2FPE A;  3KFV A;  2EYY A;  1ZUK A;  1UE9 A;  3ULR B;  1TG0 A;  1UJY A;  1V1C A;  4J9C A;  2DX1 A;  2VWF A;  3NGP A;  2KT1 A;  3TSZ A;  4ORZ A;  1H92 A;  2ENM A;  1CKA A;  1GCQ C;  1QKW A;  1UTI A;  1WYX A;  1VA7 A;  1WDX A;  2RQV A;  4Y92 A;  5GJW B;  1LCK A;  2DL5 A;  1E7O A;  1UUE A;  1PRL C;  1K0S A;  1Z9Q A;  2RNA A;  2O31 A;  2J05 A;  3I5S A;  5HCK A;  3FJ5 A;  2FRW A;  1ZUY A;  1GFC A;  4AFU C;  2P4R A;  1WXB A;  2PTK A;  4K11 A;  2DBK A;  1PRM C;  2XMF A;  1NEG A;  1UG1 A;  2J7I A;  2CSQ A;  2KRN A;  2OI3 A;  2HEQ A;  2AKK A;  2LP5 A;  1ZSG A;  1PWT A;  2FRY A;  1PHT A;  1FMK A;  2DMO A;  1U06 A;  3VS4 A;  3C0C A;  1SRL A;  2LQW A;  1UHF A;  1T0H A;  2CH4 A;  1N5Z A;  2SEM A;  2KYM A;  1AWO A;  1WXT A;  2K2M A;  4RTV A;  2O9S A;  3M0U A;  3THK A;  2DRM A;  2CT3 A;  1NM7 A;  1GRI A;  2KNB B;  2D8H A;  2F2V A;  3M0S A;  1KFZ A;  1JXO A;  1WFW A;  2ESW A;  5IXF A;  2YDL A;  1CSK A;  4RTY A;  1AOJ A;  2KYB A;  4X1V A;  1X69 A;  2O88 A;  2ROT A;  4D8K A;  3EHR A;  1X6G A;  4LUE A;  2F2W A;  2H8H A;  2RQU A;  1MV0 B;  1M3C A;  2OJ2 A;  2LJ1 A;  1GL5 A;  1XOV A;  1VYU A;  3UAT A;  1PKT A;  4AFZ C;  2RQR A;  3UF4 A;  3VRY A;  1SRM A;  3VRZ A;  1UDL A;  2VKN A;  3VS0 A;  3H0F A;  1A0N B;  2BZX A;  2EGC A;  1JU5 C;  2X3W D;  3SEM A;  1RLP C;  1UGV A;  2DYB A;  2EYW A;  2RPN A;  2GTO A;  2KT8 A;  2GNC A;  1JQQ A;  4GLM A;  1BB9 A;  1Y0M A;  4RUG A;  4WCI A;  2GGR A;  3TSW A;  1BK2 A;  1YWP A;  3PVQ A;  2C0O A;  3H41 A;  4A63 B;  2YT6 A;  3NPF A;  2SRC A;  1M3A A;  4JZ3 A;  2J6O A;  2HDA A;  3VS2 A;  2FEI A;  2JW4 A;  1Y57 A;  1YP5 A;  1OPK A;  1JEG A;  1AEY A;  1PKS A;  3I35 A;  3I9Q A;  1AZE A;  1ARK A;  3VS5 A;  2MOX A;  4ZNX A;  1M8M A;  2QDL A;  3VS3 A;  2ED0 A;  2EYX A;  2LQN A;  2LJ3 A;  5IHI A;  1JXM A;  3SHW A;  2JXB A;  4OML A;  1SHF A;  4F14 A;  1WA7 A;  5FWB A;  2L3P A;  1K1Z A;  3H0I A;  4J9B A;  2CUB A;  2MIO A;  2LJ0 A;  1AVZ C;  4HCK A;  2EPD A;  2JM9 A;  4J9H A;  4OMO A;  2V1Q A;  4Z88 A;  1OPL A;  2W10 A;  1AWW A;  1K4U S;  1UEC A;  2DL3 A;  2M0Y A;  1ABO A;  1AD5 A;  2A08 A;  3I5R A;  4LE9 A;  2DJQ A;  3R6N A;  5IHK A;  1AZG B;  1H8K A;  1NEB A;  1H3H A;  2K9G A;  2EYZ A;  2I0N A;  4GBQ A;  2EVR A;  1AWJ A;  2ABL A;  2YSQ A;  1WIE A;  2YUP A;  4IIM A;  2J6K A;  5IHN A;  1I1J A;  1MUZ A;  1NYF A;  1QLY A;  2CRE A;  2OAW A;  2EKH A;  1IO6 A;  3EHQ A;  4DEX A;  2DL4 A;  1KSW A;  2D8J A;  3UA6 A;  1MV3 A;  3PE0 A;  2EGE A;  4OMP A;  3M0T A;  1I0C A;  1T3L A;  1W6X A;  2FO0 A;  2LMJ A;  1RLQ C;  3VS1 A;  2LCS A;  2L0A A;  2CDT A;  2CT4 A;  4J9D A;  1W1F A;  4F17 A;  4J9I A;  1WI7 A;  2G6F X;  2A36 A;  2DA9 A;  2JM8 A;  1ZUU A;  3H0H A;  4RTW A;  1ZBJ A;  1Z9Z A;  2KE9 A;  1E6G A;  1UJ0 A;  2EW3 A;  1HD3 A;  4AFQ C;  2DL8 A;  1T0J A;  2KXD A;  4E6R A;  2JMA A;  4Z8A A;  1SPK A;  1ZLM A;  1RI9 A;  4J9F A;  3IQL A;  2K7A A;  1G83 A;  2AK5 A;  1HSQ A;  5ECA A;  2K6D A;  2RN8 A;  3REA B;  4DEY A;  4LN2 A;  4D8D A;  1W70 A;  2DL7 A;  3M0P A;  4CC4 B;  2JS0 A;  1E6H A;  4AG1 C;  5I11 A;  2L3S A;  1B07 A;  2HCK A;  2DIL A;  3RNJ A;  5I22 A;  1CKB A;  1NG2 A;  2PZ1 A;  2C0I A;  1UFF A;  2YUN A;  2GTJ A;  4IIO A;  2DRK A;  2L3Q A;  1TUC A;  1YWO A;  1HJD A;  2D1X A;  2LZ6 B;  2K79 A;  2J06 A;  1UHC A;  2O2O A;  1NLO C;  4KRT A;  1T3S A;  2DBM A;  2B86 A;  1X43 A;  1GFD A;  3REB B;  2ROL A;  2K3B A;  1YCS B;  1X6B A;  4ESR A;  2DLP A;  2RMO A;  3EG2 A;  1WLP B;  1U5S A;  1ZX6 A;  1WX6 A;  4LUD A;  5GJV B;  3ZL7 C;  4CC7 A;  2CSI A;  2F2X A;  3QWX X;  3NMZ C;  2C0T A;  2E5K A;  2DNU A;  1VYT A;  3U23 A;  1SEM A;  4AFS C;  4OMN A;  5EC7 A;  2KEA A;  2ECZ A;  4CC3 A;  1U3O A;  2RQW A;  5IH2 A;  2LNH B;  1X2K A;  1QWE A;  3O5Z A;  2KBT A;  1TUD A;  1VYV A;  3UA7 A;  2VVK A;  3EG0 A;  3A98 A;  1OOT A;  2KXC A;  2JMC A;  1S1N A;  3PVL A;  4M4Z A;  1SHG A;  2YUQ A;  1JO8 A;  4R0K A;  2KRO A;  1GBQ A;  4EIK A;  4F16 A;  4J9E A;  4AG2 C;  2PNI A;  1ABQ A;  2JT4 A;  3CQT A;  3VS7 A;  2DVJ A;  5FWC A;  1EFN A;  3EGU A;  2W0Z A;  3LH5 A;  2L2P A;  1NLP C;  3RBB B;  4CC2 A;  2KRS A;  2KGT A;  2JTE A;  1YNZ A;  2DM1 A;  2GQI A;  2KR3 A;  4OMQ A;  4Z89 A;  5IXB A;  1X27 A;  2D0N A;  2ED1 A;  2JS2 A;  1M30 A;  1KIK A;  2CH4 W;  2J6F A;  4LNP A;  3M0R A;  2BTT A;  1OV3 A;  1G2B A;  2NWM A;  1BBZ A;  4HVV A;  1M27 C;  2EBP A;  1K76 A;  4RTU A;  4FSS A;  2HBW A;  1M3B A;  2X3X D;  3NHN A;  1BU1 A;  1FYN A;  1K9A A;  4JZ4 A;  2EGA A;  2BZ8 A;  2MCN A;  3VS6 A;  4HVW A;  2CUD A;  2IIM A;  2FPF A;  2M51 A;  2DE0 X;  1RUW A;  2GBQ A;  2KRM A;  3EG1 A;  1KJW A;  4OMM A;  1GBR A;  1YN8 A;  3TVT A;  2AKL A;  1WXU A;  4HVU A;  2V1R A;  2NUZ A;  1B3Q A;  3EG3 A;  2AZV A;  4RTT A;  5L23 A;  1OEB A;  2AZS A;  1AWX A;  2A28 A;  4RTX A;  3JV3 A;  2FPD A;  4JJC A;  1X2Q A;  1QWF A;  2RF0 A;  1I07 A;  3QWY A;  1QKX A;  4JJB A;  2EQI A;  1QCF A;  1PNJ A;  1J3T A;  2YUO A;  5FW9 A;  1NYG A;  1K0X A;  4JJD A;  2DF6 A;  2HSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...