2DF6A

Crystal structure of the sh3 domain of betapix in complex with a high affinity peptide from pak2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 10
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2df6A00
2B86A 1T3SA 4JJCA 1SHFA 3NMZC 2O9VA 1I1JA 2FRYA 4J9HA 2CDTA 2EGEA 3ZL7C 2K3BA 5EC7A 3EG3A 2RQWA 2CUBA 1WYXA 1YNZA 5I11A 4K11A 2DM1A 2LZ6B 4RTYA 1VA7A 2DMOA 2O31A 3M0RA 3TSWA 2JM9A 2LNHB 3JV3A 1X2KA 2YDLA 1OPKA 3REBB 1VYTA 3EGUA 1J3TA 5FW9A 2KROA 2RQVA 2YUNA 1A0NB 2EVRA 3EHQA 1VYVA 1PKTA 4CC7A 3THKA 4ESRA 4CC4B 1AWXA 2M0YA 2RQTA 2A37A 4J9EA 2LJ0A 2RQRA 1HSQA 2M51A 2RPNA 1OV3A 1WXBA 1PKSA 4J9DA 1LCKA 1V1CA 2AKKA 1YN8A 1UTIA 1K1ZA 2I0NA 3M0SA 2CH4A 5IHNA 1U3OA 1U5SA 4ZNXA 2FPDA 1YP5A 1U06A 2YUQA 2BZXA 2GTOA 4DEYA 1MV3A 5I22A 2LQWA 2RF0A 1JXOA 4LN2A 3U23A 4OMNA 2LCSA 3LH5A 1BU1A 1PRLC 1M3BA 4AFSC 4F17A 2DX1A 2H8HA 5GJVB 2DBMA 1NLOC 4HVUA 3QWYA 1QKXA 3A98A 3VS0A 1G83A 4M4ZA 1AOJA 1K9AA 3PVLA 2BZ8A 4D8KA 2L0AA 1K4US 2LQNA 2KYBA 4J9BA 1I07A 4CC3A 2DBKA 1AVZC 2E5KA 3VS4A 1Z9ZA 1E6GA 1NM7A 1H92A 1TUCA 1JEGA 2F2WA 2D1XA 1ABQA 1UHFA 2DL5A 4HXJA 1UDLA 2O2OA 1TG0A 2L3QA 2D0NA 1MUZA 1M30A 1NEBA 1ZSGA 2VKNA 2FO0A 2IIMA 1HD3A 2LX7A 1GCQA 1WXTA 2PTKA 1I0CA 1BB9A 2ED1A 1ZUKA 3H41A 2A28A 1Z9QA 2EYYA 2L3SA 3SEMA 2DILA 1UE9A 1GCPA 2F2XA 2GQIA 1AWOA 2EGCA 4OMPA 4J9IA 2JW4A 3C0CA 2JTEA 3UF4A 1PHTA 2ABLA 4OMMA 3REAB 2BZYA 4RUGA 3M0PA 1AZEA 2LMJA 3H0FA 4EIKA 1Y57A 3VS1A 2GTJA 3TVTA 3I5RA 4JJDA 2DRKA 1NEGA 4IIOA 1ZBJA 2EKHA 5FWCA 4HCKA 2HCKA 4CC2A 1SHGA 5IXBA 1AZGB 3I9QA 1GFDA 4AG1C 2KRNA 1WX6A 4F16A 1JU5C 2EPDA 2FG0A 4RTXA 2YUOA 4QT7A 5IH2A 5IHIA 1VYUA 1QKWA 2JS2A 1SSHA 4Y92A 1QWEA 1KJWA 2DL8A 2JM8A 1ABOA 1ZLMA 4LE9A 1ARKA 1X43A 5L23A 2KXDA 2ROTA 1T0HA 4LUEA 1RI9A 1SPKA 1UJYA 2DL4A 4Z88A 1WIEA 2DJQA 3RNJA 1X6GA 1GRIA 2JXBA 1WLPB 4J9FA 2J6OA 3EHRA 2FPEA 1KFZA 2J05A 2FEIA 1X2QA 2PZ1A 2GNCA 3I5SA 3EG2A 2FRWA 4GLMA 2DF6A 3VS3A 3FJ5A 2EYZA 4AFUC 1UGVA 3VRZA 4Z8AA 2K2MA 2RQUA 2XMFA 2O88A 2ED0A 2C0OA 2F2VA 2CH4W 1X6BA 3VS6A 4FSSA 4AFZC 2ENMA 3I35A 3VS7A 1M8MA 1PNJA 1T3LA 1EFNA 2C0TA 2EYXA 3GBQA 1K0SA 1UJ0A 2CUDA 2GBQA 2CSQA 5FWBA 2DYBA 2HSPA 1YWOA 2JS0A 3UA7A 3VS5A 3M0QA 1WXUA 3H0HA 1NLPC 5HCKA 2KE9A 1X27A 1OPLA 2L3PA 1SRMA 3IQLA 1CKBA 1QCFA 2J06A 1GFCA 1CKAA 1TUDA 1RLPC 3RBBB 2YSQA 2HBWA 2D8HA 2SRCA 1GCQC 1ZX6A 3M0UA 4AG2C 1XOVA 2KR3A 3PVQA 4RTWA 1QWFA 2X3XD 2EGAA 2HEQA 4IIMA 2FPFA 4JJBA 1S1NA 1JXMA 2LJ1A 1M3CA 2MOXA 3SHWA 3TSZA 2DNUA 1M27C 1KSWA 1AWJA 4RTVA 5GJWB 4WCIA 2KT8A 2DRMA 1NG2A 2W10A 3R6NA 5IHKA 3UATA 2CT3A 2EYWA 2MIOA 2EBPA 2V1QA 1PWTA 3KFVA 4RTZA 2L2PA 2ESWA 1BK2A 2EW3A 1UECA 4HVVA 1OEBA 4X1VA 1YCSB 4RTUA 4HVWA 2JT4A 2KYMA 1CSKA 1FYNA 1E7OA 1QLYA 2NWMA 2C0IA 3VRYA 3PE0A 1IO6A 1JQQA 1GBQA 2K6DA 1PRMC 2DL7A 3CQTA 2G6FX 2VVKA 2X3WD 4GBQA 1UFFA 3NHNA 1NYGA 1K76A 1ZUYA 2DA9A 3O5ZA 2A36A 1E6HA 2RMOA 2K9GA 3EG1A 5IXFA 1Y0MA 2BTTA 5ECAA 2OI3A 2V1RA 2OAWA 2EQIA 4F14A 3QWXX 4OMOA 4LNPA 2KBTA 2OJ2A 3UA6A 1AD5A 2KRSA 1AWWA 1GBRA 1RLQC 2KNBB 2KT1A 2K7AA 2SEMA 1GL5A 1M3AA 4LUDA 1WDXA 2CT4A 1KIKA 2KEAA 2O9SA 2RNAA 2W0ZA 1SRLA 3EG0A 2CSIA 2LP5A 1H3HA 2K79A 4JZ3A 4JZ4A 2PNIA 1W70A 1H8KA 3M0TA 2AK5A 2KXCA 4D8DA 1OOTA 2ECZA 2J6FA 3ULRB 4E6RA 1RUWA 2AZVA 2GGRA 4AFQC 2ROLA 1B3QA 4JPBW 1WA7A 1X69A 4OMQA 1JO8A 3VS2A 2J7IA 1WFWA 1UUEA 2DE0X 2HDAA 2D8JA 1FMKA 4ORZA 2KGTA 1W6XA 2NUZA 2RN8A 4RTTA 2JMCA 4KRTA 3H0IA 1T0JA 2DL3A 2LJ3A 1G2BA 2P4RA 2A08A 2AZSA 2J6KA 1HJDA 1AEYA 1W1FA 2CREA 4DEXA 2JMAA 1NYFA 4R0KA 4J9GA 4OMLA 2MCNA 1SEMA 2DVJA 2VWFA 3NPFA 1K0XA 1N5ZA 1BBZA 1UHCA 1UG1A 2YT6A 2QDLA 1MV0B 2DLPA 2KRMA 3NGPA 1YWPA 1ZUUA 1B07A 4Z89A 2AKLA 4A63B 1WI7A 2YUPA 4J9CA
chains in the Genus database with same CATH superfamily
1T3SA 1M90C 1VQ4T 4PJLA 3OYKA 5LJ3f 3D7SB 4F7UE 3MP1A 2DTIA 1JJ2A 3RUXA 4M75G 3RDVA 2EGEA 2V26A 3ME9A 5EC7A 3L2ZA 3QZ9B 1VQ8T 2DEQA 3LLRA 4M77G 5IN1A 2CUBA 3A8MB 2RJDA 1YNZA 1QVFS 5I11A 1BYMA 2CP0A 2MAMA 1HXDA 4LXCA 2KY9A 4B9WA 3L2WA 3A5ZB 1VQKA 2JM9A 2YDLA 4E47A 2E70A 2PVOB 3EGUA 4KH1B 3N5BB 3PFSA 1UGRB 4EMGA 4QKUA 2ZGWA 3EHQA 1VYVA 4BDYA 1FXXA 4FYXB 2FZCB 3THKA 2LCCA 4OB2B 2XHCA 1VQLT 5GAMg 1D0XA 1MMAA 3EG9A 1IREB 5GAOq 1BI2A 1OV3A 2K5FA 5DM7R 2COYA 4FT2A 4HCBA 2K57A 2DD4A 1VQOT 3M0SA 2CH4A 4JUVA 4X34A 2E6NA 5GMKj 3A8LB 2YUQA 3VV0A 2A7YA 5FU6B 4M78F 4C8QB 2GTOA 4DEYA 4C92C 2HL3A 4BACA 3VYHB 2LQWA 1QQJA 3U23A 2K5IA 4MMLA 1WNLA 2DXBA 4AFSC 4C92A 3DLLA 2H3EB 5J3BA 3V8LA 1D0YA 3VS0A 3CEYA 4HCCA 4ELZC 1AOJA 5KYXB 4KT0E 2L0AA 1K4US 3M57A 2PUOB 4CC3A 1D0ZA 7AT1B 3SB2A 1PC0A 2RHIA 1TUCA 3S6WA 3CCLA 3OBYA 1FWZA 4XK8E 2QG9B 2X4XA 1O75A 3EGDA 1VQ9Q 1MUZA 1TWBA 1M90U 3I55T 2KDSA 2VKNA 2V8IA 3G4SQ 2QGFB 2FO0A 1XNIA 1W2BS 1GCQA 3OYIA 2XK0A 4M75A 4HT9A 2A28A 3OYLA 4C0ZA 4M77A 2HNIA 3C0CA 2E64A 2JTEA 3UF4A 2ABLA 3J7AF 3LW5E 2BZYA 1V29B 4BD3A 2LRQA 2XIDA 3OYCA 3CCUQ 2BKDN 3CC4T 8AT1B 5KCOA 4N4GA 2GTJA 3OMGA 1YJNQ 3I5RA 4JJDA 5FWCA 2CZ7B 6AT1B 1SHGA 2DTOA 1AZGB 1GFDA 2KRNA 1WX6A 3Q1JA 2K3YA 1I4K1 2EPDA 2FG0A 3RIRA 4C92B 2XKOC 1PCXA 1VYUA 2CP2A 4ZN1A 1BI1A 2DL8A 1ABOA 1ZLMA 1ZA2B 5GAN8 3UWNA 2JOYA 3BW1A 4LUEA 1RI9A 2LTOA 2R58A 4BE0A 4QQ6A 1AHJB 1WIEA 3H8ZA 2YRCA 2I2LA 3S3NA 4EMHA 4KULA 2KAFA 1IGQA 3LWHA 2J05A 4A4HA 3L1AA 2MK5A 2B8AA 4XTWA 4V2SA 3I5SA 4GLMA 1OZ2A 3J81E 1R77A 2DF6A 3VS3A 3FJ5A 3RMQA 4Z8AA 3EGDB 2XMFA 2ED0A 2M02A 2F2VA 2CH4W 1XTDA 3QYHB 3C95A 3CCMA 5GANg 2ENMA 3VS7A 4X9CA 3G6ET 2OTJA 1NJIR 2GFUA 1T3LA 1K0SA 1UB4A 4RCBA 4M77B 4XU0A 2DYBA 2HSPA 2JS0A 2QAZA 4F7UF 5I2SA 1RADB 2EYQA 2VC8A 1JJ2S 1QCFA 1GFCA 2DAQA 1OULA 3CD6A 3CC4A 4IKFA 2D8HA 1KHIA 5IAYA 4B6MA 5DY9A 3G7ZA 4IUUA 3M0UA 4AG2C 3HFNA 2R5AA 2X3XD 4J7FA 2XDPA 2QQ9A 1OU8A 3LWIA 3HSBA 2DIQA 4JRQA 2YWWA 2GF7A 3OBWA 2RJCA 4Z02A 2X4JA 3PIOA 1Q7YR 2QI2A 2A3LA 5CVIA 3JCMh 2RK2A 3MEAA 2M1HA 1QCOA 1G8XA 4R56A 4RTVA 1QVGA 4WCIA 2KT8A 3QYGB 2W10A 2CT3A 2EYWA 2MIOA 4PJOF 1G5VA 5LJ3d 3J80E 4RTZA 1BK2A 2EW3A 2LCLA 1OEBA 1YCSB 1YFNA 1KHCA 1RABB 2NWMA 2C0IA 3L2QA 4KUDK 1GBQA 3WVEB 2P0QA 1PRMC 1KQ1A 3FC3A 4J5YA 4P5NA 2VVKA 5C6SA 4GLKA 2F5TX 4GBQA 1YIJT 1E6HA 1ZSZC 3CMEQ 3EG1A 2XU8A 2OI3A 1VQ6T 3GOXA 2FVUA 1D1BA 1G3WA 3M4GA 1WHMA 5GANe 3CCJQ 1X01A 2K7AA 4JDSA 2FL7A 4DBFA 4E7JA 4LUDA 4KUIA 1SRLA 2P4TA 3QDFA 3GNGA 2QASA 1H3HA 4BE2A 3A8OB 3HTRA 4HA8A 4JZ3A 4XU3A 1KD1C 3H6ZA 1YJWQ 2DXUA 2J6FA 2RK1A 2YLCA 1RUWA 1UGQB 1GXIE 3FIFA 5LJ5h 3OS0A 4J83A 1K73C 4OMQA 2QEXT 2R5MA 1YJ9T 1UUEA 3G6EQ 2EFIA 1KC8C 1FMKA 4CI0C 1W6XA 2RN8A 4MDXA 5CCAA 3H0IA 1T0JA 3CCVQ 4J6XA 1YITT 1SG5A 2DL3A 5KYYA 3CC7A 2P4RA 4QVCA 2LDMA 3CC2T 1QW1A 3FJPA 1AEYA 4A4KA 4Y91A 1W2BP 2QQAA 3CCQT 4D6WA 1Q86C 4C8QE 1K9MR 1Y96B 4C5EA 4OMLA 2MCNA 4A4EA 1MGQA 1VQMA 2KQWA 1SEMA 3NPFA 5AYFA 4OP0A 1FX7A 1YBYA 4FIBA 1YIJA 2YXYA 1VQ5T 4DA4A 4EPCA 4PJNA 1S72Q 1ZUUA 3CBMA 4A63B 1VQ6A 4C0DB 4J9CA 2KSSA 3SDZA 3TEEA 1SHFA 4C0FA 3H9NA 2O9VA 1ZSZB 3INZA 4DQ2A 4GY5A 2FRYA 1PM3A 3V8KA 1KQSA 4M78G 4LDYA 4PL6A 3ZEHA 4KGZB 4L59A 4MZPA 1M1GA 2O31A 3M0RA 2IVWA 2M16A 3G71T 3JV3A 2MPXC 1VQPT 4ZTFA 3NFCA 1J3TA 2KROA 2YUNA 2BIVA 1A0NB 1YJ9A 4A54A 3CMAQ 2K2VA 1PKTA 3OB9A 3RKWA 2P84A 4JS4A 5GMKe 2JUFA 4JLIA 1KD1U 5HY6A 1WHKA 2RPNA 1BCMA 1PKSA 3CXCP 1YN8A 1C0MA 3JSCA 1TXQA 1F1BB 1UTIA 4EMKC 3OW2P 2I0NA 3P8HA 5CAIA 1K73U 3E19A 5IHNA 2ZZDA 1U5SA 1VQKT 5C0MA 1RAGB 4WTOB 1SKUB 3NTHA 4ELYC 1KC8U 1MV3A 4C92E 2DFUA 2RF0A 1WHJA 1VQ5A 5KCHA 1TUGB 2LCSA 1KD1R 1JJ2P 3LH5A 1PRLC 1M3BA 1ZQ1A 2DX1A 2H8HA 5GJVB 2QEXQ 3CCRA 2JNGA 3E9FA 4QQDA 3QWYA 3X25B 3LGLA 1K73R 1D09B 1OI1A 1Q86U 3VUBA 1K9AA 3PVLA 4PNOA 2BZ8A 4D8KA 5LJ5j 4OB1B 1B7TA 2OTLT 2G3RA 4WF2A 4J9BA 1I07A 1LVKA 3JB9D 3VJPA 4ZGJB 4BI8B 5LJ3h 1Z9ZA 1E6GA 3VS4A 1KC8R 1H92A 3CC2Q 2VV5A 2VUBA 2D1XA 4M7DF 1UHFA 3CCQQ 3G71A 3OW2A 4DBHA 1K8AR 1VQPA 4M75D 4ME7A 3MEUA 1M30A 1IXDA 5CQYA 1LNXA 2ZPBB 4M77D 4O6JA 1ZSGA 2BE9B 1Q86R 3QPHA 1B34A 2LX7A 2RHUA 3HHTB 4M77E 3V7RA 2PTKA 3CPFA 1BB9A 4M78A 3H41A 1Z9QA 2EYYA 4KGXB 2L3SA 3SEMA 5FLXE 2DILA 1WZOA 1H641 4OMPA 3EFOA 4J6YA 2JW4A 3OYFA 4E7HA 2M0OA 3REAB 4FYVB 1Q81C 1AZEA 3CCLT 3QKJA 4BI3A 2LMJA 2HMAA 2HAXA 2FZKB 4EMKB 2LQKA 5M9OA 3TVTA 4AMCA 2DRKA 4IIOA 5IXBA 1VIFA 4AG1C 4DBQA 1JU5C 2XDDA 4OGEA 2YUOA 1MHNA 5IHIA 3X26B 3QG1A 2KXDA 2PVDB 4BE1A 1U8RA 1VQNA 2CP5A 3AT1B 2OTLA 3RNJA 4J9FA 1LOJA 2J6OA 3EHRA 3OSVA 1KFZA 1YHQQ 1NJIC 1X2QA 3F70A 5GAOp 2FRWA 2AIRB 3P8DA 4C8QF 1FMWA 2JVVA 4AFUC 4LDXA 5GAN4 2K2MA 4J8OA 1VQKQ 2NUPA 1TOVA 1SF9A 2VGMA 1VQ9A 3I35A 3OYNA 1UGPB 1M8MA 1PNJA 1B34B 3CCEA 4PJOG 3PMTA 2EYXA 3G4SA 4UC4A 2E3HA 2EJGA 1QP2A 2FZGB 1Q82C 2DIGA 2GBQA 2JTFA 1YWOA 3EFOB 2KE9A 2LC4A 5GANd 1SRMA 1CKBA 4LD6A 1KQSS 3QO3A 1VQ7T 1CKAA 1QMCA 2GFAA 4OB0B 3G1JA 3RBBB 1Q7YC 2JZ2A 3CCSQ 3CCUA 2QTXA 1GCQC 1PSFA 1ZX6A 1OYXA 5GMKm 3PVQA 4RTWA 2RI3A 3EGXA 4M75C 5KH6A 4XAXB 3CPWA 3CCMT 2EJ9A 4M77C 5CIUA 5CR2A 2OTJT 1YJNA 3OSSC 2QXFA 3JCMP 1O9SA 2WACA 3EG9B 4MMKA 1M3CA 2MOXA 2KMTA 1VQ4Q 5GAN6 2O01E 3T9NA 1KSWA 3VU3C 3MO8A 4XQ3A 4OB3B 4HKEA 5GJWB 5KYUA 1NBEB 5GAMe 3L2VA 1VQ8Q 3RKYA 3R6NA 3CD6T 2EBPA 1U1SA 2V1QA 1PWTA 2L2PA 2ESWA 3OYYA 2D0QB 2WSCE 4HVVA 3UT1A 4X1VA 4FW2A 5CO7A 1FYNA 1QLYA 2YRDA 3PE0A 1Q81R 5GAOm 2XD0A 3QSUA 2L89A 1EZZB 4C92F 3JCMg 3PNWC 3CBPA 2X3WD 3X20B 3NHNA 1UEBA 4JJNK 3HP9A 1K76A 2DA9A 3O5ZA 5CKDA 5IXFA 1VQLQ 1Y0MA 1RAHB 2PUKB 1NJIU 3X28B 4C0GA 4F14A 5GAMf 2ZPEB 3QWXX 3EH1A 2KBTA 1AWWA 2HZYA 1VQ7A 2SEMA 3BDUA 1G3SA 3HRSA 4JRPA 2LT4A 4LDVA 2K3XA 1KIKA 2O9SA 2RNAA 1VQOQ 3EG0A 2PU9B 3JB9F 4ZTJA 4PLIA 3CXCS 5KYWA 2PNIA 1W70A 1WJSA 2AK5A 2H3JA 4E6RA 3ULRB 4PJOA 5LL6S 3OW2S 2V8JA 2YRVA 4JPBW 3GLXA 4M75B 1QVGP 2RHXA 4M77F 5J26A 4OMFB 2HDAA 4XTZA 1K9MC 5FRNA 3MEWA 4PKCC 2NUZA 2AHJB 1Q7YU 4X9DA 5KYUB 2Y4XA 1G2BA 3JCMQ 2A0FB 2QDYB 2RB6A 4PK4A 2AZSA 4MDWA 5LJ5g 1FMVA 1W1FA 1HK9A 1Q82R 1WHLA 2PQWA 2JMAA 1NYFA 3P8BB 2RHYA 1WGSA 1BI0A 1M2VA 4KH0B 4NOYA 4MZMA 5GAN5 3I55Q 2DD5A 2V8KA 2DVJA 2VWFA 5CK9A 4RMOA 4O5VA 1UHCA 1UG1A 3CCMQ 2YT6A 1OU9A 1MV0B 2DLPA 2OTJQ 1ZBXA 3NGPA 4AT1B 3A8HB 1B07A 2AKLA 1WI7A 2B86A 4JJCA 3JCMe 5A2QE 3CMEA 3CC7T 1I1JA 1Y7XA 4JS5A 3ZL7C 3FLGA 2K3BA 4C5IA 2RQWA 4A4FA 3CCJA 3CC4Q 1WYXA 4M7AG 2EIFA 1M1KC 5EG2A 2DM1A 2LZ6B 1VQMT 2COWA 2DMOA 3JCMb 3MPUB 3OYDA 3TSWA 4C0DC 1X2KA 4A53A 4Y28E 3JCMX 2FHDA 2RQVA 4FW1A 3JCMf 1AWXA 2RQTA 2A37A 1N9RA 2EQJA 2LJ0A 1TTHB 2RQRA 3V7CA 1N27A 4M7DG 3A1PA 1WXBA 2MYSA 4J9DA 2O4XA 1LCKA 1V1CA 4BI4A 2QK0A 1K1ZA 1W4SA 4OGCA 2CS7A 1R8OB 1KG1A 2CP3A 2EQUA 4ANJA 2FPDA 4NL3A 5CQXA 2L3RA 2RO0A 3OYMA 1ACMB 2BZXA 2DXCA 3RMSA 1K9MU 5I22A 5LJ5e 3HL8A 1JXOA 4LN2A 3GP8A 1N8RR 3KBGA 2HSEB 1KQSP 1LJOA 3MP6A 5GANf 1YCYA 4HVUA 3WVDB 2NUTA 1S72A 3RESA 2EWNA 2DK3A 3R6OA 4M4ZA 2ZPHB 1M5Q1 4N4IA 1K8AC 3ZFJA 1YI2T 2RJFA 4E7SA 3JB9J 3V7SA 3SWNA 4C5HA 2E5KA 3BE3A 2RM4A 3JRZA 4LD9K 4QVDA 1ABQA 2DL5A 4HXJA 2O2OA 3O8VA 2CP7A 1TG0A 5LJ5f 2L3QA 2E12A 2D0NA 2DZ9A 4M78D 1EX4A 1NEBA 4FYYB 1IRXA 3BDLA 2F5KA 4M78E 1NPPA 2JJ9A 3CCRT 2ZPGB 1WXTA 2ED1A 1ZUKA 1UE9A 1GCPA 3C94A 4C8QG 1RAFB 1NPRA 2GQIA 4M7AA 1N9SA 2EGCA 2WSEE 4J9IA 2OX7A 1M8VA 1PHTA 2O4XB 3CC7Q 3OS1A 2VGNA 3QUIA 3M0PA 2DJZA 2Y4YA 3H0FA 3OS2A 4EIKA 1V76A 1Y57A 3JCMV 3VS1A 3OS5A 3OYAA 1PD0A 4JLGA 3GPLA 1WQWA 3E1SA 1NEGA 2EKHA 4HCKA 2HCKA 5A0GA 1ZHIA 2QTVA 4F16A 1M1KR 2BE7D 2P0KA 4ZGDB 1YIJQ 5FRMA 4M7DA 3JCMJ 4E7KA 2K4YA 2JS2A 4ZGEB 2HL5C 1SSHA 4Y92A 1VQ6Q 1QWEA 4LE9A 1ARKA 1X43A 2E4HA 1WPYA 2NUTB 5L23A 1RI0A 2ROTA 3OMCA 1T0HA 2Z0WA 5KYYB 3LYIA 4Z88A 1YI2A 1BIBA 2DJQA 1TS9A 1X6GA 1I8FA 1BCOA 3I56A 2LVMA 2FPEA 5GAMd 3SWNB 3OY9A 2L8DA 2FEIA 2YLBA 3L2UA 2RD1A 1OZ3A 2F1LA 2X35A 2EYZA 1I5LA 4VUBA 3V8JA 3TCJA 2O88A 3PT9A 4QQGA 2F69A 3VS6A 3MCAB 4BUGA 1K8AU 2QA4A 1OX9A 1YJ9Q 2QQBA 1VQNT 2C0TA 1NZ9A 2EJFA 2MWPA 3GBQA 4XU1A 2ZPIB 3EH2A 1UJ0A 1QVGS 1IHVA 3KUFA 2CSQA 4M7AB 1YITQ 3VS5A 3UA7A 4PJJA 3H0HA 1NLPC 5HCKA 1X27A 1JBMA 3JAME 1OPLA 1PG5B 3IQLA 3UDCA 4C92G 3QJYA 2J06A 2YSQA 2HBWA 4DOWA 2IG0A 2E1HA 1TH7A 1XOVA 1QWFA 2EGAA 3OA6A 2DVEA 4M78C 3AHUA 4KBMB 4M75E 2CP6A 3PIPA 5FROA 5L8RE 1VQ9T 2LQ8A 2X9HA 4OVAA 5KE2A 1VQ5Q 4JJBA 3QZ5B 1S1NA 3CCET 2HBPA 4FL6A 3E9GA 1VUBA 1JXMA 2X4WA 3OYGA 3G4ST 3TREA 1VOMA 2CZ1B 3SHWA 3FRNA 1JRIA 4JRKA 3JCMc 1M27C 2DYIA 1AWJA 4FCYA 1TSFA 2KI7A 2DRMA 1NG2A 5IHKA 5D6YA 3UATA 4IUTA 1Y07A 4XTXA 5KYXA 3HPWA 3OYBA 2LT1A 3A8GB 3KFVA 3X24B 3CCUT 2RH2A 1UECA 3OQ5A 4RTUA 2JT4A 1YHQA 2KYMA 1CSKA 5A0DA 1E7OA 3DKMA 1IO6A 4F7UG 3G71Q 3HKSA 4HCZA 4PJMA 4LDUA 1YJNT 1VQPQ 2KVQG 2DL7A 3GIBA 2G6FX 1D3BA 2P0PA 3HFOA 1MNEA 1RAAB 2D9TA 3CBOA 2MWOA 3M53A 5HK3A 1NYGA 1ZUYA 3PGGA 2A36A 2RMOA 2BTTA 2BUDA 2X51A 5ECAA 1WHGA 1WJQA 2V1RA 4PFOA 3JCMd 4LNPA 3JB9I 3OYHA 1AD5A 2KRSA 1GBRA 2JN0A 3SD4A 3CPWP 1GL5A 1M3AA 4PFZA 4PJOD 2K5LA 5IT9E 2W0ZA 1Y71A 3VKIA 1AT1B 2CSIA 2LP5A 4PJOE 2K79A 4JZ4A 4E2FB 4RG2A 1OOTA 3CCSA 2GGRA 3UPUA 4AFQC 1B3QA 4RG8A 1WA7A 1MMDA 2E3IA 2E10A 4M78B 1JO8A 3VS2A 3DB3A 4MZTA 1WFWA 2EQKA 2D8JA 1MMGA 1VQNQ 3NTKA 5GAOr 2JMCA 2EQMA 1M1FA 1VQ4A 1X6OA 2OTLQ 1OQKA 2VASA 2L5QA 1SSFA 5GMKl 3QDRB 3M4YA 2DO3A 1VQ8A 1TU0B 5KE3A 2FYKA 4R0KA 3M59A 4J9GA 4PFPA 3RKXA 3GF5A 2VYTA 3RERA 1M9SA 5FU7C 1G3TA 1K0XA 1D3BB 5LJ3j 1BBZA 2AT1B 2QDLA 5LJ5d 3EFSA 2LX9A 1Q81U 2QYZA 5I2MA 1YWPA 1IGUA 3CCEQ 4Z89A 2YUPA 2ZAEA 3TU4K 2HQEA 3NMZC 1VQLA 3KXTA 2XI9A 4J9HA 2CDTA 3MHXA 1D1AA 3CCLQ 5KYNA 3EG3A 4FYWB 4F7UA 5GAMh 5DLOA 4J6WA 5GAOl 2DPPB 3RR6A 1Q95G 4K11A 2CYZB 2NUPB 3HRTA 1VQOA 2MF2A 4RTYA 1M90R 1PD1A 1VA7A 1QCNA 1WJRA 2LNHB 1OPKA 2DZCA 3REBB 1VYTA 3OYEA 5FW9A 1XQHA 2EVRA 2WSFE 3M58A 4FU6A 8ATCB 3S3MA 4CC7A 4A4GA 4ESRA 4CC4B 2M0YA 2X4YA 3TQ7P 3CMET 4J9EA 4YTLA 1HSQA 3LH0A 2QQRA 2M51A 2DKGA 2Y90A 1WHHA 2AKKA 3CCJT 4PJOC 1N8RC 2VXFA 1RACB 4IURA 1KQ2A 5GMKi 3EGXB 1LPLA 2E5QA 1U3OA 3QJ6A 2CGHA 4ZNXA 3PMIA 1YP5A 1U06A 3URGA 2EKOA 4NS5A 1Q82U 3WXMB 3SFMA 1YJWT 4M75F 2GQVA 4OMNA 4ZN3A 3I55A 1QVPA 4XU2A 5FU7B 1BU1A 1ZA1B 4F17A 3META 2DBMA 4BB7A 1NLOC 1DJ7B 2DETA 2HKQB 3BFMA 1QKXA 3A98A 1IB8A 1G83A 2RA2A 3CCVT 2LQNA 1VQ7Q 2KYBA 3VYGA 4F7UB 2DBKA 1AVZC 4L6V5 5HK0A 4HT8A 1NM7A 1G3YA 2M9UA 5D6WA 1JEGA 2F2WA 3LX7A 1UDLA 2HQHA 2DXTA 4M7AD 2IIMA 1HD3A 5GAOn 1PSEA 4E7IA 4LDWA 2CZ0B 1S72T 1I0CA 1R0BG 4M7AE 4Q5WA 1EIFA 2F2XA 1UGSB 1P92A 1D1CA 1AWOA 1QVFP 3CD6Q 4OMMA 4TVRA 2ZCFB 4RUGA 2RHZA 5KYWB 1X75C 2OAUA 3MP8A 4PJOB 3C12A 2XDBA 3FDRA 4M7DD 1YJWA 4DBRA 1ZBJA 1WQ7A 4M7DE 4CC2A 4II1A 2XG8D 2E6ZA 3I9QA 1Y96A 3PTAA 3L42A 3QIIA 4IUVA 5IH2A 4RTXA 4QT7A 5GAMj 1QKWA 2RI2A 1R0CB 5HKCA 3G6EA 3CMAT 1N8RU 2HD0A 1KJWA 2JM8A 1IZ6A 2HKNA 1SPKA 1UJYA 2RJEA 5GANh 2DL4A 3CCVA 4C5GA 3MEVA 1MNDA 2CZ6B 3FEOA 4B9XA 1GRIA 2JXBA 3M56A 1WLPB 3OYJA 1ZSZA 2COZA 2RI5A 2MI6A 2VXEA 3DB4A 1QVFA 2PZ1A 2GNCA 4JRIA 3EG2A 1M2VB 5AT1B 1JB0E 3CPWS 2QGGA 1BI3A 1UGVA 3ASKA 5CKHA 3VRZA 2RQUA 2C0OA 3JCMW 4NL2A 4E7ZA 1X6BA 3ER0A 4FSSA 4AFZC 1BKBA 2R57A 1EFNA 4E7LA 3SWNC 3EAEA 3QHSA 2EAYA 2CUDA 5FWBA 3M0QA 1WXUA 3NTIA 3I56T 1HYOA 1M2OA 4XTUA 4IUPA 2VB6A 2JTMA 2L3PA 4RKUE 2ZPFB 5I21A 3E2UA 2DERA 1TUDA 1RLPC 4BDZA 5CKBA 3LGFA 4KGVB 5CKEA 2SRCA 5GAN3 4QW2A 4C8QD 2KR3A 3BY7A 1RL2A 2HEQA 5DLQE 2QA4T 4IIMA 2FPFA 3QXEB 4M7AC 2LNVA 3VUZA 1U1TA 1KK7A 1VIEA 3CMAA 2LJ1A 5LJ3g 1IHWA 2MMPA 1M1KU 1C6VX 4BY6C 3TSZA 4RCCA 2DNUA 4FSXA 4EDUA 5CKFA 2QQSA 4ATOA 2NLUA 3C4SA 2E65A 4XTYA 4HVWA 1VQMQ 3EFRA 1C1AA 4M7DC 3QBYA 3VRYA 1JQQA 2IPOB 2K6DA 4N0AC 1I5OB 3L2RA 2YHTA 2XICA 3CQTA 3M55A 3GNFB 3M9QA 1W2BA 9ATCB 1UFFA 4FT4A 4N0AA 4F04B 2K9GA 2QEXA 5GMKh 3ZBDA 4XTVA 2OAWA 4L5GA 2EQIA 4J7IA 3M5AA 1OX8A 4OMOA 2OJ2A 5D6XA 3UA6A 5A0LA 1RLQC 2KNBB 2KT1A 1YITA 1M4ZA 1WDXA 2CT4A 2KEAA 4QVZA 1YHQT 3CC2A 1BIAA 2PVGB 3CCQA 1H8KA 3DLMA 3M0TA 4FM4B 2CKKA 2D6FA 3JB9H 2KXCA 4D8DA 2DTHA 2ECZA 4PLLA 3S3OA 2AZVA 5GANj 2DEUA 2ROLA 4C92D 4EMKA 2E41A 1X69A 5GAN7 3FB9A 2J7IA 3MKDA 4CRIA 4IUQA 3HRUA 2DE0X 4M7AF 5J39A 4ORZA 2KGTA 4N4HA 1MMNA 2GCXA 1RAEB 4RTTA 4KRTA 1RAIB 4BY6B 1YI2Q 5D7UA 3M54A 2FB7A 2LJ3A 1NE8A 1XJWB 5LJ3e 1H3ZA 2A08A 3I56Q 1N6AA 2J6KA 3MJXA 1HJDA 2CREA 5FU6C 4DEXA 2NYSA 4C8QC 5GAN2 1I81A 3CCST 4DOVA 3CXCA 2HQXA 4R55A 4C8QA 4M7DB 1N5ZA 1QP3A 3CCRQ 2KK4A 2KRMA 2QA4Q 3JB9G 2C06A 4OF1A 2ATCB
chains in the Genus database with same CATH topology
2B86A 1T3SA 4JJCA 1SHFA 3NMZC 2O9VA 1I1JA 2FRYA 4J9HA 2CDTA 2EGEA 3ZL7C 2K3BA 5EC7A 3EG3A 2RQWA 2CUBA 1WYXA 1YNZA 5I11A 4K11A 2DM1A 2LZ6B 4RTYA 1VA7A 2DMOA 2O31A 3M0RA 3TSWA 2JM9A 2LNHB 3JV3A 1X2KA 2YDLA 1OPKA 3REBB 1VYTA 3EGUA 1J3TA 5FW9A 2KROA 2RQVA 2YUNA 1A0NB 2EVRA 3EHQA 1VYVA 1PKTA 4CC7A 3THKA 4ESRA 4CC4B 1AWXA 2M0YA 2RQTA 2A37A 4J9EA 2LJ0A 2RQRA 1HSQA 2M51A 2RPNA 1OV3A 1WXBA 1PKSA 4J9DA 1LCKA 1V1CA 2AKKA 1YN8A 1UTIA 1K1ZA 2I0NA 3M0SA 2CH4A 5IHNA 1U3OA 1U5SA 4ZNXA 2FPDA 1YP5A 1U06A 2YUQA 2BZXA 2GTOA 4DEYA 1MV3A 5I22A 2LQWA 2RF0A 1JXOA 4LN2A 3U23A 4OMNA 2LCSA 3LH5A 1BU1A 1PRLC 1M3BA 4AFSC 4F17A 2DX1A 2H8HA 5GJVB 2DBMA 1NLOC 4HVUA 3QWYA 1QKXA 3A98A 3VS0A 1G83A 4M4ZA 1AOJA 1K9AA 3PVLA 2BZ8A 4D8KA 2L0AA 1K4US 2LQNA 2KYBA 4J9BA 1I07A 4CC3A 2DBKA 1AVZC 2E5KA 3VS4A 1Z9ZA 1E6GA 1NM7A 1H92A 1TUCA 1JEGA 2F2WA 2D1XA 1ABQA 1UHFA 2DL5A 4HXJA 1UDLA 2O2OA 1TG0A 2L3QA 2D0NA 1MUZA 1M30A 1NEBA 1ZSGA 2VKNA 2FO0A 2IIMA 1HD3A 2LX7A 1GCQA 1WXTA 2PTKA 1I0CA 1BB9A 2ED1A 1ZUKA 3H41A 2A28A 1Z9QA 2EYYA 2L3SA 3SEMA 2DILA 1UE9A 1GCPA 2F2XA 2GQIA 1AWOA 2EGCA 4OMPA 4J9IA 2JW4A 3C0CA 2JTEA 3UF4A 1PHTA 2ABLA 4OMMA 3REAB 2BZYA 4RUGA 3M0PA 1AZEA 2LMJA 3H0FA 4EIKA 1Y57A 3VS1A 2GTJA 3TVTA 3I5RA 4JJDA 2DRKA 1NEGA 4IIOA 1ZBJA 2EKHA 5FWCA 4HCKA 2HCKA 4CC2A 1SHGA 5IXBA 1AZGB 3I9QA 1GFDA 4AG1C 2KRNA 1WX6A 4F16A 1JU5C 2EPDA 2FG0A 4RTXA 2YUOA 4QT7A 5IH2A 5IHIA 1VYUA 1QKWA 2JS2A 1SSHA 4Y92A 1QWEA 1KJWA 2DL8A 2JM8A 1ABOA 1ZLMA 4LE9A 1ARKA 1X43A 5L23A 2KXDA 2ROTA 1T0HA 4LUEA 1RI9A 1SPKA 1UJYA 2DL4A 4Z88A 1WIEA 2DJQA 3RNJA 1X6GA 1GRIA 2JXBA 1WLPB 4J9FA 2J6OA 3EHRA 2FPEA 1KFZA 2J05A 2FEIA 1X2QA 2PZ1A 2GNCA 3I5SA 3EG2A 2FRWA 4GLMA 2DF6A 3VS3A 3FJ5A 2EYZA 4AFUC 1UGVA 3VRZA 4Z8AA 2K2MA 2RQUA 2XMFA 2O88A 2ED0A 2C0OA 2F2VA 2CH4W 1X6BA 3VS6A 4FSSA 4AFZC 2ENMA 3I35A 3VS7A 1M8MA 1PNJA 1T3LA 1EFNA 2C0TA 2EYXA 3GBQA 1K0SA 1UJ0A 2CUDA 2GBQA 2CSQA 5FWBA 2DYBA 2HSPA 1YWOA 2JS0A 3UA7A 3VS5A 3M0QA 1WXUA 3H0HA 1NLPC 5HCKA 2KE9A 1X27A 1OPLA 2L3PA 1SRMA 3IQLA 1CKBA 1QCFA 2J06A 1GFCA 1CKAA 1TUDA 1RLPC 3RBBB 2YSQA 2HBWA 2D8HA 2SRCA 1GCQC 1ZX6A 3M0UA 4AG2C 1XOVA 2KR3A 3PVQA 4RTWA 1QWFA 2X3XD 2EGAA 2HEQA 4IIMA 2FPFA 4JJBA 1S1NA 1JXMA 2LJ1A 1M3CA 2MOXA 3SHWA 3TSZA 2DNUA 1M27C 1KSWA 1AWJA 4RTVA 5GJWB 4WCIA 2KT8A 2DRMA 1NG2A 2W10A 3R6NA 5IHKA 3UATA 2CT3A 2EYWA 2MIOA 2EBPA 2V1QA 1PWTA 3KFVA 4RTZA 2L2PA 2ESWA 1BK2A 2EW3A 1UECA 4HVVA 1OEBA 4X1VA 1YCSB 4RTUA 4HVWA 2JT4A 2KYMA 1CSKA 1FYNA 1E7OA 1QLYA 2NWMA 2C0IA 3VRYA 3PE0A 1IO6A 1JQQA 1GBQA 2K6DA 1PRMC 2DL7A 3CQTA 2G6FX 2VVKA 2X3WD 4GBQA 1UFFA 3NHNA 1NYGA 1K76A 1ZUYA 2DA9A 3O5ZA 2A36A 1E6HA 2RMOA 2K9GA 3EG1A 5IXFA 1Y0MA 2BTTA 5ECAA 2OI3A 2V1RA 2OAWA 2EQIA 4F14A 3QWXX 4OMOA 4LNPA 2KBTA 2OJ2A 3UA6A 1AD5A 2KRSA 1AWWA 1GBRA 1RLQC 2KNBB 2KT1A 2K7AA 2SEMA 1GL5A 1M3AA 4LUDA 1WDXA 2CT4A 1KIKA 2KEAA 2O9SA 2RNAA 2W0ZA 1SRLA 3EG0A 2CSIA 2LP5A 1H3HA 2K79A 4JZ3A 4JZ4A 2PNIA 1W70A 1H8KA 3M0TA 2AK5A 2KXCA 4D8DA 1OOTA 2ECZA 2J6FA 3ULRB 4E6RA 1RUWA 2AZVA 2GGRA 4AFQC 2ROLA 1B3QA 4JPBW 1WA7A 1X69A 4OMQA 1JO8A 3VS2A 2J7IA 1WFWA 1UUEA 2DE0X 2HDAA 2D8JA 1FMKA 4ORZA 2KGTA 1W6XA 2NUZA 2RN8A 4RTTA 2JMCA 4KRTA 3H0IA 1T0JA 2DL3A 2LJ3A 1G2BA 2P4RA 2A08A 2AZSA 2J6KA 1HJDA 1AEYA 1W1FA 2CREA 4DEXA 2JMAA 1NYFA 4R0KA 4J9GA 4OMLA 2MCNA 1SEMA 2DVJA 2VWFA 3NPFA 1K0XA 1N5ZA 1BBZA 1UHCA 1UG1A 2YT6A 2QDLA 1MV0B 2DLPA 2KRMA 3NGPA 1YWPA 1ZUUA 1B07A 4Z89A 2AKLA 4A63B 1WI7A 2YUPA 4J9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B86 A;  1T3S A;  4JJC A;  1SHF A;  3NMZ C;  2O9V A;  1I1J A;  2FRY A;  4J9H A;  2CDT A;  2EGE A;  3ZL7 C;  2K3B A;  5EC7 A;  3EG3 A;  2RQW A;  2CUB A;  1WYX A;  1YNZ A;  5I11 A;  4K11 A;  2DM1 A;  2LZ6 B;  4RTY A;  1VA7 A;  2DMO A;  2O31 A;  3M0R A;  3TSW A;  2JM9 A;  2LNH B;  3JV3 A;  1X2K A;  2YDL A;  1OPK A;  3REB B;  1VYT A;  3EGU A;  1J3T A;  5FW9 A;  2KRO A;  2RQV A;  2YUN A;  1A0N B;  2EVR A;  3EHQ A;  1VYV A;  1PKT A;  4CC7 A;  3THK A;  4ESR A;  4CC4 B;  1AWX A;  2M0Y A;  2RQT A;  2A37 A;  4J9E A;  2LJ0 A;  2RQR A;  1HSQ A;  2M51 A;  2RPN A;  1OV3 A;  1WXB A;  1PKS A;  4J9D A;  1LCK A;  1V1C A;  2AKK A;  1YN8 A;  1UTI A;  1K1Z A;  2I0N A;  3M0S A;  2CH4 A;  5IHN A;  1U3O A;  1U5S A;  4ZNX A;  2FPD A;  1YP5 A;  1U06 A;  2YUQ A;  2BZX A;  2GTO A;  4DEY A;  1MV3 A;  5I22 A;  2LQW A;  2RF0 A;  1JXO A;  4LN2 A;  3U23 A;  4OMN A;  2LCS A;  3LH5 A;  1BU1 A;  1PRL C;  1M3B A;  4AFS C;  4F17 A;  2DX1 A;  2H8H A;  5GJV B;  2DBM A;  1NLO C;  4HVU A;  3QWY A;  1QKX A;  3A98 A;  3VS0 A;  1G83 A;  4M4Z A;  1AOJ A;  1K9A A;  3PVL A;  2BZ8 A;  4D8K A;  2L0A A;  1K4U S;  2LQN A;  2KYB A;  4J9B A;  1I07 A;  4CC3 A;  2DBK A;  1AVZ C;  2E5K A;  3VS4 A;  1Z9Z A;  1E6G A;  1NM7 A;  1H92 A;  1TUC A;  1JEG A;  2F2W A;  2D1X A;  1ABQ A;  1UHF A;  2DL5 A;  4HXJ A;  1UDL A;  2O2O A;  1TG0 A;  2L3Q A;  2D0N A;  1MUZ A;  1M30 A;  1NEB A;  1ZSG A;  2VKN A;  2FO0 A;  2IIM A;  1HD3 A;  2LX7 A;  1GCQ A;  1WXT A;  2PTK A;  1I0C A;  1BB9 A;  2ED1 A;  1ZUK A;  3H41 A;  2A28 A;  1Z9Q A;  2EYY A;  2L3S A;  3SEM A;  2DIL A;  1UE9 A;  1GCP A;  2F2X A;  2GQI A;  1AWO A;  2EGC A;  4OMP A;  4J9I A;  2JW4 A;  3C0C A;  2JTE A;  3UF4 A;  1PHT A;  2ABL A;  4OMM A;  3REA B;  2BZY A;  4RUG A;  3M0P A;  1AZE A;  2LMJ A;  3H0F A;  4EIK A;  1Y57 A;  3VS1 A;  2GTJ A;  3TVT A;  3I5R A;  4JJD A;  2DRK A;  1NEG A;  4IIO A;  1ZBJ A;  2EKH A;  5FWC A;  4HCK A;  2HCK A;  4CC2 A;  1SHG A;  5IXB A;  1AZG B;  3I9Q A;  1GFD A;  4AG1 C;  2KRN A;  1WX6 A;  4F16 A;  1JU5 C;  2EPD A;  2FG0 A;  4RTX A;  2YUO A;  4QT7 A;  5IH2 A;  5IHI A;  1VYU A;  1QKW A;  2JS2 A;  1SSH A;  4Y92 A;  1QWE A;  1KJW A;  2DL8 A;  2JM8 A;  1ABO A;  1ZLM A;  4LE9 A;  1ARK A;  1X43 A;  5L23 A;  2KXD A;  2ROT A;  1T0H A;  4LUE A;  1RI9 A;  1SPK A;  1UJY A;  2DL4 A;  4Z88 A;  1WIE A;  2DJQ A;  3RNJ A;  1X6G A;  1GRI A;  2JXB A;  1WLP B;  4J9F A;  2J6O A;  3EHR A;  2FPE A;  1KFZ A;  2J05 A;  2FEI A;  1X2Q A;  2PZ1 A;  2GNC A;  3I5S A;  3EG2 A;  2FRW A;  4GLM A;  2DF6 A;  3VS3 A;  3FJ5 A;  2EYZ A;  4AFU C;  1UGV A;  3VRZ A;  4Z8A A;  2K2M A;  2RQU A;  2XMF A;  2O88 A;  2ED0 A;  2C0O A;  2F2V A;  2CH4 W;  1X6B A;  3VS6 A;  4FSS A;  4AFZ C;  2ENM A;  3I35 A;  3VS7 A;  1M8M A;  1PNJ A;  1T3L A;  1EFN A;  2C0T A;  2EYX A;  3GBQ A;  1K0S A;  1UJ0 A;  2CUD A;  2GBQ A;  2CSQ A;  5FWB A;  2DYB A;  2HSP A;  1YWO A;  2JS0 A;  3UA7 A;  3VS5 A;  3M0Q A;  1WXU A;  3H0H A;  1NLP C;  5HCK A;  2KE9 A;  1X27 A;  1OPL A;  2L3P A;  1SRM A;  3IQL A;  1CKB A;  1QCF A;  2J06 A;  1GFC A;  1CKA A;  1TUD A;  1RLP C;  3RBB B;  2YSQ A;  2HBW A;  2D8H A;  2SRC A;  1GCQ C;  1ZX6 A;  3M0U A;  4AG2 C;  1XOV A;  2KR3 A;  3PVQ A;  4RTW A;  1QWF A;  2X3X D;  2EGA A;  2HEQ A;  4IIM A;  2FPF A;  4JJB A;  1S1N A;  1JXM A;  2LJ1 A;  1M3C A;  2MOX A;  3SHW A;  3TSZ A;  2DNU A;  1M27 C;  1KSW A;  1AWJ A;  4RTV A;  5GJW B;  4WCI A;  2KT8 A;  2DRM A;  1NG2 A;  2W10 A;  3R6N A;  5IHK A;  3UAT A;  2CT3 A;  2EYW A;  2MIO A;  2EBP A;  2V1Q A;  1PWT A;  3KFV A;  4RTZ A;  2L2P A;  2ESW A;  1BK2 A;  2EW3 A;  1UEC A;  4HVV A;  1OEB A;  4X1V A;  1YCS B;  4RTU A;  4HVW A;  2JT4 A;  2KYM A;  1CSK A;  1FYN A;  1E7O A;  1QLY A;  2NWM A;  2C0I A;  3VRY A;  3PE0 A;  1IO6 A;  1JQQ A;  1GBQ A;  2K6D A;  1PRM C;  2DL7 A;  3CQT A;  2G6F X;  2VVK A;  2X3W D;  4GBQ A;  1UFF A;  3NHN A;  1NYG A;  1K76 A;  1ZUY A;  2DA9 A;  3O5Z A;  2A36 A;  1E6H A;  2RMO A;  2K9G A;  3EG1 A;  5IXF A;  1Y0M A;  2BTT A;  5ECA A;  2OI3 A;  2V1R A;  2OAW A;  2EQI A;  4F14 A;  3QWX X;  4OMO A;  4LNP A;  2KBT A;  2OJ2 A;  3UA6 A;  1AD5 A;  2KRS A;  1AWW A;  1GBR A;  1RLQ C;  2KNB B;  2KT1 A;  2K7A A;  2SEM A;  1GL5 A;  1M3A A;  4LUD A;  1WDX A;  2CT4 A;  1KIK A;  2KEA A;  2O9S A;  2RNA A;  2W0Z A;  1SRL A;  3EG0 A;  2CSI A;  2LP5 A;  1H3H A;  2K79 A;  4JZ3 A;  4JZ4 A;  2PNI A;  1W70 A;  1H8K A;  3M0T A;  2AK5 A;  2KXC A;  4D8D A;  1OOT A;  2ECZ A;  2J6F A;  3ULR B;  4E6R A;  1RUW A;  2AZV A;  2GGR A;  4AFQ C;  2ROL A;  1B3Q A;  4JPB W;  1WA7 A;  1X69 A;  4OMQ A;  1JO8 A;  3VS2 A;  2J7I A;  1WFW A;  1UUE A;  2DE0 X;  2HDA A;  2D8J A;  1FMK A;  4ORZ A;  2KGT A;  1W6X A;  2NUZ A;  2RN8 A;  4RTT A;  2JMC A;  4KRT A;  3H0I A;  1T0J A;  2DL3 A;  2LJ3 A;  1G2B A;  2P4R A;  2A08 A;  2AZS A;  2J6K A;  1HJD A;  1AEY A;  1W1F A;  2CRE A;  4DEX A;  2JMA A;  1NYF A;  4R0K A;  4J9G A;  4OML A;  2MCN A;  1SEM A;  2DVJ A;  2VWF A;  3NPF A;  1K0X A;  1N5Z A;  1BBZ A;  1UHC A;  1UG1 A;  2YT6 A;  2QDL A;  1MV0 B;  2DLP A;  2KRM A;  3NGP A;  1YWP A;  1ZUU A;  1B07 A;  4Z89 A;  2AKL A;  4A63 B;  1WI7 A;  2YUP A;  4J9C A; 
#chains in the Genus database with same CATH topology
 1T3S A;  1M90 C;  1VQ4 T;  4PJL A;  3OYK A;  5LJ3 f;  3D7S B;  4F7U E;  3MP1 A;  2DTI A;  1JJ2 A;  3RUX A;  4M75 G;  3RDV A;  2EGE A;  2V26 A;  3ME9 A;  5EC7 A;  3L2Z A;  3QZ9 B;  1VQ8 T;  2DEQ A;  3LLR A;  4M77 G;  5IN1 A;  2CUB A;  3A8M B;  2RJD A;  1YNZ A;  1QVF S;  5I11 A;  1BYM A;  2CP0 A;  2MAM A;  1HXD A;  4LXC A;  2KY9 A;  4B9W A;  3L2W A;  3A5Z B;  1VQK A;  2JM9 A;  2YDL A;  4E47 A;  2E70 A;  2PVO B;  3EGU A;  4KH1 B;  3N5B B;  3PFS A;  1UGR B;  4EMG A;  4QKU A;  2ZGW A;  3EHQ A;  1VYV A;  4BDY A;  1FXX A;  4FYX B;  2FZC B;  3THK A;  2LCC A;  4OB2 B;  2XHC A;  1VQL T;  5GAM g;  1D0X A;  1MMA A;  3EG9 A;  1IRE B;  5GAO q;  1BI2 A;  1OV3 A;  2K5F A;  5DM7 R;  2COY A;  4FT2 A;  4HCB A;  2K57 A;  2DD4 A;  1VQO T;  3M0S A;  2CH4 A;  4JUV A;  4X34 A;  2E6N A;  5GMK j;  3A8L B;  2YUQ A;  3VV0 A;  2A7Y A;  5FU6 B;  4M78 F;  4C8Q B;  2GTO A;  4DEY A;  4C92 C;  2HL3 A;  4BAC A;  3VYH B;  2LQW A;  1QQJ A;  3U23 A;  2K5I A;  4MML A;  1WNL A;  2DXB A;  4AFS C;  4C92 A;  3DLL A;  2H3E B;  5J3B A;  3V8L A;  1D0Y A;  3VS0 A;  3CEY A;  4HCC A;  4ELZ C;  1AOJ A;  5KYX B;  4KT0 E;  2L0A A;  1K4U S;  3M57 A;  2PUO B;  4CC3 A;  1D0Z A;  7AT1 B;  3SB2 A;  1PC0 A;  2RHI A;  1TUC A;  3S6W A;  3CCL A;  3OBY A;  1FWZ A;  4XK8 E;  2QG9 B;  2X4X A;  1O75 A;  3EGD A;  1VQ9 Q;  1MUZ A;  1TWB A;  1M90 U;  3I55 T;  2KDS A;  2VKN A;  2V8I A;  3G4S Q;  2QGF B;  2FO0 A;  1XNI A;  1W2B S;  1GCQ A;  3OYI A;  2XK0 A;  4M75 A;  4HT9 A;  2A28 A;  3OYL A;  4C0Z A;  4M77 A;  2HNI A;  3C0C A;  2E64 A;  2JTE A;  3UF4 A;  2ABL A;  3J7A F;  3LW5 E;  2BZY A;  1V29 B;  4BD3 A;  2LRQ A;  2XID A;  3OYC A;  3CCU Q;  2BKD N;  3CC4 T;  8AT1 B;  5KCO A;  4N4G A;  2GTJ A;  3OMG A;  1YJN Q;  3I5R A;  4JJD A;  5FWC A;  2CZ7 B;  6AT1 B;  1SHG A;  2DTO A;  1AZG B;  1GFD A;  2KRN A;  1WX6 A;  3Q1J A;  2K3Y A;  1I4K 1;  2EPD A;  2FG0 A;  3RIR A;  4C92 B;  2XKO C;  1PCX A;  1VYU A;  2CP2 A;  4ZN1 A;  1BI1 A;  2DL8 A;  1ABO A;  1ZLM A;  1ZA2 B;  5GAN 8;  3UWN A;  2JOY A;  3BW1 A;  4LUE A;  1RI9 A;  2LTO A;  2R58 A;  4BE0 A;  4QQ6 A;  1AHJ B;  1WIE A;  3H8Z A;  2YRC A;  2I2L A;  3S3N A;  4EMH A;  4KUL A;  2KAF A;  1IGQ A;  3LWH A;  2J05 A;  4A4H A;  3L1A A;  2MK5 A;  2B8A A;  4XTW A;  4V2S A;  3I5S A;  4GLM A;  1OZ2 A;  3J81 E;  1R77 A;  2DF6 A;  3VS3 A;  3FJ5 A;  3RMQ A;  4Z8A A;  3EGD B;  2XMF A;  2ED0 A;  2M02 A;  2F2V A;  2CH4 W;  1XTD A;  3QYH B;  3C95 A;  3CCM A;  5GAN g;  2ENM A;  3VS7 A;  4X9C A;  3G6E T;  2OTJ A;  1NJI R;  2GFU A;  1T3L A;  1K0S A;  1UB4 A;  4RCB A;  4M77 B;  4XU0 A;  2DYB A;  2HSP A;  2JS0 A;  2QAZ A;  4F7U F;  5I2S A;  1RAD B;  2EYQ A;  2VC8 A;  1JJ2 S;  1QCF A;  1GFC A;  2DAQ A;  1OUL A;  3CD6 A;  3CC4 A;  4IKF A;  2D8H A;  1KHI A;  5IAY A;  4B6M A;  5DY9 A;  3G7Z A;  4IUU A;  3M0U A;  4AG2 C;  3HFN A;  2R5A A;  2X3X D;  4J7F A;  2XDP A;  2QQ9 A;  1OU8 A;  3LWI A;  3HSB A;  2DIQ A;  4JRQ A;  2YWW A;  2GF7 A;  3OBW A;  2RJC A;  4Z02 A;  2X4J A;  3PIO A;  1Q7Y R;  2QI2 A;  2A3L A;  5CVI A;  3JCM h;  2RK2 A;  3MEA A;  2M1H A;  1QCO A;  1G8X A;  4R56 A;  4RTV A;  1QVG A;  4WCI A;  2KT8 A;  3QYG B;  2W10 A;  2CT3 A;  2EYW A;  2MIO A;  4PJO F;  1G5V A;  5LJ3 d;  3J80 E;  4RTZ A;  1BK2 A;  2EW3 A;  2LCL A;  1OEB A;  1YCS B;  1YFN A;  1KHC A;  1RAB B;  2NWM A;  2C0I A;  3L2Q A;  4KUD K;  1GBQ A;  3WVE B;  2P0Q A;  1PRM C;  1KQ1 A;  3FC3 A;  4J5Y A;  4P5N A;  2VVK A;  5C6S A;  4GLK A;  2F5T X;  4GBQ A;  1YIJ T;  1E6H A;  1ZSZ C;  3CME Q;  3EG1 A;  2XU8 A;  2OI3 A;  1VQ6 T;  3GOX A;  2FVU A;  1D1B A;  1G3W A;  3M4G A;  1WHM A;  5GAN e;  3CCJ Q;  1X01 A;  2K7A A;  4JDS A;  2FL7 A;  4DBF A;  4E7J A;  4LUD A;  4KUI A;  1SRL A;  2P4T A;  3QDF A;  3GNG A;  2QAS A;  1H3H A;  4BE2 A;  3A8O B;  3HTR A;  4HA8 A;  4JZ3 A;  4XU3 A;  1KD1 C;  3H6Z A;  1YJW Q;  2DXU A;  2J6F A;  2RK1 A;  2YLC A;  1RUW A;  1UGQ B;  1GXI E;  3FIF A;  5LJ5 h;  3OS0 A;  4J83 A;  1K73 C;  4OMQ A;  2QEX T;  2R5M A;  1YJ9 T;  1UUE A;  3G6E Q;  2EFI A;  1KC8 C;  1FMK A;  4CI0 C;  1W6X A;  2RN8 A;  4MDX A;  5CCA A;  3H0I A;  1T0J A;  3CCV Q;  4J6X A;  1YIT T;  1SG5 A;  2DL3 A;  5KYY A;  3CC7 A;  2P4R A;  4QVC A;  2LDM A;  3CC2 T;  1QW1 A;  3FJP A;  1AEY A;  4A4K A;  4Y91 A;  1W2B P;  2QQA A;  3CCQ T;  4D6W A;  1Q86 C;  4C8Q E;  1K9M R;  1Y96 B;  4C5E A;  4OML A;  2MCN A;  4A4E A;  1MGQ A;  1VQM A;  2KQW A;  1SEM A;  3NPF A;  5AYF A;  4OP0 A;  1FX7 A;  1YBY A;  4FIB A;  1YIJ A;  2YXY A;  1VQ5 T;  4DA4 A;  4EPC A;  4PJN A;  1S72 Q;  1ZUU A;  3CBM A;  4A63 B;  1VQ6 A;  4C0D B;  4J9C A;  2KSS A;  3SDZ A;  3TEE A;  1SHF A;  4C0F A;  3H9N A;  2O9V A;  1ZSZ B;  3INZ A;  4DQ2 A;  4GY5 A;  2FRY A;  1PM3 A;  3V8K A;  1KQS A;  4M78 G;  4LDY A;  4PL6 A;  3ZEH A;  4KGZ B;  4L59 A;  4MZP A;  1M1G A;  2O31 A;  3M0R A;  2IVW A;  2M16 A;  3G71 T;  3JV3 A;  2MPX C;  1VQP T;  4ZTF A;  3NFC A;  1J3T A;  2KRO A;  2YUN A;  2BIV A;  1A0N B;  1YJ9 A;  4A54 A;  3CMA Q;  2K2V A;  1PKT A;  3OB9 A;  3RKW A;  2P84 A;  4JS4 A;  5GMK e;  2JUF A;  4JLI A;  1KD1 U;  5HY6 A;  1WHK A;  2RPN A;  1BCM A;  1PKS A;  3CXC P;  1YN8 A;  1C0M A;  3JSC A;  1TXQ A;  1F1B B;  1UTI A;  4EMK C;  3OW2 P;  2I0N A;  3P8H A;  5CAI A;  1K73 U;  3E19 A;  5IHN A;  2ZZD A;  1U5S A;  1VQK T;  5C0M A;  1RAG B;  4WTO B;  1SKU B;  3NTH A;  4ELY C;  1KC8 U;  1MV3 A;  4C92 E;  2DFU A;  2RF0 A;  1WHJ A;  1VQ5 A;  5KCH A;  1TUG B;  2LCS A;  1KD1 R;  1JJ2 P;  3LH5 A;  1PRL C;  1M3B A;  1ZQ1 A;  2DX1 A;  2H8H A;  5GJV B;  2QEX Q;  3CCR A;  2JNG A;  3E9F A;  4QQD A;  3QWY A;  3X25 B;  3LGL A;  1K73 R;  1D09 B;  1OI1 A;  1Q86 U;  3VUB A;  1K9A A;  3PVL A;  4PNO A;  2BZ8 A;  4D8K A;  5LJ5 j;  4OB1 B;  1B7T A;  2OTL T;  2G3R A;  4WF2 A;  4J9B A;  1I07 A;  1LVK A;  3JB9 D;  3VJP A;  4ZGJ B;  4BI8 B;  5LJ3 h;  1Z9Z A;  1E6G A;  3VS4 A;  1KC8 R;  1H92 A;  3CC2 Q;  2VV5 A;  2VUB A;  2D1X A;  4M7D F;  1UHF A;  3CCQ Q;  3G71 A;  3OW2 A;  4DBH A;  1K8A R;  1VQP A;  4M75 D;  4ME7 A;  3MEU A;  1M30 A;  1IXD A;  5CQY A;  1LNX A;  2ZPB B;  4M77 D;  4O6J A;  1ZSG A;  2BE9 B;  1Q86 R;  3QPH A;  1B34 A;  2LX7 A;  2RHU A;  3HHT B;  4M77 E;  3V7R A;  2PTK A;  3CPF A;  1BB9 A;  4M78 A;  3H41 A;  1Z9Q A;  2EYY A;  4KGX B;  2L3S A;  3SEM A;  5FLX E;  2DIL A;  1WZO A;  1H64 1;  4OMP A;  3EFO A;  4J6Y A;  2JW4 A;  3OYF A;  4E7H A;  2M0O A;  3REA B;  4FYV B;  1Q81 C;  1AZE A;  3CCL T;  3QKJ A;  4BI3 A;  2LMJ A;  2HMA A;  2HAX A;  2FZK B;  4EMK B;  2LQK A;  5M9O A;  3TVT A;  4AMC A;  2DRK A;  4IIO A;  5IXB A;  1VIF A;  4AG1 C;  4DBQ A;  1JU5 C;  2XDD A;  4OGE A;  2YUO A;  1MHN A;  5IHI A;  3X26 B;  3QG1 A;  2KXD A;  2PVD B;  4BE1 A;  1U8R A;  1VQN A;  2CP5 A;  3AT1 B;  2OTL A;  3RNJ A;  4J9F A;  1LOJ A;  2J6O A;  3EHR A;  3OSV A;  1KFZ A;  1YHQ Q;  1NJI C;  1X2Q A;  3F70 A;  5GAO p;  2FRW A;  2AIR B;  3P8D A;  4C8Q F;  1FMW A;  2JVV A;  4AFU C;  4LDX A;  5GAN 4;  2K2M A;  4J8O A;  1VQK Q;  2NUP A;  1TOV A;  1SF9 A;  2VGM A;  1VQ9 A;  3I35 A;  3OYN A;  1UGP B;  1M8M A;  1PNJ A;  1B34 B;  3CCE A;  4PJO G;  3PMT A;  2EYX A;  3G4S A;  4UC4 A;  2E3H A;  2EJG A;  1QP2 A;  2FZG B;  1Q82 C;  2DIG A;  2GBQ A;  2JTF A;  1YWO A;  3EFO B;  2KE9 A;  2LC4 A;  5GAN d;  1SRM A;  1CKB A;  4LD6 A;  1KQS S;  3QO3 A;  1VQ7 T;  1CKA A;  1QMC A;  2GFA A;  4OB0 B;  3G1J A;  3RBB B;  1Q7Y C;  2JZ2 A;  3CCS Q;  3CCU A;  2QTX A;  1GCQ C;  1PSF A;  1ZX6 A;  1OYX A;  5GMK m;  3PVQ A;  4RTW A;  2RI3 A;  3EGX A;  4M75 C;  5KH6 A;  4XAX B;  3CPW A;  3CCM T;  2EJ9 A;  4M77 C;  5CIU A;  5CR2 A;  2OTJ T;  1YJN A;  3OSS C;  2QXF A;  3JCM P;  1O9S A;  2WAC A;  3EG9 B;  4MMK A;  1M3C A;  2MOX A;  2KMT A;  1VQ4 Q;  5GAN 6;  2O01 E;  3T9N A;  1KSW A;  3VU3 C;  3MO8 A;  4XQ3 A;  4OB3 B;  4HKE A;  5GJW B;  5KYU A;  1NBE B;  5GAM e;  3L2V A;  1VQ8 Q;  3RKY A;  3R6N A;  3CD6 T;  2EBP A;  1U1S A;  2V1Q A;  1PWT A;  2L2P A;  2ESW A;  3OYY A;  2D0Q B;  2WSC E;  4HVV A;  3UT1 A;  4X1V A;  4FW2 A;  5CO7 A;  1FYN A;  1QLY A;  2YRD A;  3PE0 A;  1Q81 R;  5GAO m;  2XD0 A;  3QSU A;  2L89 A;  1EZZ B;  4C92 F;  3JCM g;  3PNW C;  3CBP A;  2X3W D;  3X20 B;  3NHN A;  1UEB A;  4JJN K;  3HP9 A;  1K76 A;  2DA9 A;  3O5Z A;  5CKD A;  5IXF A;  1VQL Q;  1Y0M A;  1RAH B;  2PUK B;  1NJI U;  3X28 B;  4C0G A;  4F14 A;  5GAM f;  2ZPE B;  3QWX X;  3EH1 A;  2KBT A;  1AWW A;  2HZY A;  1VQ7 A;  2SEM A;  3BDU A;  1G3S A;  3HRS A;  4JRP A;  2LT4 A;  4LDV A;  2K3X A;  1KIK A;  2O9S A;  2RNA A;  1VQO Q;  3EG0 A;  2PU9 B;  3JB9 F;  4ZTJ A;  4PLI A;  3CXC S;  5KYW A;  2PNI A;  1W70 A;  1WJS A;  2AK5 A;  2H3J A;  4E6R A;  3ULR B;  4PJO A;  5LL6 S;  3OW2 S;  2V8J A;  2YRV A;  4JPB W;  3GLX A;  4M75 B;  1QVG P;  2RHX A;  4M77 F;  5J26 A;  4OMF B;  2HDA A;  4XTZ A;  1K9M C;  5FRN A;  3MEW A;  4PKC C;  2NUZ A;  2AHJ B;  1Q7Y U;  4X9D A;  5KYU B;  2Y4X A;  1G2B A;  3JCM Q;  2A0F B;  2QDY B;  2RB6 A;  4PK4 A;  2AZS A;  4MDW A;  5LJ5 g;  1FMV A;  1W1F A;  1HK9 A;  1Q82 R;  1WHL A;  2PQW A;  2JMA A;  1NYF A;  3P8B B;  2RHY A;  1WGS A;  1BI0 A;  1M2V A;  4KH0 B;  4NOY A;  4MZM A;  5GAN 5;  3I55 Q;  2DD5 A;  2V8K A;  2DVJ A;  2VWF A;  5CK9 A;  4RMO A;  4O5V A;  1UHC A;  1UG1 A;  3CCM Q;  2YT6 A;  1OU9 A;  1MV0 B;  2DLP A;  2OTJ Q;  1ZBX A;  3NGP A;  4AT1 B;  3A8H B;  1B07 A;  2AKL A;  1WI7 A;  2B86 A;  4JJC A;  3JCM e;  5A2Q E;  3CME A;  3CC7 T;  1I1J A;  1Y7X A;  4JS5 A;  3ZL7 C;  3FLG A;  2K3B A;  4C5I A;  2RQW A;  4A4F A;  3CCJ A;  3CC4 Q;  1WYX A;  4M7A G;  2EIF A;  1M1K C;  5EG2 A;  2DM1 A;  2LZ6 B;  1VQM T;  2COW A;  2DMO A;  3JCM b;  3MPU B;  3OYD A;  3TSW A;  4C0D C;  1X2K A;  4A53 A;  4Y28 E;  3JCM X;  2FHD A;  2RQV A;  4FW1 A;  3JCM f;  1AWX A;  2RQT A;  2A37 A;  1N9R A;  2EQJ A;  2LJ0 A;  1TTH B;  2RQR A;  3V7C A;  1N27 A;  4M7D G;  3A1P A;  1WXB A;  2MYS A;  4J9D A;  2O4X A;  1LCK A;  1V1C A;  4BI4 A;  2QK0 A;  1K1Z A;  1W4S A;  4OGC A;  2CS7 A;  1R8O B;  1KG1 A;  2CP3 A;  2EQU A;  4ANJ A;  2FPD A;  4NL3 A;  5CQX A;  2L3R A;  2RO0 A;  3OYM A;  1ACM B;  2BZX A;  2DXC A;  3RMS A;  1K9M U;  5I22 A;  5LJ5 e;  3HL8 A;  1JXO A;  4LN2 A;  3GP8 A;  1N8R R;  3KBG A;  2HSE B;  1KQS P;  1LJO A;  3MP6 A;  5GAN f;  1YCY A;  4HVU A;  3WVD B;  2NUT A;  1S72 A;  3RES A;  2EWN A;  2DK3 A;  3R6O A;  4M4Z A;  2ZPH B;  1M5Q 1;  4N4I A;  1K8A C;  3ZFJ A;  1YI2 T;  2RJF A;  4E7S A;  3JB9 J;  3V7S A;  3SWN A;  4C5H A;  2E5K A;  3BE3 A;  2RM4 A;  3JRZ A;  4LD9 K;  4QVD A;  1ABQ A;  2DL5 A;  4HXJ A;  2O2O A;  3O8V A;  2CP7 A;  1TG0 A;  5LJ5 f;  2L3Q A;  2E12 A;  2D0N A;  2DZ9 A;  4M78 D;  1EX4 A;  1NEB A;  4FYY B;  1IRX A;  3BDL A;  2F5K A;  4M78 E;  1NPP A;  2JJ9 A;  3CCR T;  2ZPG B;  1WXT A;  2ED1 A;  1ZUK A;  1UE9 A;  1GCP A;  3C94 A;  4C8Q G;  1RAF B;  1NPR A;  2GQI A;  4M7A A;  1N9S A;  2EGC A;  2WSE E;  4J9I A;  2OX7 A;  1M8V A;  1PHT A;  2O4X B;  3CC7 Q;  3OS1 A;  2VGN A;  3QUI A;  3M0P A;  2DJZ A;  2Y4Y A;  3H0F A;  3OS2 A;  4EIK A;  1V76 A;  1Y57 A;  3JCM V;  3VS1 A;  3OS5 A;  3OYA A;  1PD0 A;  4JLG A;  3GPL A;  1WQW A;  3E1S A;  1NEG A;  2EKH A;  4HCK A;  2HCK A;  5A0G A;  1ZHI A;  2QTV A;  4F16 A;  1M1K R;  2BE7 D;  2P0K A;  4ZGD B;  1YIJ Q;  5FRM A;  4M7D A;  3JCM J;  4E7K A;  2K4Y A;  2JS2 A;  4ZGE B;  2HL5 C;  1SSH A;  4Y92 A;  1VQ6 Q;  1QWE A;  4LE9 A;  1ARK A;  1X43 A;  2E4H A;  1WPY A;  2NUT B;  5L23 A;  1RI0 A;  2ROT A;  3OMC A;  1T0H A;  2Z0W A;  5KYY B;  3LYI A;  4Z88 A;  1YI2 A;  1BIB A;  2DJQ A;  1TS9 A;  1X6G A;  1I8F A;  1BCO A;  3I56 A;  2LVM A;  2FPE A;  5GAM d;  3SWN B;  3OY9 A;  2L8D A;  2FEI A;  2YLB A;  3L2U A;  2RD1 A;  1OZ3 A;  2F1L A;  2X35 A;  2EYZ A;  1I5L A;  4VUB A;  3V8J A;  3TCJ A;  2O88 A;  3PT9 A;  4QQG A;  2F69 A;  3VS6 A;  3MCA B;  4BUG A;  1K8A U;  2QA4 A;  1OX9 A;  1YJ9 Q;  2QQB A;  1VQN T;  2C0T A;  1NZ9 A;  2EJF A;  2MWP A;  3GBQ A;  4XU1 A;  2ZPI B;  3EH2 A;  1UJ0 A;  1QVG S;  1IHV A;  3KUF A;  2CSQ A;  4M7A B;  1YIT Q;  3VS5 A;  3UA7 A;  4PJJ A;  3H0H A;  1NLP C;  5HCK A;  1X27 A;  1JBM A;  3JAM E;  1OPL A;  1PG5 B;  3IQL A;  3UDC A;  4C92 G;  3QJY A;  2J06 A;  2YSQ A;  2HBW A;  4DOW A;  2IG0 A;  2E1H A;  1TH7 A;  1XOV A;  1QWF A;  2EGA A;  3OA6 A;  2DVE A;  4M78 C;  3AHU A;  4KBM B;  4M75 E;  2CP6 A;  3PIP A;  5FRO A;  5L8R E;  1VQ9 T;  2LQ8 A;  2X9H A;  4OVA A;  5KE2 A;  1VQ5 Q;  4JJB A;  3QZ5 B;  1S1N A;  3CCE T;  2HBP A;  4FL6 A;  3E9G A;  1VUB A;  1JXM A;  2X4W A;  3OYG A;  3G4S T;  3TRE A;  1VOM A;  2CZ1 B;  3SHW A;  3FRN A;  1JRI A;  4JRK A;  3JCM c;  1M27 C;  2DYI A;  1AWJ A;  4FCY A;  1TSF A;  2KI7 A;  2DRM A;  1NG2 A;  5IHK A;  5D6Y A;  3UAT A;  4IUT A;  1Y07 A;  4XTX A;  5KYX A;  3HPW A;  3OYB A;  2LT1 A;  3A8G B;  3KFV A;  3X24 B;  3CCU T;  2RH2 A;  1UEC A;  3OQ5 A;  4RTU A;  2JT4 A;  1YHQ A;  2KYM A;  1CSK A;  5A0D A;  1E7O A;  3DKM A;  1IO6 A;  4F7U G;  3G71 Q;  3HKS A;  4HCZ A;  4PJM A;  4LDU A;  1YJN T;  1VQP Q;  2KVQ G;  2DL7 A;  3GIB A;  2G6F X;  1D3B A;  2P0P A;  3HFO A;  1MNE A;  1RAA B;  2D9T A;  3CBO A;  2MWO A;  3M53 A;  5HK3 A;  1NYG A;  1ZUY A;  3PGG A;  2A36 A;  2RMO A;  2BTT A;  2BUD A;  2X51 A;  5ECA A;  1WHG A;  1WJQ A;  2V1R A;  4PFO A;  3JCM d;  4LNP A;  3JB9 I;  3OYH A;  1AD5 A;  2KRS A;  1GBR A;  2JN0 A;  3SD4 A;  3CPW P;  1GL5 A;  1M3A A;  4PFZ A;  4PJO D;  2K5L A;  5IT9 E;  2W0Z A;  1Y71 A;  3VKI A;  1AT1 B;  2CSI A;  2LP5 A;  4PJO E;  2K79 A;  4JZ4 A;  4E2F B;  4RG2 A;  1OOT A;  3CCS A;  2GGR A;  3UPU A;  4AFQ C;  1B3Q A;  4RG8 A;  1WA7 A;  1MMD A;  2E3I A;  2E10 A;  4M78 B;  1JO8 A;  3VS2 A;  3DB3 A;  4MZT A;  1WFW A;  2EQK A;  2D8J A;  1MMG A;  1VQN Q;  3NTK A;  5GAO r;  2JMC A;  2EQM A;  1M1F A;  1VQ4 A;  1X6O A;  2OTL Q;  1OQK A;  2VAS A;  2L5Q A;  1SSF A;  5GMK l;  3QDR B;  3M4Y A;  2DO3 A;  1VQ8 A;  1TU0 B;  5KE3 A;  2FYK A;  4R0K A;  3M59 A;  4J9G A;  4PFP A;  3RKX A;  3GF5 A;  2VYT A;  3RER A;  1M9S A;  5FU7 C;  1G3T A;  1K0X A;  1D3B B;  5LJ3 j;  1BBZ A;  2AT1 B;  2QDL A;  5LJ5 d;  3EFS A;  2LX9 A;  1Q81 U;  2QYZ A;  5I2M A;  1YWP A;  1IGU A;  3CCE Q;  4Z89 A;  2YUP A;  2ZAE A;  3TU4 K;  2HQE A;  3NMZ C;  1VQL A;  3KXT A;  2XI9 A;  4J9H A;  2CDT A;  3MHX A;  1D1A A;  3CCL Q;  5KYN A;  3EG3 A;  4FYW B;  4F7U A;  5GAM h;  5DLO A;  4J6W A;  5GAO l;  2DPP B;  3RR6 A;  1Q95 G;  4K11 A;  2CYZ B;  2NUP B;  3HRT A;  1VQO A;  2MF2 A;  4RTY A;  1M90 R;  1PD1 A;  1VA7 A;  1QCN A;  1WJR A;  2LNH B;  1OPK A;  2DZC A;  3REB B;  1VYT A;  3OYE A;  5FW9 A;  1XQH A;  2EVR A;  2WSF E;  3M58 A;  4FU6 A;  8ATC B;  3S3M A;  4CC7 A;  4A4G A;  4ESR A;  4CC4 B;  2M0Y A;  2X4Y A;  3TQ7 P;  3CME T;  4J9E A;  4YTL A;  1HSQ A;  3LH0 A;  2QQR A;  2M51 A;  2DKG A;  2Y90 A;  1WHH A;  2AKK A;  3CCJ T;  4PJO C;  1N8R C;  2VXF A;  1RAC B;  4IUR A;  1KQ2 A;  5GMK i;  3EGX B;  1LPL A;  2E5Q A;  1U3O A;  3QJ6 A;  2CGH A;  4ZNX A;  3PMI A;  1YP5 A;  1U06 A;  3URG A;  2EKO A;  4NS5 A;  1Q82 U;  3WXM B;  3SFM A;  1YJW T;  4M75 F;  2GQV A;  4OMN A;  4ZN3 A;  3I55 A;  1QVP A;  4XU2 A;  5FU7 B;  1BU1 A;  1ZA1 B;  4F17 A;  3MET A;  2DBM A;  4BB7 A;  1NLO C;  1DJ7 B;  2DET A;  2HKQ B;  3BFM A;  1QKX A;  3A98 A;  1IB8 A;  1G83 A;  2RA2 A;  3CCV T;  2LQN A;  1VQ7 Q;  2KYB A;  3VYG A;  4F7U B;  2DBK A;  1AVZ C;  4L6V 5;  5HK0 A;  4HT8 A;  1NM7 A;  1G3Y A;  2M9U A;  5D6W A;  1JEG A;  2F2W A;  3LX7 A;  1UDL A;  2HQH A;  2DXT A;  4M7A D;  2IIM A;  1HD3 A;  5GAO n;  1PSE A;  4E7I A;  4LDW A;  2CZ0 B;  1S72 T;  1I0C A;  1R0B G;  4M7A E;  4Q5W A;  1EIF A;  2F2X A;  1UGS B;  1P92 A;  1D1C A;  1AWO A;  1QVF P;  3CD6 Q;  4OMM A;  4TVR A;  2ZCF B;  4RUG A;  2RHZ A;  5KYW B;  1X75 C;  2OAU A;  3MP8 A;  4PJO B;  3C12 A;  2XDB A;  3FDR A;  4M7D D;  1YJW A;  4DBR A;  1ZBJ A;  1WQ7 A;  4M7D E;  4CC2 A;  4II1 A;  2XG8 D;  2E6Z A;  3I9Q A;  1Y96 A;  3PTA A;  3L42 A;  3QII A;  4IUV A;  5IH2 A;  4RTX A;  4QT7 A;  5GAM j;  1QKW A;  2RI2 A;  1R0C B;  5HKC A;  3G6E A;  3CMA T;  1N8R U;  2HD0 A;  1KJW A;  2JM8 A;  1IZ6 A;  2HKN A;  1SPK A;  1UJY A;  2RJE A;  5GAN h;  2DL4 A;  3CCV A;  4C5G A;  3MEV A;  1MND A;  2CZ6 B;  3FEO A;  4B9X A;  1GRI A;  2JXB A;  3M56 A;  1WLP B;  3OYJ A;  1ZSZ A;  2COZ A;  2RI5 A;  2MI6 A;  2VXE A;  3DB4 A;  1QVF A;  2PZ1 A;  2GNC A;  4JRI A;  3EG2 A;  1M2V B;  5AT1 B;  1JB0 E;  3CPW S;  2QGG A;  1BI3 A;  1UGV A;  3ASK A;  5CKH A;  3VRZ A;  2RQU A;  2C0O A;  3JCM W;  4NL2 A;  4E7Z A;  1X6B A;  3ER0 A;  4FSS A;  4AFZ C;  1BKB A;  2R57 A;  1EFN A;  4E7L A;  3SWN C;  3EAE A;  3QHS A;  2EAY A;  2CUD A;  5FWB A;  3M0Q A;  1WXU A;  3NTI A;  3I56 T;  1HYO A;  1M2O A;  4XTU A;  4IUP A;  2VB6 A;  2JTM A;  2L3P A;  4RKU E;  2ZPF B;  5I21 A;  3E2U A;  2DER A;  1TUD A;  1RLP C;  4BDZ A;  5CKB A;  3LGF A;  4KGV B;  5CKE A;  2SRC A;  5GAN 3;  4QW2 A;  4C8Q D;  2KR3 A;  3BY7 A;  1RL2 A;  2HEQ A;  5DLQ E;  2QA4 T;  4IIM A;  2FPF A;  3QXE B;  4M7A C;  2LNV A;  3VUZ A;  1U1T A;  1KK7 A;  1VIE A;  3CMA A;  2LJ1 A;  5LJ3 g;  1IHW A;  2MMP A;  1M1K U;  1C6V X;  4BY6 C;  3TSZ A;  4RCC A;  2DNU A;  4FSX A;  4EDU A;  5CKF A;  2QQS A;  4ATO A;  2NLU A;  3C4S A;  2E65 A;  4XTY A;  4HVW A;  1VQM Q;  3EFR A;  1C1A A;  4M7D C;  3QBY A;  3VRY A;  1JQQ A;  2IPO B;  2K6D A;  4N0A C;  1I5O B;  3L2R A;  2YHT A;  2XIC A;  3CQT A;  3M55 A;  3GNF B;  3M9Q A;  1W2B A;  9ATC B;  1UFF A;  4FT4 A;  4N0A A;  4F04 B;  2K9G A;  2QEX A;  5GMK h;  3ZBD A;  4XTV A;  2OAW A;  4L5G A;  2EQI A;  4J7I A;  3M5A A;  1OX8 A;  4OMO A;  2OJ2 A;  5D6X A;  3UA6 A;  5A0L A;  1RLQ C;  2KNB B;  2KT1 A;  1YIT A;  1M4Z A;  1WDX A;  2CT4 A;  2KEA A;  4QVZ A;  1YHQ T;  3CC2 A;  1BIA A;  2PVG B;  3CCQ A;  1H8K A;  3DLM A;  3M0T A;  4FM4 B;  2CKK A;  2D6F A;  3JB9 H;  2KXC A;  4D8D A;  2DTH A;  2ECZ A;  4PLL A;  3S3O A;  2AZV A;  5GAN j;  2DEU A;  2ROL A;  4C92 D;  4EMK A;  2E41 A;  1X69 A;  5GAN 7;  3FB9 A;  2J7I A;  3MKD A;  4CRI A;  4IUQ A;  3HRU A;  2DE0 X;  4M7A F;  5J39 A;  4ORZ A;  2KGT A;  4N4H A;  1MMN A;  2GCX A;  1RAE B;  4RTT A;  4KRT A;  1RAI B;  4BY6 B;  1YI2 Q;  5D7U A;  3M54 A;  2FB7 A;  2LJ3 A;  1NE8 A;  1XJW B;  5LJ3 e;  1H3Z A;  2A08 A;  3I56 Q;  1N6A A;  2J6K A;  3MJX A;  1HJD A;  2CRE A;  5FU6 C;  4DEX A;  2NYS A;  4C8Q C;  5GAN 2;  1I81 A;  3CCS T;  4DOV A;  3CXC A;  2HQX A;  4R55 A;  4C8Q A;  4M7D B;  1N5Z A;  1QP3 A;  3CCR Q;  2KK4 A;  2KRM A;  2QA4 Q;  3JB9 G;  2C06 A;  4OF1 A;  2ATC B; 
#chains in the Genus database with same CATH homology
 2B86 A;  1T3S A;  4JJC A;  1SHF A;  3NMZ C;  2O9V A;  1I1J A;  2FRY A;  4J9H A;  2CDT A;  2EGE A;  3ZL7 C;  2K3B A;  5EC7 A;  3EG3 A;  2RQW A;  2CUB A;  1WYX A;  1YNZ A;  5I11 A;  4K11 A;  2DM1 A;  2LZ6 B;  4RTY A;  1VA7 A;  2DMO A;  2O31 A;  3M0R A;  3TSW A;  2JM9 A;  2LNH B;  3JV3 A;  1X2K A;  2YDL A;  1OPK A;  3REB B;  1VYT A;  3EGU A;  1J3T A;  5FW9 A;  2KRO A;  2RQV A;  2YUN A;  1A0N B;  2EVR A;  3EHQ A;  1VYV A;  1PKT A;  4CC7 A;  3THK A;  4ESR A;  4CC4 B;  1AWX A;  2M0Y A;  2RQT A;  2A37 A;  4J9E A;  2LJ0 A;  2RQR A;  1HSQ A;  2M51 A;  2RPN A;  1OV3 A;  1WXB A;  1PKS A;  4J9D A;  1LCK A;  1V1C A;  2AKK A;  1YN8 A;  1UTI A;  1K1Z A;  2I0N A;  3M0S A;  2CH4 A;  5IHN A;  1U3O A;  1U5S A;  4ZNX A;  2FPD A;  1YP5 A;  1U06 A;  2YUQ A;  2BZX A;  2GTO A;  4DEY A;  1MV3 A;  5I22 A;  2LQW A;  2RF0 A;  1JXO A;  4LN2 A;  3U23 A;  4OMN A;  2LCS A;  3LH5 A;  1BU1 A;  1PRL C;  1M3B A;  4AFS C;  4F17 A;  2DX1 A;  2H8H A;  5GJV B;  2DBM A;  1NLO C;  4HVU A;  3QWY A;  1QKX A;  3A98 A;  3VS0 A;  1G83 A;  4M4Z A;  1AOJ A;  1K9A A;  3PVL A;  2BZ8 A;  4D8K A;  2L0A A;  1K4U S;  2LQN A;  2KYB A;  4J9B A;  1I07 A;  4CC3 A;  2DBK A;  1AVZ C;  2E5K A;  3VS4 A;  1Z9Z A;  1E6G A;  1NM7 A;  1H92 A;  1TUC A;  1JEG A;  2F2W A;  2D1X A;  1ABQ A;  1UHF A;  2DL5 A;  4HXJ A;  1UDL A;  2O2O A;  1TG0 A;  2L3Q A;  2D0N A;  1MUZ A;  1M30 A;  1NEB A;  1ZSG A;  2VKN A;  2FO0 A;  2IIM A;  1HD3 A;  2LX7 A;  1GCQ A;  1WXT A;  2PTK A;  1I0C A;  1BB9 A;  2ED1 A;  1ZUK A;  3H41 A;  2A28 A;  1Z9Q A;  2EYY A;  2L3S A;  3SEM A;  2DIL A;  1UE9 A;  1GCP A;  2F2X A;  2GQI A;  1AWO A;  2EGC A;  4OMP A;  4J9I A;  2JW4 A;  3C0C A;  2JTE A;  3UF4 A;  1PHT A;  2ABL A;  4OMM A;  3REA B;  2BZY A;  4RUG A;  3M0P A;  1AZE A;  2LMJ A;  3H0F A;  4EIK A;  1Y57 A;  3VS1 A;  2GTJ A;  3TVT A;  3I5R A;  4JJD A;  2DRK A;  1NEG A;  4IIO A;  1ZBJ A;  2EKH A;  5FWC A;  4HCK A;  2HCK A;  4CC2 A;  1SHG A;  5IXB A;  1AZG B;  3I9Q A;  1GFD A;  4AG1 C;  2KRN A;  1WX6 A;  4F16 A;  1JU5 C;  2EPD A;  2FG0 A;  4RTX A;  2YUO A;  4QT7 A;  5IH2 A;  5IHI A;  1VYU A;  1QKW A;  2JS2 A;  1SSH A;  4Y92 A;  1QWE A;  1KJW A;  2DL8 A;  2JM8 A;  1ABO A;  1ZLM A;  4LE9 A;  1ARK A;  1X43 A;  5L23 A;  2KXD A;  2ROT A;  1T0H A;  4LUE A;  1RI9 A;  1SPK A;  1UJY A;  2DL4 A;  4Z88 A;  1WIE A;  2DJQ A;  3RNJ A;  1X6G A;  1GRI A;  2JXB A;  1WLP B;  4J9F A;  2J6O A;  3EHR A;  2FPE A;  1KFZ A;  2J05 A;  2FEI A;  1X2Q A;  2PZ1 A;  2GNC A;  3I5S A;  3EG2 A;  2FRW A;  4GLM A;  2DF6 A;  3VS3 A;  3FJ5 A;  2EYZ A;  4AFU C;  1UGV A;  3VRZ A;  4Z8A A;  2K2M A;  2RQU A;  2XMF A;  2O88 A;  2ED0 A;  2C0O A;  2F2V A;  2CH4 W;  1X6B A;  3VS6 A;  4FSS A;  4AFZ C;  2ENM A;  3I35 A;  3VS7 A;  1M8M A;  1PNJ A;  1T3L A;  1EFN A;  2C0T A;  2EYX A;  3GBQ A;  1K0S A;  1UJ0 A;  2CUD A;  2GBQ A;  2CSQ A;  5FWB A;  2DYB A;  2HSP A;  1YWO A;  2JS0 A;  3UA7 A;  3VS5 A;  3M0Q A;  1WXU A;  3H0H A;  1NLP C;  5HCK A;  2KE9 A;  1X27 A;  1OPL A;  2L3P A;  1SRM A;  3IQL A;  1CKB A;  1QCF A;  2J06 A;  1GFC A;  1CKA A;  1TUD A;  1RLP C;  3RBB B;  2YSQ A;  2HBW A;  2D8H A;  2SRC A;  1GCQ C;  1ZX6 A;  3M0U A;  4AG2 C;  1XOV A;  2KR3 A;  3PVQ A;  4RTW A;  1QWF A;  2X3X D;  2EGA A;  2HEQ A;  4IIM A;  2FPF A;  4JJB A;  1S1N A;  1JXM A;  2LJ1 A;  1M3C A;  2MOX A;  3SHW A;  3TSZ A;  2DNU A;  1M27 C;  1KSW A;  1AWJ A;  4RTV A;  5GJW B;  4WCI A;  2KT8 A;  2DRM A;  1NG2 A;  2W10 A;  3R6N A;  5IHK A;  3UAT A;  2CT3 A;  2EYW A;  2MIO A;  2EBP A;  2V1Q A;  1PWT A;  3KFV A;  4RTZ A;  2L2P A;  2ESW A;  1BK2 A;  2EW3 A;  1UEC A;  4HVV A;  1OEB A;  4X1V A;  1YCS B;  4RTU A;  4HVW A;  2JT4 A;  2KYM A;  1CSK A;  1FYN A;  1E7O A;  1QLY A;  2NWM A;  2C0I A;  3VRY A;  3PE0 A;  1IO6 A;  1JQQ A;  1GBQ A;  2K6D A;  1PRM C;  2DL7 A;  3CQT A;  2G6F X;  2VVK A;  2X3W D;  4GBQ A;  1UFF A;  3NHN A;  1NYG A;  1K76 A;  1ZUY A;  2DA9 A;  3O5Z A;  2A36 A;  1E6H A;  2RMO A;  2K9G A;  3EG1 A;  5IXF A;  1Y0M A;  2BTT A;  5ECA A;  2OI3 A;  2V1R A;  2OAW A;  2EQI A;  4F14 A;  3QWX X;  4OMO A;  4LNP A;  2KBT A;  2OJ2 A;  3UA6 A;  1AD5 A;  2KRS A;  1AWW A;  1GBR A;  1RLQ C;  2KNB B;  2KT1 A;  2K7A A;  2SEM A;  1GL5 A;  1M3A A;  4LUD A;  1WDX A;  2CT4 A;  1KIK A;  2KEA A;  2O9S A;  2RNA A;  2W0Z A;  1SRL A;  3EG0 A;  2CSI A;  2LP5 A;  1H3H A;  2K79 A;  4JZ3 A;  4JZ4 A;  2PNI A;  1W70 A;  1H8K A;  3M0T A;  2AK5 A;  2KXC A;  4D8D A;  1OOT A;  2ECZ A;  2J6F A;  3ULR B;  4E6R A;  1RUW A;  2AZV A;  2GGR A;  4AFQ C;  2ROL A;  1B3Q A;  4JPB W;  1WA7 A;  1X69 A;  4OMQ A;  1JO8 A;  3VS2 A;  2J7I A;  1WFW A;  1UUE A;  2DE0 X;  2HDA A;  2D8J A;  1FMK A;  4ORZ A;  2KGT A;  1W6X A;  2NUZ A;  2RN8 A;  4RTT A;  2JMC A;  4KRT A;  3H0I A;  1T0J A;  2DL3 A;  2LJ3 A;  1G2B A;  2P4R A;  2A08 A;  2AZS A;  2J6K A;  1HJD A;  1AEY A;  1W1F A;  2CRE A;  4DEX A;  2JMA A;  1NYF A;  4R0K A;  4J9G A;  4OML A;  2MCN A;  1SEM A;  2DVJ A;  2VWF A;  3NPF A;  1K0X A;  1N5Z A;  1BBZ A;  1UHC A;  1UG1 A;  2YT6 A;  2QDL A;  1MV0 B;  2DLP A;  2KRM A;  3NGP A;  1YWP A;  1ZUU A;  1B07 A;  4Z89 A;  2AKL A;  4A63 B;  1WI7 A;  2YUP A;  4J9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...