2DFJA

Crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
267
structure length
267
Chain Sequence
ATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRRQPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNWSPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYSIAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the diadenosine tetraphosphate hydrolase from Shigella flexneri 2a
pubmed doi rcsb
source organism Shigella flexneri 2a
molecule tags Hydrolase
molecule keywords diadenosinetetraphosphatase
total genus 74
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.6.1.41: Bis(5'-nucleosyl)-tetraphosphatase (symmetrical).
pdb deposition date 2006-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2dfjA00
3DSDA 4V0WA 2NXFA 3V4YA 1S3MA 2NPPC 2BDXA 4DSYA 1SU1A 3LL8A 4O24A 2HYPA 3FGAC 4XPNA 2USHA 3AV0A 4KKZA 5F3WA 3ZU0A 3RL3A 1G5BA 3T1IA 1WAO1 1USHA 2O8AA 4I5NC 2CV9A 2WDCA 3H66A 4J6OA 3H67A 3HVQA 4F0ZA 2IE4C 3GVEA 4G9JA 1S8EA 1UF3A 1XZWA 3K7WC 1MF8A 2WDDA 4WWLA 2Q8UA 3IVDA 4HD0A 1QHWA 1NNWA 1II7A 4DHLA 2DFJA 4MP0A 4ZX2A 4OR9A 3RL4A 4LTYA 3THNA 5C1VA 4O5GA 4IYPC 2KKNA 4V0XA 4ZVZA 1FJMA 1UTEA 2AHDA 3TGHA 3QFKA 3CK2A 3H63A 1S3LA 1OIEA 3H69A 3DSCA 4YKEA 4KBPA 5J28A 5HPEA 1OIDA 1KBPA 4FBKA 2Z1AA 4LACC 3IVEA 4V0VA 3C5WC 4M0VA 3PSOA 3RL5A 3RQZA 3H64A 2A22A 3H62B 5DNYA 1HPUA 1WARA 5INBA 4H2BA 3THOB 4LU9A 3QFNA 1Z2XA 3E7AA 4H2FA 5JPEA 4TUIA 1S70A 2Z72A 3P71C 1V73A 3H68A 4TUGA 2ZBMA 4ORAA 3C9FA 3E7BA 4DT2A 4UWQA 3PSNA 2Z06A 4ORCA 5JJTA 2BQ8X 4I5LC 2QFRA 2R17A 4FBQA 3QFMA 2WDFA 4FCXA 2WDEA 5B8IA 1XM7A 2GJUA 1TCOA 2P6BA 2IAEC 1Z2WA 1HP1A 4FBWA 2HYOA 2NYMC 3EGHA 3QG5C 4H1SA 3DW8C 3ZTVA 3IB7A 2XMOA 2QJCA 4O43A 1T71A 1OI8A 2BCDA 3K7VC 4UT3B 4IL1A 4Q7FA 2O8GA 1W24A 3IB8A 4B2OA 1IT6A 1U32A 4MOVA 2JOGA 3KBPA 4ORBA 1JK7A 2HY1A 3ICFA 1S95A 4H1YP 4NZVA 3H60A 2QFPA 2IE3C 2YVTA 3AUZA 4UT3A 4UT2A 1AUIA 1QFCA 4JA7A 5IOHA 4H2GA 1M63A 5EQVA 5JPFA 4H2IA 3EGGA 5GTUA 1S3NA 1T70A 4JA9A 2NYLC 1HO5A 3JYFA 3H61A 3N5UA 3QFOA 4O4KA 4MOYA
chains in the Genus database with same CATH superfamily
3DSDA 4V0WA 2NXFA 2ZO9B 3V4YA 3D03A 1S3MA 2NPPC 2BDXA 4DSYA 1SU1A 3LL8A 4O24A 2HYPA 3FGAC 4XPNA 2USHA 3AV0A 4KKZA 5F3WA 3ZU0A 3RL3A 1G5BA 3T1IA 1WAO1 1USHA 2O8AA 4I5NC 2CV9A 2WDCA 3H66A 4J6OA 3H67A 3HVQA 4F0ZA 2IE4C 3GVEA 4G9JA 1S8EA 1UF3A 1XZWA 3K7WC 1MF8A 2WDDA 4WWLA 2Q8UA 3IVDA 4HD0A 1QHWA 1NNWA 1II7A 2ZOAA 2DFJA 4DHLA 4MP0A 4ZX2A 4OR9A 3RL4A 4LTYA 3THNA 5C1VA 4O5GA 4IYPC 2KKNA 4V0XA 4ZVZA 1FJMA 1UTEA 2AHDA 3TGHA 3QFKA 3CK2A 3H63A 1S3LA 1OIEA 3H69A 3DSCA 4YKEA 4KBPA 5J28A 5HPEA 1OIDA 1KBPA 4FBKA 2Z1AA 4LACC 3IVEA 4V0VA 3C5WC 4M0VA 3PSOA 3RL5A 3RQZA 3H64A 2A22A 3H62B 2DXLA 5DNYA 1HPUA 1WARA 5INBA 4H2BA 3FLOA 3THOB 4LU9A 3QFNA 1Z2XA 3E7AA 4H2FA 5JPEA 4TUIA 1S70A 2Z72A 3P71C 1V73A 3H68A 4TUGA 2ZBMA 4ORAA 3C9FA 3E7BA 4DT2A 4UWQA 3PSNA 2Z06A 4ORCA 5JJTA 2BQ8X 4I5LC 2QFRA 2R17A 3E0JA 3QFMA 4FBQA 2WDFA 4FCXA 2WDEA 5B8IA 1XM7A 2GJUA 1TCOA 2P6BA 2IAEC 1Z2WA 1HP1A 4FBWA 2HYOA 2NYMC 3EGHA 3QG5C 4H1SA 3DW8C 2DXNA 3ZTVA 3IB7A 2XMOA 2QJCA 4O43A 1T71A 1OI8A 2BCDA 3K7VC 4UT3B 4IL1A 4Q7FA 2O8GA 1W24A 3IB8A 4B2OA 1IT6A 1U32A 4MOVA 2JOGA 3KBPA 4ORBA 2YEQA 1JK7A 2HY1A 3ICFA 1S95A 4H1YP 4NZVA 3H60A 2QFPA 2IE3C 2YVTA 3AUZA 4UT3A 4UT2A 1AUIA 1QFCA 4JA7A 5IOHA 4H2GA 1M63A 5EQVA 5JPFA 4H2IA 3EGGA 5GTUA 1S3NA 1T70A 4JA9A 2NYLC 1HO5A 3JYFA 3H61A 3N5UA 3QFOA 4O4KA 4MOYA
chains in the Genus database with same CATH topology
3DSDA 4V0WA 2NXFA 2ZO9B 3V4YA 3D03A 1S3MA 2NPPC 2BDXA 4DSYA 1SU1A 3LL8A 4O24A 2HYPA 3FGAC 4XPNA 2USHA 3AV0A 4KKZA 5F3WA 3ZU0A 3RL3A 1G5BA 3T1IA 1WAO1 1USHA 2O8AA 4I5NC 2CV9A 2WDCA 3H66A 4J6OA 3H67A 3HVQA 4F0ZA 2IE4C 3GVEA 4G9JA 1S8EA 1UF3A 1XZWA 3K7WC 1MF8A 2WDDA 4WWLA 2Q8UA 3IVDA 4HD0A 1QHWA 1NNWA 1II7A 2ZOAA 2DFJA 4DHLA 4MP0A 4ZX2A 4OR9A 3RL4A 4LTYA 3THNA 5C1VA 4O5GA 4IYPC 2KKNA 4V0XA 4ZVZA 1FJMA 1UTEA 2AHDA 3TGHA 3QFKA 3CK2A 3H63A 1S3LA 1OIEA 3H69A 3DSCA 4YKEA 4KBPA 5J28A 5HPEA 1OIDA 1KBPA 4FBKA 2Z1AA 4LACC 3IVEA 4V0VA 3C5WC 4M0VA 3PSOA 3RL5A 3RQZA 3H64A 2A22A 3H62B 2DXLA 5DNYA 1HPUA 1WARA 5INBA 4H2BA 3FLOA 3THOB 4LU9A 3QFNA 1Z2XA 3E7AA 4H2FA 5JPEA 4TUIA 1S70A 2Z72A 3P71C 1V73A 3H68A 4TUGA 2ZBMA 4ORAA 3C9FA 3E7BA 4DT2A 4UWQA 3PSNA 2Z06A 4ORCA 5JJTA 2BQ8X 4I5LC 2QFRA 2R17A 3E0JA 3QFMA 4FBQA 2WDFA 4FCXA 2WDEA 5B8IA 1XM7A 2GJUA 1TCOA 2P6BA 2IAEC 1Z2WA 1HP1A 4FBWA 2HYOA 2NYMC 3EGHA 3QG5C 4H1SA 3DW8C 2DXNA 3ZTVA 3IB7A 2XMOA 2QJCA 4O43A 1T71A 1OI8A 2BCDA 3K7VC 4UT3B 4IL1A 4Q7FA 2O8GA 1W24A 3IB8A 4B2OA 1IT6A 1U32A 4MOVA 2JOGA 3KBPA 4ORBA 2YEQA 1JK7A 2HY1A 3ICFA 1S95A 4H1YP 4NZVA 3H60A 2QFPA 2IE3C 2YVTA 3AUZA 4UT3A 4UT2A 1AUIA 1QFCA 4JA7A 5IOHA 4H2GA 1M63A 5EQVA 5JPFA 4H2IA 3EGGA 5GTUA 1S3NA 1T70A 4JA9A 2NYLC 1HO5A 3JYFA 3H61A 3N5UA 3QFOA 4O4KA 4MOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSD A;  4V0W A;  2NXF A;  3V4Y A;  1S3M A;  2NPP C;  2BDX A;  4DSY A;  1SU1 A;  3LL8 A;  4O24 A;  2HYP A;  3FGA C;  4XPN A;  2USH A;  3AV0 A;  4KKZ A;  5F3W A;  3ZU0 A;  3RL3 A;  1G5B A;  3T1I A;  1WAO 1;  1USH A;  2O8A A;  4I5N C;  2CV9 A;  2WDC A;  3H66 A;  4J6O A;  3H67 A;  3HVQ A;  4F0Z A;  2IE4 C;  3GVE A;  4G9J A;  1S8E A;  1UF3 A;  1XZW A;  3K7W C;  1MF8 A;  2WDD A;  4WWL A;  2Q8U A;  3IVD A;  4HD0 A;  1QHW A;  1NNW A;  1II7 A;  4DHL A;  2DFJ A;  4MP0 A;  4ZX2 A;  4OR9 A;  3RL4 A;  4LTY A;  3THN A;  5C1V A;  4O5G A;  4IYP C;  2KKN A;  4V0X A;  4ZVZ A;  1FJM A;  1UTE A;  2AHD A;  3TGH A;  3QFK A;  3CK2 A;  3H63 A;  1S3L A;  1OIE A;  3H69 A;  3DSC A;  4YKE A;  4KBP A;  5J28 A;  5HPE A;  1OID A;  1KBP A;  4FBK A;  2Z1A A;  4LAC C;  3IVE A;  4V0V A;  3C5W C;  4M0V A;  3PSO A;  3RL5 A;  3RQZ A;  3H64 A;  2A22 A;  3H62 B;  5DNY A;  1HPU A;  1WAR A;  5INB A;  4H2B A;  3THO B;  4LU9 A;  3QFN A;  1Z2X A;  3E7A A;  4H2F A;  5JPE A;  4TUI A;  1S70 A;  2Z72 A;  3P71 C;  1V73 A;  3H68 A;  4TUG A;  2ZBM A;  4ORA A;  3C9F A;  3E7B A;  4DT2 A;  4UWQ A;  3PSN A;  2Z06 A;  4ORC A;  5JJT A;  2BQ8 X;  4I5L C;  2QFR A;  2R17 A;  4FBQ A;  3QFM A;  2WDF A;  4FCX A;  2WDE A;  5B8I A;  1XM7 A;  2GJU A;  1TCO A;  2P6B A;  2IAE C;  1Z2W A;  1HP1 A;  4FBW A;  2HYO A;  2NYM C;  3EGH A;  3QG5 C;  4H1S A;  3DW8 C;  3ZTV A;  3IB7 A;  2XMO A;  2QJC A;  4O43 A;  1T71 A;  1OI8 A;  2BCD A;  3K7V C;  4UT3 B;  4IL1 A;  4Q7F A;  2O8G A;  1W24 A;  3IB8 A;  4B2O A;  1IT6 A;  1U32 A;  4MOV A;  2JOG A;  3KBP A;  4ORB A;  1JK7 A;  2HY1 A;  3ICF A;  1S95 A;  4H1Y P;  4NZV A;  3H60 A;  2QFP A;  2IE3 C;  2YVT A;  3AUZ A;  4UT3 A;  4UT2 A;  1AUI A;  1QFC A;  4JA7 A;  5IOH A;  4H2G A;  1M63 A;  5EQV A;  5JPF A;  4H2I A;  3EGG A;  5GTU A;  1S3N A;  1T70 A;  4JA9 A;  2NYL C;  1HO5 A;  3JYF A;  3H61 A;  3N5U A;  3QFO A;  4O4K A;  4MOY A; 
#chains in the Genus database with same CATH topology
 3DSD A;  4V0W A;  2NXF A;  2ZO9 B;  3V4Y A;  3D03 A;  1S3M A;  2NPP C;  2BDX A;  4DSY A;  1SU1 A;  3LL8 A;  4O24 A;  2HYP A;  3FGA C;  4XPN A;  2USH A;  3AV0 A;  4KKZ A;  5F3W A;  3ZU0 A;  3RL3 A;  1G5B A;  3T1I A;  1WAO 1;  1USH A;  2O8A A;  4I5N C;  2CV9 A;  2WDC A;  3H66 A;  4J6O A;  3H67 A;  3HVQ A;  4F0Z A;  2IE4 C;  3GVE A;  4G9J A;  1S8E A;  1UF3 A;  1XZW A;  3K7W C;  1MF8 A;  2WDD A;  4WWL A;  2Q8U A;  3IVD A;  4HD0 A;  1QHW A;  1NNW A;  1II7 A;  2ZOA A;  2DFJ A;  4DHL A;  4MP0 A;  4ZX2 A;  4OR9 A;  3RL4 A;  4LTY A;  3THN A;  5C1V A;  4O5G A;  4IYP C;  2KKN A;  4V0X A;  4ZVZ A;  1FJM A;  1UTE A;  2AHD A;  3TGH A;  3QFK A;  3CK2 A;  3H63 A;  1S3L A;  1OIE A;  3H69 A;  3DSC A;  4YKE A;  4KBP A;  5J28 A;  5HPE A;  1OID A;  1KBP A;  4FBK A;  2Z1A A;  4LAC C;  3IVE A;  4V0V A;  3C5W C;  4M0V A;  3PSO A;  3RL5 A;  3RQZ A;  3H64 A;  2A22 A;  3H62 B;  2DXL A;  5DNY A;  1HPU A;  1WAR A;  5INB A;  4H2B A;  3FLO A;  3THO B;  4LU9 A;  3QFN A;  1Z2X A;  3E7A A;  4H2F A;  5JPE A;  4TUI A;  1S70 A;  2Z72 A;  3P71 C;  1V73 A;  3H68 A;  4TUG A;  2ZBM A;  4ORA A;  3C9F A;  3E7B A;  4DT2 A;  4UWQ A;  3PSN A;  2Z06 A;  4ORC A;  5JJT A;  2BQ8 X;  4I5L C;  2QFR A;  2R17 A;  3E0J A;  3QFM A;  4FBQ A;  2WDF A;  4FCX A;  2WDE A;  5B8I A;  1XM7 A;  2GJU A;  1TCO A;  2P6B A;  2IAE C;  1Z2W A;  1HP1 A;  4FBW A;  2HYO A;  2NYM C;  3EGH A;  3QG5 C;  4H1S A;  3DW8 C;  2DXN A;  3ZTV A;  3IB7 A;  2XMO A;  2QJC A;  4O43 A;  1T71 A;  1OI8 A;  2BCD A;  3K7V C;  4UT3 B;  4IL1 A;  4Q7F A;  2O8G A;  1W24 A;  3IB8 A;  4B2O A;  1IT6 A;  1U32 A;  4MOV A;  2JOG A;  3KBP A;  4ORB A;  2YEQ A;  1JK7 A;  2HY1 A;  3ICF A;  1S95 A;  4H1Y P;  4NZV A;  3H60 A;  2QFP A;  2IE3 C;  2YVT A;  3AUZ A;  4UT3 A;  4UT2 A;  1AUI A;  1QFC A;  4JA7 A;  5IOH A;  4H2G A;  1M63 A;  5EQV A;  5JPF A;  4H2I A;  3EGG A;  5GTU A;  1S3N A;  1T70 A;  4JA9 A;  2NYL C;  1HO5 A;  3JYF A;  3H61 A;  3N5U A;  3QFO A;  4O4K A;  4MOY A; 
#chains in the Genus database with same CATH homology
 3DSD A;  4V0W A;  2NXF A;  2ZO9 B;  3V4Y A;  3D03 A;  1S3M A;  2NPP C;  2BDX A;  4DSY A;  1SU1 A;  3LL8 A;  4O24 A;  2HYP A;  3FGA C;  4XPN A;  2USH A;  3AV0 A;  4KKZ A;  5F3W A;  3ZU0 A;  3RL3 A;  1G5B A;  3T1I A;  1WAO 1;  1USH A;  2O8A A;  4I5N C;  2CV9 A;  2WDC A;  3H66 A;  4J6O A;  3H67 A;  3HVQ A;  4F0Z A;  2IE4 C;  3GVE A;  4G9J A;  1S8E A;  1UF3 A;  1XZW A;  3K7W C;  1MF8 A;  2WDD A;  4WWL A;  2Q8U A;  3IVD A;  4HD0 A;  1QHW A;  1NNW A;  1II7 A;  2ZOA A;  2DFJ A;  4DHL A;  4MP0 A;  4ZX2 A;  4OR9 A;  3RL4 A;  4LTY A;  3THN A;  5C1V A;  4O5G A;  4IYP C;  2KKN A;  4V0X A;  4ZVZ A;  1FJM A;  1UTE A;  2AHD A;  3TGH A;  3QFK A;  3CK2 A;  3H63 A;  1S3L A;  1OIE A;  3H69 A;  3DSC A;  4YKE A;  4KBP A;  5J28 A;  5HPE A;  1OID A;  1KBP A;  4FBK A;  2Z1A A;  4LAC C;  3IVE A;  4V0V A;  3C5W C;  4M0V A;  3PSO A;  3RL5 A;  3RQZ A;  3H64 A;  2A22 A;  3H62 B;  2DXL A;  5DNY A;  1HPU A;  1WAR A;  5INB A;  4H2B A;  3FLO A;  3THO B;  4LU9 A;  3QFN A;  1Z2X A;  3E7A A;  4H2F A;  5JPE A;  4TUI A;  1S70 A;  2Z72 A;  3P71 C;  1V73 A;  3H68 A;  4TUG A;  2ZBM A;  4ORA A;  3C9F A;  3E7B A;  4DT2 A;  4UWQ A;  3PSN A;  2Z06 A;  4ORC A;  5JJT A;  2BQ8 X;  4I5L C;  2QFR A;  2R17 A;  3E0J A;  3QFM A;  4FBQ A;  2WDF A;  4FCX A;  2WDE A;  5B8I A;  1XM7 A;  2GJU A;  1TCO A;  2P6B A;  2IAE C;  1Z2W A;  1HP1 A;  4FBW A;  2HYO A;  2NYM C;  3EGH A;  3QG5 C;  4H1S A;  3DW8 C;  2DXN A;  3ZTV A;  3IB7 A;  2XMO A;  2QJC A;  4O43 A;  1T71 A;  1OI8 A;  2BCD A;  3K7V C;  4UT3 B;  4IL1 A;  4Q7F A;  2O8G A;  1W24 A;  3IB8 A;  4B2O A;  1IT6 A;  1U32 A;  4MOV A;  2JOG A;  3KBP A;  4ORB A;  2YEQ A;  1JK7 A;  2HY1 A;  3ICF A;  1S95 A;  4H1Y P;  4NZV A;  3H60 A;  2QFP A;  2IE3 C;  2YVT A;  3AUZ A;  4UT3 A;  4UT2 A;  1AUI A;  1QFC A;  4JA7 A;  5IOH A;  4H2G A;  1M63 A;  5EQV A;  5JPF A;  4H2I A;  3EGG A;  5GTU A;  1S3N A;  1T70 A;  4JA9 A;  2NYL C;  1HO5 A;  3JYF A;  3H61 A;  3N5U A;  3QFO A;  4O4K A;  4MOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...