2DFJA

Crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
267
structure length
267
Chain Sequence
ATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRRQPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNWSPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYSIAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the diadenosine tetraphosphate hydrolase from Shigella flexneri 2a
pubmed doi rcsb
molecule keywords diadenosinetetraphosphatase
molecule tags Hydrolase
source organism Shigella flexneri 2a
total genus 74
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.6.1.41: Bis(5'-nucleosyl)-tetraphosphatase (symmetrical).
pdb deposition date 2006-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2dfjA00
1NNWA 1S3MA 1UF3A 2HYOA 1M63A 2DFJA 2JOGA 2WDEA 4LU9A 4DT2A 4H2IA 4V0VA 4H1YP 4TUGA 2IE4C 2R17A 4I5LC 2XMOA 2HYPA 2Z72A 4ZX2A 4TUIA 3K7WC 3RL5A 5IOHA 2Z1AA 4H2FA 4NZVA 5F3WA 3DW8C 2BDXA 2QJCA 5GTUA 4B2OA 5B8IA 4LTYA 1HO5A 3ZTVA 1SU1A 3H60A 3QFMA 3QFOA 1OIDA 4ORBA 4H2GA 1XM7A 4F0ZA 3DSCA 1IT6A 3QFKA 2QFPA 3H66A 4O24A 2IE3C 4DHLA 3JYFA 3PSNA 3H63A 3AUZA 1JK7A 2NYMC 1OI8A 1T71A 2O8AA 4UT2A 2WDFA 2USHA 4O5GA 4KKZA 2QFRA 3IB8A 2P6BA 4H2BA 4WWLA 4XPNA 4J6OA 4V0XA 1TCOA 4UT3B 1QHWA 1T70A 2AHDA 3H67A 4ORCA 5HPEA 3AV0A 1II7A 1Z2WA 4UWQA 3ZU0A 3H68A 4FBQA 4MOYA 2IAEC 3H64A 4DSYA 3DSDA 3QG5C 1G5BA 2O8GA 1QFCA 1U32A 4MP0A 1MF8A 2HY1A 3IVEA 4KBPA 4FBWA 3E7BA 4MOVA 4G9JA 1S3LA 4O4KA 3THOB 1S3NA 1S70A 2CV9A 1KBPA 2YVTA 1USHA 3C9FA 5J28A 2NYLC 1S8EA 4IL1A 4OR9A 2KKNA 3E7AA 5INBA 3H69A 4JA9A 5C1VA 3K7VC 5JPFA 3RQZA 1HP1A 1HPUA 3QFNA 4O43A 1WARA 3PSOA 4H1SA 1Z2XA 2Q8UA 4FBKA 2GJUA 1XZWA 4YKEA 1WAO1 1FJMA 2NPPC 3H61A 4IYPC 4ORAA 3KBPA 5EQVA 3RL3A 3FGAC 3P71C 2BCDA 2WDDA 5DNYA 3THNA 5JPEA 1S95A 1V73A 3GVEA 3H62B 4ZVZA 4V0WA 3V4YA 4LACC 3IB7A 4FCXA 3ICFA 4UT3A 2BQ8X 4HD0A 4I5NC 3TGHA 3CK2A 3RL4A 3C5WC 3IVDA 1AUIA 5JJTA 1OIEA 2Z06A 3EGGA 1W24A 3T1IA 3LL8A 2A22A 2WDCA 4JA7A 2NXFA 4Q7FA 1UTEA 2ZBMA 3N5UA 3EGHA 4M0VA 3HVQA
chains in the Genus database with same CATH superfamily
2ZO9B 1NNWA 1S3MA 1UF3A 2HYOA 1M63A 2DFJA 2JOGA 2WDEA 4LU9A 2ZOAA 4DT2A 4H2IA 4V0VA 4H1YP 4TUGA 2IE4C 2R17A 4I5LC 2XMOA 2HYPA 2Z72A 4ZX2A 4TUIA 3K7WC 3RL5A 5IOHA 2Z1AA 4H2FA 4NZVA 5F3WA 3DW8C 2BDXA 2QJCA 5GTUA 4B2OA 5B8IA 4LTYA 1HO5A 3ZTVA 1SU1A 3H60A 3QFMA 3QFOA 1OIDA 4ORBA 4H2GA 1XM7A 4F0ZA 3DSCA 1IT6A 3QFKA 2QFPA 3H66A 4O24A 2IE3C 4DHLA 3JYFA 3PSNA 3H63A 3AUZA 1JK7A 2NYMC 1OI8A 1T71A 2O8AA 4UT2A 2WDFA 2USHA 4O5GA 4KKZA 2QFRA 3IB8A 2P6BA 4H2BA 4WWLA 3FLOA 4XPNA 4J6OA 4V0XA 1TCOA 4UT3B 1QHWA 1T70A 2AHDA 3H67A 3E0JA 4ORCA 5HPEA 3AV0A 1II7A 1Z2WA 4UWQA 3ZU0A 3H68A 4FBQA 4MOYA 2IAEC 3H64A 4DSYA 3DSDA 3QG5C 1G5BA 2O8GA 1QFCA 1U32A 4MP0A 1MF8A 2HY1A 3IVEA 4KBPA 4FBWA 3E7BA 4MOVA 4G9JA 1S3LA 4O4KA 3THOB 1S3NA 1S70A 2CV9A 1KBPA 2YVTA 1USHA 3C9FA 5J28A 2NYLC 1S8EA 4IL1A 4OR9A 2KKNA 2DXLA 3E7AA 5INBA 3H69A 4JA9A 5C1VA 3K7VC 5JPFA 3RQZA 1HP1A 1HPUA 3QFNA 4O43A 1WARA 3PSOA 4H1SA 3D03A 1Z2XA 2Q8UA 4FBKA 2GJUA 1XZWA 4YKEA 1WAO1 1FJMA 2NPPC 3H61A 4IYPC 4ORAA 3KBPA 5EQVA 3RL3A 3FGAC 3P71C 2BCDA 2WDDA 5DNYA 3THNA 5JPEA 1S95A 1V73A 3GVEA 3H62B 4ZVZA 4V0WA 3V4YA 4LACC 3IB7A 4FCXA 3ICFA 4UT3A 2BQ8X 2DXNA 4HD0A 4I5NC 3TGHA 3CK2A 3RL4A 3C5WC 3IVDA 1AUIA 5JJTA 1OIEA 2YEQA 2Z06A 3EGGA 1W24A 3T1IA 3LL8A 2A22A 2WDCA 4JA7A 2NXFA 4Q7FA 1UTEA 2ZBMA 3N5UA 3EGHA 4M0VA 3HVQA
chains in the Genus database with same CATH topology
2ZO9B 1NNWA 1S3MA 1UF3A 2HYOA 1M63A 2DFJA 2JOGA 2WDEA 4LU9A 2ZOAA 4DT2A 4H2IA 4V0VA 4H1YP 4TUGA 2IE4C 2R17A 4I5LC 2XMOA 2HYPA 2Z72A 4ZX2A 4TUIA 3K7WC 3RL5A 5IOHA 2Z1AA 4H2FA 4NZVA 5F3WA 3DW8C 2BDXA 2QJCA 5GTUA 4B2OA 5B8IA 4LTYA 1HO5A 3ZTVA 1SU1A 3H60A 3QFMA 3QFOA 1OIDA 4ORBA 4H2GA 1XM7A 4F0ZA 3DSCA 1IT6A 3QFKA 2QFPA 3H66A 4O24A 2IE3C 4DHLA 3JYFA 3PSNA 3H63A 3AUZA 1JK7A 2NYMC 1OI8A 1T71A 2O8AA 4UT2A 2WDFA 2USHA 4O5GA 4KKZA 2QFRA 3IB8A 2P6BA 4H2BA 4WWLA 3FLOA 4XPNA 4J6OA 4V0XA 1TCOA 4UT3B 1QHWA 1T70A 2AHDA 3H67A 3E0JA 4ORCA 5HPEA 3AV0A 1II7A 1Z2WA 4UWQA 3ZU0A 3H68A 4FBQA 4MOYA 2IAEC 3H64A 4DSYA 3DSDA 3QG5C 1G5BA 2O8GA 1QFCA 1U32A 4MP0A 1MF8A 2HY1A 3IVEA 4KBPA 4FBWA 3E7BA 4MOVA 4G9JA 1S3LA 4O4KA 3THOB 1S3NA 1S70A 2CV9A 1KBPA 2YVTA 1USHA 3C9FA 5J28A 2NYLC 1S8EA 4IL1A 4OR9A 2KKNA 2DXLA 3E7AA 5INBA 3H69A 4JA9A 5C1VA 3K7VC 5JPFA 3RQZA 1HP1A 1HPUA 3QFNA 4O43A 1WARA 3PSOA 4H1SA 3D03A 1Z2XA 2Q8UA 4FBKA 2GJUA 1XZWA 4YKEA 1WAO1 1FJMA 2NPPC 3H61A 4IYPC 4ORAA 3KBPA 5EQVA 3RL3A 3FGAC 3P71C 2BCDA 2WDDA 5DNYA 3THNA 5JPEA 1S95A 1V73A 3GVEA 3H62B 4ZVZA 4V0WA 3V4YA 4LACC 3IB7A 4FCXA 3ICFA 4UT3A 2BQ8X 2DXNA 4HD0A 4I5NC 3TGHA 3CK2A 3RL4A 3C5WC 3IVDA 1AUIA 5JJTA 1OIEA 2YEQA 2Z06A 3EGGA 1W24A 3T1IA 3LL8A 2A22A 2WDCA 4JA7A 2NXFA 4Q7FA 1UTEA 2ZBMA 3N5UA 3EGHA 4M0VA 3HVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNW A;  1S3M A;  1UF3 A;  2HYO A;  1M63 A;  2DFJ A;  2JOG A;  2WDE A;  4LU9 A;  4DT2 A;  4H2I A;  4V0V A;  4H1Y P;  4TUG A;  2IE4 C;  2R17 A;  4I5L C;  2XMO A;  2HYP A;  2Z72 A;  4ZX2 A;  4TUI A;  3K7W C;  3RL5 A;  5IOH A;  2Z1A A;  4H2F A;  4NZV A;  5F3W A;  3DW8 C;  2BDX A;  2QJC A;  5GTU A;  4B2O A;  5B8I A;  4LTY A;  1HO5 A;  3ZTV A;  1SU1 A;  3H60 A;  3QFM A;  3QFO A;  1OID A;  4ORB A;  4H2G A;  1XM7 A;  4F0Z A;  3DSC A;  1IT6 A;  3QFK A;  2QFP A;  3H66 A;  4O24 A;  2IE3 C;  4DHL A;  3JYF A;  3PSN A;  3H63 A;  3AUZ A;  1JK7 A;  2NYM C;  1OI8 A;  1T71 A;  2O8A A;  4UT2 A;  2WDF A;  2USH A;  4O5G A;  4KKZ A;  2QFR A;  3IB8 A;  2P6B A;  4H2B A;  4WWL A;  4XPN A;  4J6O A;  4V0X A;  1TCO A;  4UT3 B;  1QHW A;  1T70 A;  2AHD A;  3H67 A;  4ORC A;  5HPE A;  3AV0 A;  1II7 A;  1Z2W A;  4UWQ A;  3ZU0 A;  3H68 A;  4FBQ A;  4MOY A;  2IAE C;  3H64 A;  4DSY A;  3DSD A;  3QG5 C;  1G5B A;  2O8G A;  1QFC A;  1U32 A;  4MP0 A;  1MF8 A;  2HY1 A;  3IVE A;  4KBP A;  4FBW A;  3E7B A;  4MOV A;  4G9J A;  1S3L A;  4O4K A;  3THO B;  1S3N A;  1S70 A;  2CV9 A;  1KBP A;  2YVT A;  1USH A;  3C9F A;  5J28 A;  2NYL C;  1S8E A;  4IL1 A;  4OR9 A;  2KKN A;  3E7A A;  5INB A;  3H69 A;  4JA9 A;  5C1V A;  3K7V C;  5JPF A;  3RQZ A;  1HP1 A;  1HPU A;  3QFN A;  4O43 A;  1WAR A;  3PSO A;  4H1S A;  1Z2X A;  2Q8U A;  4FBK A;  2GJU A;  1XZW A;  4YKE A;  1WAO 1;  1FJM A;  2NPP C;  3H61 A;  4IYP C;  4ORA A;  3KBP A;  5EQV A;  3RL3 A;  3FGA C;  3P71 C;  2BCD A;  2WDD A;  5DNY A;  3THN A;  5JPE A;  1S95 A;  1V73 A;  3GVE A;  3H62 B;  4ZVZ A;  4V0W A;  3V4Y A;  4LAC C;  3IB7 A;  4FCX A;  3ICF A;  4UT3 A;  2BQ8 X;  4HD0 A;  4I5N C;  3TGH A;  3CK2 A;  3RL4 A;  3C5W C;  3IVD A;  1AUI A;  5JJT A;  1OIE A;  2Z06 A;  3EGG A;  1W24 A;  3T1I A;  3LL8 A;  2A22 A;  2WDC A;  4JA7 A;  2NXF A;  4Q7F A;  1UTE A;  2ZBM A;  3N5U A;  3EGH A;  4M0V A;  3HVQ A; 
#chains in the Genus database with same CATH topology
 2ZO9 B;  1NNW A;  1S3M A;  1UF3 A;  2HYO A;  1M63 A;  2DFJ A;  2JOG A;  2WDE A;  4LU9 A;  2ZOA A;  4DT2 A;  4H2I A;  4V0V A;  4H1Y P;  4TUG A;  2IE4 C;  2R17 A;  4I5L C;  2XMO A;  2HYP A;  2Z72 A;  4ZX2 A;  4TUI A;  3K7W C;  3RL5 A;  5IOH A;  2Z1A A;  4H2F A;  4NZV A;  5F3W A;  3DW8 C;  2BDX A;  2QJC A;  5GTU A;  4B2O A;  5B8I A;  4LTY A;  1HO5 A;  3ZTV A;  1SU1 A;  3H60 A;  3QFM A;  3QFO A;  1OID A;  4ORB A;  4H2G A;  1XM7 A;  4F0Z A;  3DSC A;  1IT6 A;  3QFK A;  2QFP A;  3H66 A;  4O24 A;  2IE3 C;  4DHL A;  3JYF A;  3PSN A;  3H63 A;  3AUZ A;  1JK7 A;  2NYM C;  1OI8 A;  1T71 A;  2O8A A;  4UT2 A;  2WDF A;  2USH A;  4O5G A;  4KKZ A;  2QFR A;  3IB8 A;  2P6B A;  4H2B A;  4WWL A;  3FLO A;  4XPN A;  4J6O A;  4V0X A;  1TCO A;  4UT3 B;  1QHW A;  1T70 A;  2AHD A;  3H67 A;  3E0J A;  4ORC A;  5HPE A;  3AV0 A;  1II7 A;  1Z2W A;  4UWQ A;  3ZU0 A;  3H68 A;  4FBQ A;  4MOY A;  2IAE C;  3H64 A;  4DSY A;  3DSD A;  3QG5 C;  1G5B A;  2O8G A;  1QFC A;  1U32 A;  4MP0 A;  1MF8 A;  2HY1 A;  3IVE A;  4KBP A;  4FBW A;  3E7B A;  4MOV A;  4G9J A;  1S3L A;  4O4K A;  3THO B;  1S3N A;  1S70 A;  2CV9 A;  1KBP A;  2YVT A;  1USH A;  3C9F A;  5J28 A;  2NYL C;  1S8E A;  4IL1 A;  4OR9 A;  2KKN A;  2DXL A;  3E7A A;  5INB A;  3H69 A;  4JA9 A;  5C1V A;  3K7V C;  5JPF A;  3RQZ A;  1HP1 A;  1HPU A;  3QFN A;  4O43 A;  1WAR A;  3PSO A;  4H1S A;  3D03 A;  1Z2X A;  2Q8U A;  4FBK A;  2GJU A;  1XZW A;  4YKE A;  1WAO 1;  1FJM A;  2NPP C;  3H61 A;  4IYP C;  4ORA A;  3KBP A;  5EQV A;  3RL3 A;  3FGA C;  3P71 C;  2BCD A;  2WDD A;  5DNY A;  3THN A;  5JPE A;  1S95 A;  1V73 A;  3GVE A;  3H62 B;  4ZVZ A;  4V0W A;  3V4Y A;  4LAC C;  3IB7 A;  4FCX A;  3ICF A;  4UT3 A;  2BQ8 X;  2DXN A;  4HD0 A;  4I5N C;  3TGH A;  3CK2 A;  3RL4 A;  3C5W C;  3IVD A;  1AUI A;  5JJT A;  1OIE A;  2YEQ A;  2Z06 A;  3EGG A;  1W24 A;  3T1I A;  3LL8 A;  2A22 A;  2WDC A;  4JA7 A;  2NXF A;  4Q7F A;  1UTE A;  2ZBM A;  3N5U A;  3EGH A;  4M0V A;  3HVQ A; 
#chains in the Genus database with same CATH homology
 2ZO9 B;  1NNW A;  1S3M A;  1UF3 A;  2HYO A;  1M63 A;  2DFJ A;  2JOG A;  2WDE A;  4LU9 A;  2ZOA A;  4DT2 A;  4H2I A;  4V0V A;  4H1Y P;  4TUG A;  2IE4 C;  2R17 A;  4I5L C;  2XMO A;  2HYP A;  2Z72 A;  4ZX2 A;  4TUI A;  3K7W C;  3RL5 A;  5IOH A;  2Z1A A;  4H2F A;  4NZV A;  5F3W A;  3DW8 C;  2BDX A;  2QJC A;  5GTU A;  4B2O A;  5B8I A;  4LTY A;  1HO5 A;  3ZTV A;  1SU1 A;  3H60 A;  3QFM A;  3QFO A;  1OID A;  4ORB A;  4H2G A;  1XM7 A;  4F0Z A;  3DSC A;  1IT6 A;  3QFK A;  2QFP A;  3H66 A;  4O24 A;  2IE3 C;  4DHL A;  3JYF A;  3PSN A;  3H63 A;  3AUZ A;  1JK7 A;  2NYM C;  1OI8 A;  1T71 A;  2O8A A;  4UT2 A;  2WDF A;  2USH A;  4O5G A;  4KKZ A;  2QFR A;  3IB8 A;  2P6B A;  4H2B A;  4WWL A;  3FLO A;  4XPN A;  4J6O A;  4V0X A;  1TCO A;  4UT3 B;  1QHW A;  1T70 A;  2AHD A;  3H67 A;  3E0J A;  4ORC A;  5HPE A;  3AV0 A;  1II7 A;  1Z2W A;  4UWQ A;  3ZU0 A;  3H68 A;  4FBQ A;  4MOY A;  2IAE C;  3H64 A;  4DSY A;  3DSD A;  3QG5 C;  1G5B A;  2O8G A;  1QFC A;  1U32 A;  4MP0 A;  1MF8 A;  2HY1 A;  3IVE A;  4KBP A;  4FBW A;  3E7B A;  4MOV A;  4G9J A;  1S3L A;  4O4K A;  3THO B;  1S3N A;  1S70 A;  2CV9 A;  1KBP A;  2YVT A;  1USH A;  3C9F A;  5J28 A;  2NYL C;  1S8E A;  4IL1 A;  4OR9 A;  2KKN A;  2DXL A;  3E7A A;  5INB A;  3H69 A;  4JA9 A;  5C1V A;  3K7V C;  5JPF A;  3RQZ A;  1HP1 A;  1HPU A;  3QFN A;  4O43 A;  1WAR A;  3PSO A;  4H1S A;  3D03 A;  1Z2X A;  2Q8U A;  4FBK A;  2GJU A;  1XZW A;  4YKE A;  1WAO 1;  1FJM A;  2NPP C;  3H61 A;  4IYP C;  4ORA A;  3KBP A;  5EQV A;  3RL3 A;  3FGA C;  3P71 C;  2BCD A;  2WDD A;  5DNY A;  3THN A;  5JPE A;  1S95 A;  1V73 A;  3GVE A;  3H62 B;  4ZVZ A;  4V0W A;  3V4Y A;  4LAC C;  3IB7 A;  4FCX A;  3ICF A;  4UT3 A;  2BQ8 X;  2DXN A;  4HD0 A;  4I5N C;  3TGH A;  3CK2 A;  3RL4 A;  3C5W C;  3IVD A;  1AUI A;  5JJT A;  1OIE A;  2YEQ A;  2Z06 A;  3EGG A;  1W24 A;  3T1I A;  3LL8 A;  2A22 A;  2WDC A;  4JA7 A;  2NXF A;  4Q7F A;  1UTE A;  2ZBM A;  3N5U A;  3EGH A;  4M0V A;  3HVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...