2DFJA

Crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
267
structure length
267
Chain Sequence
b'ATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRRQPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNWSPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYSIAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the diadenosine tetraphosphate hydrolase from Shigella flexneri 2a
pubmed doi rcsb
molecule keywords diadenosinetetraphosphatase
source organism Shigella flexneri 2a
molecule tags Hydrolase
total genus 74
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.6.1.41: Bis(5'-nucleosyl)-tetraphosphatase (symmetrical).
pdb deposition date 2006-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2dfjA00
4H2IA 1UF3A 3H67A 4HD0A 2JOGA 3K7VC 1OIEA 5F3WA 2WDFA 4XPNA 2CV9A 1XZWA 2NYLC 4V0VA 4ZVZA 3E7BA 3H62B 2Z06A 3QFOA 2ZBMA 3ICFA 2IE4C 2O8GA 1S95A 3H68A 3V4YA 1Z2WA 1KBPA 4UT3A 1T71A 5HPEA 3T1IA 4DHLA 4NZVA 4KKZA 3H61A 3RQZA 1JK7A 3H60A 4LACC 1S70A 5IOHA 1G5BA 1U32A 2Q8UA 3AUZA 3DSCA 2QJCA 3THNA 4V0WA 4MOYA 2Z1AA 3DW8C 4ZX2A 4ORCA 2USHA 3K7WC 1T70A 3LL8A 3QFMA 5JPFA 2IE3C 3GVEA 4IL1A 4V0XA 1OIDA 1SU1A 4UWQA 2KKNA 3N5UA 3HVQA 4JA7A 3PSNA 1IT6A 2A22A 3EGGA 1WARA 3IB7A 2QFRA 5C1VA 2WDDA 4F0ZA 1QFCA 2HYOA 2Z72A 2NYMC 3RL3A 2GJUA 4H2FA 3EGHA 4B2OA 2WDCA 4MP0A 1Z2XA 5INBA 3H64A 1HP1A 4H1YP 1USHA 4FCXA 2R17A 1S3MA 4WWLA 4DT2A 5J28A 1WAO1 2IAEC 5GTUA 4TUGA 2BQ8X 2O8AA 4UT2A 1HPUA 1FJMA 1NNWA 5JPEA 4ORBA 4JA9A 3P71C 1OI8A 4OR9A 4KBPA 5JJTA 3IVDA 3RL5A 4FBKA 4TUIA 4J6OA 3AV0A 4H2GA 1V73A 3C5WC 3JYFA 4YKEA 3ZU0A 3KBPA 3C9FA 4G9JA 4LU9A 2HY1A 1TCOA 4O43A 2BCDA 2BDXA 3IB8A 4IYPC 4Q7FA 4FBQA 1S3LA 2QFPA 2DFJA 4DSYA 4O24A 5DNYA 3H69A 1M63A 3DSDA 1XM7A 1W24A 1AUIA 3QFNA 4O4KA 2P6BA 3H63A 4H1SA 1QHWA 5B8IA 1S8EA 1S3NA 3CK2A 4ORAA 3H66A 2AHDA 3ZTVA 2NXFA 1HO5A 4I5NC 3IVEA 1MF8A 4LTYA 4UT3B 4O5GA 2WDEA 2YVTA 3QG5C 3TGHA 4MOVA 1UTEA 2XMOA 3PSOA 4H2BA 4M0VA 3RL4A 5EQVA 1II7A 2NPPC 3THOB 2HYPA 4FBWA 4I5LC 3QFKA 3FGAC 3E7AA
chains in the Genus database with same CATH superfamily
4H2IA 1UF3A 2ZOAA 3H67A 2JOGA 3K7VC 1OIEA 4HD0A 5F3WA 2WDFA 4XPNA 2CV9A 1XZWA 2NYLC 4V0VA 2YEQA 4ZVZA 3E7BA 3H62B 2Z06A 3QFOA 2ZBMA 3ICFA 2DXLA 2IE4C 2O8GA 1S95A 3H68A 3V4YA 1Z2WA 1KBPA 4UT3A 1T71A 5HPEA 3T1IA 4DHLA 4NZVA 3E0JA 4KKZA 3H61A 3RQZA 1JK7A 3H60A 4LACC 1S70A 5IOHA 1G5BA 1U32A 2Q8UA 3AUZA 3DSCA 2QJCA 3THNA 4V0WA 2ZO9B 4MOYA 2Z1AA 3DW8C 4ZX2A 4ORCA 2USHA 3K7WC 1T70A 3LL8A 3QFMA 5JPFA 2IE3C 3GVEA 4IL1A 4V0XA 1OIDA 1SU1A 4UWQA 2KKNA 3N5UA 3HVQA 4JA7A 3PSNA 1IT6A 2A22A 3EGGA 1WARA 3IB7A 2QFRA 5C1VA 2WDDA 4F0ZA 1QFCA 2HYOA 2Z72A 2NYMC 3RL3A 2GJUA 4H2FA 3EGHA 4B2OA 2WDCA 4MP0A 1Z2XA 5INBA 3H64A 1HP1A 4H1YP 1USHA 4FCXA 2R17A 1S3MA 4WWLA 4DT2A 5J28A 1WAO1 2IAEC 5GTUA 4TUGA 2BQ8X 2O8AA 4UT2A 1HPUA 1FJMA 1NNWA 5JPEA 4ORBA 4JA9A 3P71C 1OI8A 4OR9A 4KBPA 5JJTA 3IVDA 3RL5A 4FBKA 4TUIA 4J6OA 3AV0A 4H2GA 1V73A 3C5WC 3JYFA 4YKEA 3ZU0A 3KBPA 3C9FA 4G9JA 4LU9A 2HY1A 1TCOA 4O43A 2BCDA 2BDXA 3IB8A 4IYPC 3D03A 4FBQA 4Q7FA 1S3LA 2QFPA 2DFJA 4DSYA 3FLOA 4O24A 5DNYA 3H69A 1M63A 3DSDA 1XM7A 1W24A 1AUIA 3QFNA 4O4KA 2P6BA 3H63A 4H1SA 1QHWA 5B8IA 1S8EA 1S3NA 3CK2A 4ORAA 3H66A 2AHDA 3ZTVA 2NXFA 1HO5A 4I5NC 3IVEA 1MF8A 4LTYA 4UT3B 4O5GA 2WDEA 2YVTA 3QG5C 3TGHA 4MOVA 1UTEA 2XMOA 3PSOA 4H2BA 4M0VA 3RL4A 5EQVA 1II7A 2NPPC 3THOB 2HYPA 4FBWA 2DXNA 4I5LC 3QFKA 3FGAC 3E7AA
chains in the Genus database with same CATH topology
4H2IA 1UF3A 2ZOAA 3H67A 2JOGA 3K7VC 1OIEA 4HD0A 5F3WA 2WDFA 4XPNA 2CV9A 1XZWA 2NYLC 4V0VA 2YEQA 4ZVZA 3E7BA 3H62B 2Z06A 3QFOA 2ZBMA 3ICFA 2DXLA 2IE4C 2O8GA 1S95A 3H68A 3V4YA 1Z2WA 1KBPA 4UT3A 1T71A 5HPEA 3T1IA 4DHLA 4NZVA 3E0JA 4KKZA 3H61A 3RQZA 1JK7A 3H60A 4LACC 1S70A 5IOHA 1G5BA 1U32A 2Q8UA 3AUZA 3DSCA 2QJCA 3THNA 4V0WA 2ZO9B 4MOYA 2Z1AA 3DW8C 4ZX2A 4ORCA 2USHA 3K7WC 1T70A 3LL8A 3QFMA 5JPFA 2IE3C 3GVEA 4IL1A 4V0XA 1OIDA 1SU1A 4UWQA 2KKNA 3N5UA 3HVQA 4JA7A 3PSNA 1IT6A 2A22A 3EGGA 1WARA 3IB7A 2QFRA 5C1VA 2WDDA 4F0ZA 1QFCA 2HYOA 2Z72A 2NYMC 3RL3A 2GJUA 4H2FA 3EGHA 4B2OA 2WDCA 4MP0A 1Z2XA 5INBA 3H64A 1HP1A 4H1YP 1USHA 4FCXA 2R17A 1S3MA 4WWLA 4DT2A 5J28A 1WAO1 2IAEC 5GTUA 4TUGA 2BQ8X 2O8AA 4UT2A 1HPUA 1FJMA 1NNWA 5JPEA 4ORBA 4JA9A 3P71C 1OI8A 4OR9A 4KBPA 5JJTA 3IVDA 3RL5A 4FBKA 4TUIA 4J6OA 3AV0A 4H2GA 1V73A 3C5WC 3JYFA 4YKEA 3ZU0A 3KBPA 3C9FA 4G9JA 4LU9A 2HY1A 1TCOA 4O43A 2BCDA 2BDXA 3IB8A 4IYPC 3D03A 4FBQA 4Q7FA 1S3LA 2QFPA 2DFJA 4DSYA 3FLOA 4O24A 5DNYA 3H69A 1M63A 3DSDA 1XM7A 1W24A 1AUIA 3QFNA 4O4KA 2P6BA 3H63A 4H1SA 1QHWA 5B8IA 1S8EA 1S3NA 3CK2A 4ORAA 3H66A 2AHDA 3ZTVA 2NXFA 1HO5A 4I5NC 3IVEA 1MF8A 4LTYA 4UT3B 4O5GA 2WDEA 2YVTA 3QG5C 3TGHA 4MOVA 1UTEA 2XMOA 3PSOA 4H2BA 4M0VA 3RL4A 5EQVA 1II7A 2NPPC 3THOB 2HYPA 4FBWA 2DXNA 4I5LC 3QFKA 3FGAC 3E7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2I A;  1UF3 A;  3H67 A;  4HD0 A;  2JOG A;  3K7V C;  1OIE A;  5F3W A;  2WDF A;  4XPN A;  2CV9 A;  1XZW A;  2NYL C;  4V0V A;  4ZVZ A;  3E7B A;  3H62 B;  2Z06 A;  3QFO A;  2ZBM A;  3ICF A;  2IE4 C;  2O8G A;  1S95 A;  3H68 A;  3V4Y A;  1Z2W A;  1KBP A;  4UT3 A;  1T71 A;  5HPE A;  3T1I A;  4DHL A;  4NZV A;  4KKZ A;  3H61 A;  3RQZ A;  1JK7 A;  3H60 A;  4LAC C;  1S70 A;  5IOH A;  1G5B A;  1U32 A;  2Q8U A;  3AUZ A;  3DSC A;  2QJC A;  3THN A;  4V0W A;  4MOY A;  2Z1A A;  3DW8 C;  4ZX2 A;  4ORC A;  2USH A;  3K7W C;  1T70 A;  3LL8 A;  3QFM A;  5JPF A;  2IE3 C;  3GVE A;  4IL1 A;  4V0X A;  1OID A;  1SU1 A;  4UWQ A;  2KKN A;  3N5U A;  3HVQ A;  4JA7 A;  3PSN A;  1IT6 A;  2A22 A;  3EGG A;  1WAR A;  3IB7 A;  2QFR A;  5C1V A;  2WDD A;  4F0Z A;  1QFC A;  2HYO A;  2Z72 A;  2NYM C;  3RL3 A;  2GJU A;  4H2F A;  3EGH A;  4B2O A;  2WDC A;  4MP0 A;  1Z2X A;  5INB A;  3H64 A;  1HP1 A;  4H1Y P;  1USH A;  4FCX A;  2R17 A;  1S3M A;  4WWL A;  4DT2 A;  5J28 A;  1WAO 1;  2IAE C;  5GTU A;  4TUG A;  2BQ8 X;  2O8A A;  4UT2 A;  1HPU A;  1FJM A;  1NNW A;  5JPE A;  4ORB A;  4JA9 A;  3P71 C;  1OI8 A;  4OR9 A;  4KBP A;  5JJT A;  3IVD A;  3RL5 A;  4FBK A;  4TUI A;  4J6O A;  3AV0 A;  4H2G A;  1V73 A;  3C5W C;  3JYF A;  4YKE A;  3ZU0 A;  3KBP A;  3C9F A;  4G9J A;  4LU9 A;  2HY1 A;  1TCO A;  4O43 A;  2BCD A;  2BDX A;  3IB8 A;  4IYP C;  4Q7F A;  4FBQ A;  1S3L A;  2QFP A;  2DFJ A;  4DSY A;  4O24 A;  5DNY A;  3H69 A;  1M63 A;  3DSD A;  1XM7 A;  1W24 A;  1AUI A;  3QFN A;  4O4K A;  2P6B A;  3H63 A;  4H1S A;  1QHW A;  5B8I A;  1S8E A;  1S3N A;  3CK2 A;  4ORA A;  3H66 A;  2AHD A;  3ZTV A;  2NXF A;  1HO5 A;  4I5N C;  3IVE A;  1MF8 A;  4LTY A;  4UT3 B;  4O5G A;  2WDE A;  2YVT A;  3QG5 C;  3TGH A;  4MOV A;  1UTE A;  2XMO A;  3PSO A;  4H2B A;  4M0V A;  3RL4 A;  5EQV A;  1II7 A;  2NPP C;  3THO B;  2HYP A;  4FBW A;  4I5L C;  3QFK A;  3FGA C;  3E7A A; 
#chains in the Genus database with same CATH topology
 4H2I A;  1UF3 A;  2ZOA A;  3H67 A;  2JOG A;  3K7V C;  1OIE A;  4HD0 A;  5F3W A;  2WDF A;  4XPN A;  2CV9 A;  1XZW A;  2NYL C;  4V0V A;  2YEQ A;  4ZVZ A;  3E7B A;  3H62 B;  2Z06 A;  3QFO A;  2ZBM A;  3ICF A;  2DXL A;  2IE4 C;  2O8G A;  1S95 A;  3H68 A;  3V4Y A;  1Z2W A;  1KBP A;  4UT3 A;  1T71 A;  5HPE A;  3T1I A;  4DHL A;  4NZV A;  3E0J A;  4KKZ A;  3H61 A;  3RQZ A;  1JK7 A;  3H60 A;  4LAC C;  1S70 A;  5IOH A;  1G5B A;  1U32 A;  2Q8U A;  3AUZ A;  3DSC A;  2QJC A;  3THN A;  4V0W A;  2ZO9 B;  4MOY A;  2Z1A A;  3DW8 C;  4ZX2 A;  4ORC A;  2USH A;  3K7W C;  1T70 A;  3LL8 A;  3QFM A;  5JPF A;  2IE3 C;  3GVE A;  4IL1 A;  4V0X A;  1OID A;  1SU1 A;  4UWQ A;  2KKN A;  3N5U A;  3HVQ A;  4JA7 A;  3PSN A;  1IT6 A;  2A22 A;  3EGG A;  1WAR A;  3IB7 A;  2QFR A;  5C1V A;  2WDD A;  4F0Z A;  1QFC A;  2HYO A;  2Z72 A;  2NYM C;  3RL3 A;  2GJU A;  4H2F A;  3EGH A;  4B2O A;  2WDC A;  4MP0 A;  1Z2X A;  5INB A;  3H64 A;  1HP1 A;  4H1Y P;  1USH A;  4FCX A;  2R17 A;  1S3M A;  4WWL A;  4DT2 A;  5J28 A;  1WAO 1;  2IAE C;  5GTU A;  4TUG A;  2BQ8 X;  2O8A A;  4UT2 A;  1HPU A;  1FJM A;  1NNW A;  5JPE A;  4ORB A;  4JA9 A;  3P71 C;  1OI8 A;  4OR9 A;  4KBP A;  5JJT A;  3IVD A;  3RL5 A;  4FBK A;  4TUI A;  4J6O A;  3AV0 A;  4H2G A;  1V73 A;  3C5W C;  3JYF A;  4YKE A;  3ZU0 A;  3KBP A;  3C9F A;  4G9J A;  4LU9 A;  2HY1 A;  1TCO A;  4O43 A;  2BCD A;  2BDX A;  3IB8 A;  4IYP C;  3D03 A;  4FBQ A;  4Q7F A;  1S3L A;  2QFP A;  2DFJ A;  4DSY A;  3FLO A;  4O24 A;  5DNY A;  3H69 A;  1M63 A;  3DSD A;  1XM7 A;  1W24 A;  1AUI A;  3QFN A;  4O4K A;  2P6B A;  3H63 A;  4H1S A;  1QHW A;  5B8I A;  1S8E A;  1S3N A;  3CK2 A;  4ORA A;  3H66 A;  2AHD A;  3ZTV A;  2NXF A;  1HO5 A;  4I5N C;  3IVE A;  1MF8 A;  4LTY A;  4UT3 B;  4O5G A;  2WDE A;  2YVT A;  3QG5 C;  3TGH A;  4MOV A;  1UTE A;  2XMO A;  3PSO A;  4H2B A;  4M0V A;  3RL4 A;  5EQV A;  1II7 A;  2NPP C;  3THO B;  2HYP A;  4FBW A;  2DXN A;  4I5L C;  3QFK A;  3FGA C;  3E7A A; 
#chains in the Genus database with same CATH homology
 4H2I A;  1UF3 A;  2ZOA A;  3H67 A;  2JOG A;  3K7V C;  1OIE A;  4HD0 A;  5F3W A;  2WDF A;  4XPN A;  2CV9 A;  1XZW A;  2NYL C;  4V0V A;  2YEQ A;  4ZVZ A;  3E7B A;  3H62 B;  2Z06 A;  3QFO A;  2ZBM A;  3ICF A;  2DXL A;  2IE4 C;  2O8G A;  1S95 A;  3H68 A;  3V4Y A;  1Z2W A;  1KBP A;  4UT3 A;  1T71 A;  5HPE A;  3T1I A;  4DHL A;  4NZV A;  3E0J A;  4KKZ A;  3H61 A;  3RQZ A;  1JK7 A;  3H60 A;  4LAC C;  1S70 A;  5IOH A;  1G5B A;  1U32 A;  2Q8U A;  3AUZ A;  3DSC A;  2QJC A;  3THN A;  4V0W A;  2ZO9 B;  4MOY A;  2Z1A A;  3DW8 C;  4ZX2 A;  4ORC A;  2USH A;  3K7W C;  1T70 A;  3LL8 A;  3QFM A;  5JPF A;  2IE3 C;  3GVE A;  4IL1 A;  4V0X A;  1OID A;  1SU1 A;  4UWQ A;  2KKN A;  3N5U A;  3HVQ A;  4JA7 A;  3PSN A;  1IT6 A;  2A22 A;  3EGG A;  1WAR A;  3IB7 A;  2QFR A;  5C1V A;  2WDD A;  4F0Z A;  1QFC A;  2HYO A;  2Z72 A;  2NYM C;  3RL3 A;  2GJU A;  4H2F A;  3EGH A;  4B2O A;  2WDC A;  4MP0 A;  1Z2X A;  5INB A;  3H64 A;  1HP1 A;  4H1Y P;  1USH A;  4FCX A;  2R17 A;  1S3M A;  4WWL A;  4DT2 A;  5J28 A;  1WAO 1;  2IAE C;  5GTU A;  4TUG A;  2BQ8 X;  2O8A A;  4UT2 A;  1HPU A;  1FJM A;  1NNW A;  5JPE A;  4ORB A;  4JA9 A;  3P71 C;  1OI8 A;  4OR9 A;  4KBP A;  5JJT A;  3IVD A;  3RL5 A;  4FBK A;  4TUI A;  4J6O A;  3AV0 A;  4H2G A;  1V73 A;  3C5W C;  3JYF A;  4YKE A;  3ZU0 A;  3KBP A;  3C9F A;  4G9J A;  4LU9 A;  2HY1 A;  1TCO A;  4O43 A;  2BCD A;  2BDX A;  3IB8 A;  4IYP C;  3D03 A;  4FBQ A;  4Q7F A;  1S3L A;  2QFP A;  2DFJ A;  4DSY A;  3FLO A;  4O24 A;  5DNY A;  3H69 A;  1M63 A;  3DSD A;  1XM7 A;  1W24 A;  1AUI A;  3QFN A;  4O4K A;  2P6B A;  3H63 A;  4H1S A;  1QHW A;  5B8I A;  1S8E A;  1S3N A;  3CK2 A;  4ORA A;  3H66 A;  2AHD A;  3ZTV A;  2NXF A;  1HO5 A;  4I5N C;  3IVE A;  1MF8 A;  4LTY A;  4UT3 B;  4O5G A;  2WDE A;  2YVT A;  3QG5 C;  3TGH A;  4MOV A;  1UTE A;  2XMO A;  3PSO A;  4H2B A;  4M0V A;  3RL4 A;  5EQV A;  1II7 A;  2NPP C;  3THO B;  2HYP A;  4FBW A;  2DXN A;  4I5L C;  3QFK A;  3FGA C;  3E7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...