2DFJA

Crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
267
structure length
267
Chain Sequence
ATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRRQPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNWSPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYSIAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diadenosinetetraphosphatase
publication title Crystal structure of the diadenosine tetraphosphate hydrolase from Shigella flexneri 2a
pubmed doi rcsb
source organism Shigella flexneri 2a
molecule tags Hydrolase
total genus 74
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.6.1.41: Bis(5'-nucleosyl)-tetraphosphatase (symmetrical).
pdb deposition date 2006-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2dfjA00
4IYPC 4ORCA 3C5WC 1JK7A 1M63A 4HD0A 1QFCA 4O5GA 3DSDA 2O8GA 4H2GA 4H1YP 1HPUA 1KBPA 5EQVA 4H2IA 5JPFA 1V73A 1QHWA 1XZWA 4YKEA 1NNWA 4LTYA 5INBA 3ZU0A 2NXFA 2IE4C 4I5LC 2Q8UA 4TUGA 1XM7A 3THOB 3EGHA 3H61A 4DT2A 3T1IA 3QG5C 1S3NA 3K7VC 4JA7A 3QFMA 3HVQA 1S3MA 3H62B 4ZX2A 5HPEA 2WDEA 5IOHA 2R17A 5GTUA 1HP1A 1Z2WA 3H60A 1S70A 3LL8A 4V0WA 3RL5A 3THNA 1UF3A 1T71A 2USHA 2Z72A 3AV0A 1Z2XA 1WARA 3PSNA 2WDDA 4FBWA 4V0XA 3ZTVA 3QFKA 4FBKA 4I5NC 2O8AA 2WDCA 3EGGA 5C1VA 2HYPA 3IB7A 1OIEA 5J28A 4B2OA 4H2BA 4O43A 3PSOA 4H2FA 5F3WA 4ORAA 4DSYA 2AHDA 3RL3A 1OI8A 4ZVZA 5JPEA 4XPNA 3IVDA 2HY1A 1U32A 4MOYA 2BDXA 3RQZA 1FJMA 4FBQA 1IT6A 2A22A 3QFOA 4UT3A 1S95A 2IE3C 5DNYA 3DSCA 2NPPC 3H66A 2CV9A 1T70A 2KKNA 4FCXA 3QFNA 3RL4A 4O4KA 2BCDA 2IAEC 2NYMC 4V0VA 2QFRA 3H69A 2Z06A 4M0VA 1II7A 2BQ8X 3IVEA 1USHA 3H63A 4IL1A 4UT2A 3FGAC 4OR9A 3IB8A 2NYLC 4H1SA 3E7BA 5B8IA 1UTEA 1W24A 4NZVA 3C9FA 1WAO1 4MOVA 2Z1AA 4O24A 2QFPA 4KBPA 3ICFA 3H64A 4MP0A 2HYOA 1S8EA 3AUZA 1G5BA 3H68A 4LU9A 4UT3B 3V4YA 3DW8C 3KBPA 1SU1A 3CK2A 3TGHA 3K7WC 3N5UA 2ZBMA 1HO5A 3E7AA 3H67A 4Q7FA 1TCOA 3P71C 2XMOA 4JA9A 4LACC 4F0ZA 5JJTA 4ORBA 4G9JA 4UWQA 1S3LA 3GVEA 2YVTA 3JYFA 4DHLA 2P6BA 4TUIA 4KKZA 2GJUA 2QJCA 4WWLA 4J6OA 1AUIA 1OIDA 2DFJA 2JOGA 2WDFA 1MF8A
chains in the Genus database with same CATH superfamily
4IYPC 4ORCA 3C5WC 1JK7A 1M63A 4HD0A 1QFCA 4O5GA 3DSDA 2O8GA 4H2GA 4H1YP 1HPUA 1KBPA 5EQVA 4H2IA 5JPFA 1V73A 1QHWA 1XZWA 4YKEA 1NNWA 4LTYA 5INBA 3ZU0A 2NXFA 2IE4C 4I5LC 2Q8UA 4TUGA 1XM7A 3THOB 3EGHA 3H61A 2DXNA 4DT2A 3T1IA 3QG5C 1S3NA 3K7VC 4JA7A 3QFMA 3HVQA 1S3MA 3H62B 4ZX2A 5HPEA 2WDEA 5IOHA 2R17A 5GTUA 1HP1A 1Z2WA 3H60A 3E0JA 1S70A 3LL8A 4V0WA 3RL5A 3THNA 1UF3A 1T71A 2USHA 2Z72A 3AV0A 1Z2XA 1WARA 3PSNA 2WDDA 4FBWA 3D03A 4V0XA 3ZTVA 3QFKA 4FBKA 4I5NC 2O8AA 2WDCA 3EGGA 5C1VA 2HYPA 3IB7A 1OIEA 5J28A 4B2OA 4H2BA 4O43A 3PSOA 4H2FA 5F3WA 4ORAA 4DSYA 2AHDA 3RL3A 1OI8A 4ZVZA 5JPEA 4XPNA 3IVDA 2DXLA 2HY1A 1U32A 4MOYA 2BDXA 3RQZA 1FJMA 4FBQA 1IT6A 2A22A 3QFOA 4UT3A 1S95A 2IE3C 5DNYA 3DSCA 2NPPC 3H66A 2CV9A 1T70A 2KKNA 4FCXA 3QFNA 3RL4A 4O4KA 2BCDA 2IAEC 2NYMC 4V0VA 2QFRA 3H69A 2YEQA 2Z06A 4M0VA 1II7A 2BQ8X 2ZO9B 1USHA 3H63A 3IVEA 4IL1A 4UT2A 3FGAC 4OR9A 3IB8A 2NYLC 4H1SA 3E7BA 5B8IA 1UTEA 1W24A 4NZVA 3C9FA 1WAO1 4MOVA 2Z1AA 4O24A 2QFPA 4KBPA 3ICFA 3H64A 4MP0A 2HYOA 1S8EA 3AUZA 1G5BA 3H68A 4LU9A 4UT3B 3V4YA 3DW8C 3KBPA 1SU1A 3CK2A 3FLOA 3TGHA 3K7WC 3N5UA 2ZBMA 1HO5A 3E7AA 3H67A 4Q7FA 2ZOAA 1TCOA 3P71C 2XMOA 4JA9A 4LACC 4F0ZA 5JJTA 4ORBA 4G9JA 4UWQA 1S3LA 3GVEA 2YVTA 3JYFA 4DHLA 2P6BA 4TUIA 4KKZA 2GJUA 2QJCA 4WWLA 4J6OA 1AUIA 1OIDA 2DFJA 2JOGA 2WDFA 1MF8A
chains in the Genus database with same CATH topology
4IYPC 4ORCA 3C5WC 1JK7A 1M63A 4HD0A 1QFCA 4O5GA 3DSDA 2O8GA 4H2GA 4H1YP 1HPUA 1KBPA 5EQVA 4H2IA 5JPFA 1V73A 1QHWA 1XZWA 4YKEA 1NNWA 4LTYA 5INBA 3ZU0A 2NXFA 2IE4C 4I5LC 2Q8UA 4TUGA 1XM7A 3THOB 3EGHA 3H61A 2DXNA 4DT2A 3T1IA 3QG5C 1S3NA 3K7VC 4JA7A 3QFMA 3HVQA 1S3MA 3H62B 4ZX2A 5HPEA 2WDEA 5IOHA 2R17A 5GTUA 1HP1A 1Z2WA 3H60A 3E0JA 1S70A 3LL8A 4V0WA 3RL5A 3THNA 1UF3A 1T71A 2USHA 2Z72A 3AV0A 1Z2XA 1WARA 3PSNA 2WDDA 4FBWA 3D03A 4V0XA 3ZTVA 3QFKA 4FBKA 4I5NC 2O8AA 2WDCA 3EGGA 5C1VA 2HYPA 3IB7A 1OIEA 5J28A 4B2OA 4H2BA 4O43A 3PSOA 4H2FA 5F3WA 4ORAA 4DSYA 2AHDA 3RL3A 1OI8A 4ZVZA 5JPEA 4XPNA 3IVDA 2DXLA 2HY1A 1U32A 4MOYA 2BDXA 3RQZA 1FJMA 4FBQA 1IT6A 2A22A 3QFOA 4UT3A 1S95A 2IE3C 5DNYA 3DSCA 2NPPC 3H66A 2CV9A 1T70A 2KKNA 4FCXA 3QFNA 3RL4A 4O4KA 2BCDA 2IAEC 2NYMC 4V0VA 2QFRA 3H69A 2YEQA 2Z06A 4M0VA 1II7A 2BQ8X 2ZO9B 1USHA 3H63A 3IVEA 4IL1A 4UT2A 3FGAC 4OR9A 3IB8A 2NYLC 4H1SA 3E7BA 5B8IA 1UTEA 1W24A 4NZVA 3C9FA 1WAO1 4MOVA 2Z1AA 4O24A 2QFPA 4KBPA 3ICFA 3H64A 4MP0A 2HYOA 1S8EA 3AUZA 1G5BA 3H68A 4LU9A 4UT3B 3V4YA 3DW8C 3KBPA 1SU1A 3CK2A 3FLOA 3TGHA 3K7WC 3N5UA 2ZBMA 1HO5A 3E7AA 3H67A 4Q7FA 2ZOAA 1TCOA 3P71C 2XMOA 4JA9A 4LACC 4F0ZA 5JJTA 4ORBA 4G9JA 4UWQA 1S3LA 3GVEA 2YVTA 3JYFA 4DHLA 2P6BA 4TUIA 4KKZA 2GJUA 2QJCA 4WWLA 4J6OA 1AUIA 1OIDA 2DFJA 2JOGA 2WDFA 1MF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYP C;  4ORC A;  3C5W C;  1JK7 A;  1M63 A;  4HD0 A;  1QFC A;  4O5G A;  3DSD A;  2O8G A;  4H2G A;  4H1Y P;  1HPU A;  1KBP A;  5EQV A;  4H2I A;  5JPF A;  1V73 A;  1QHW A;  1XZW A;  4YKE A;  1NNW A;  4LTY A;  5INB A;  3ZU0 A;  2NXF A;  2IE4 C;  4I5L C;  2Q8U A;  4TUG A;  1XM7 A;  3THO B;  3EGH A;  3H61 A;  4DT2 A;  3T1I A;  3QG5 C;  1S3N A;  3K7V C;  4JA7 A;  3QFM A;  3HVQ A;  1S3M A;  3H62 B;  4ZX2 A;  5HPE A;  2WDE A;  5IOH A;  2R17 A;  5GTU A;  1HP1 A;  1Z2W A;  3H60 A;  1S70 A;  3LL8 A;  4V0W A;  3RL5 A;  3THN A;  1UF3 A;  1T71 A;  2USH A;  2Z72 A;  3AV0 A;  1Z2X A;  1WAR A;  3PSN A;  2WDD A;  4FBW A;  4V0X A;  3ZTV A;  3QFK A;  4FBK A;  4I5N C;  2O8A A;  2WDC A;  3EGG A;  5C1V A;  2HYP A;  3IB7 A;  1OIE A;  5J28 A;  4B2O A;  4H2B A;  4O43 A;  3PSO A;  4H2F A;  5F3W A;  4ORA A;  4DSY A;  2AHD A;  3RL3 A;  1OI8 A;  4ZVZ A;  5JPE A;  4XPN A;  3IVD A;  2HY1 A;  1U32 A;  4MOY A;  2BDX A;  3RQZ A;  1FJM A;  4FBQ A;  1IT6 A;  2A22 A;  3QFO A;  4UT3 A;  1S95 A;  2IE3 C;  5DNY A;  3DSC A;  2NPP C;  3H66 A;  2CV9 A;  1T70 A;  2KKN A;  4FCX A;  3QFN A;  3RL4 A;  4O4K A;  2BCD A;  2IAE C;  2NYM C;  4V0V A;  2QFR A;  3H69 A;  2Z06 A;  4M0V A;  1II7 A;  2BQ8 X;  3IVE A;  1USH A;  3H63 A;  4IL1 A;  4UT2 A;  3FGA C;  4OR9 A;  3IB8 A;  2NYL C;  4H1S A;  3E7B A;  5B8I A;  1UTE A;  1W24 A;  4NZV A;  3C9F A;  1WAO 1;  4MOV A;  2Z1A A;  4O24 A;  2QFP A;  4KBP A;  3ICF A;  3H64 A;  4MP0 A;  2HYO A;  1S8E A;  3AUZ A;  1G5B A;  3H68 A;  4LU9 A;  4UT3 B;  3V4Y A;  3DW8 C;  3KBP A;  1SU1 A;  3CK2 A;  3TGH A;  3K7W C;  3N5U A;  2ZBM A;  1HO5 A;  3E7A A;  3H67 A;  4Q7F A;  1TCO A;  3P71 C;  2XMO A;  4JA9 A;  4LAC C;  4F0Z A;  5JJT A;  4ORB A;  4G9J A;  4UWQ A;  1S3L A;  3GVE A;  2YVT A;  3JYF A;  4DHL A;  2P6B A;  4TUI A;  4KKZ A;  2GJU A;  2QJC A;  4WWL A;  4J6O A;  1AUI A;  1OID A;  2DFJ A;  2JOG A;  2WDF A;  1MF8 A; 
#chains in the Genus database with same CATH topology
 4IYP C;  4ORC A;  3C5W C;  1JK7 A;  1M63 A;  4HD0 A;  1QFC A;  4O5G A;  3DSD A;  2O8G A;  4H2G A;  4H1Y P;  1HPU A;  1KBP A;  5EQV A;  4H2I A;  5JPF A;  1V73 A;  1QHW A;  1XZW A;  4YKE A;  1NNW A;  4LTY A;  5INB A;  3ZU0 A;  2NXF A;  2IE4 C;  4I5L C;  2Q8U A;  4TUG A;  1XM7 A;  3THO B;  3EGH A;  3H61 A;  2DXN A;  4DT2 A;  3T1I A;  3QG5 C;  1S3N A;  3K7V C;  4JA7 A;  3QFM A;  3HVQ A;  1S3M A;  3H62 B;  4ZX2 A;  5HPE A;  2WDE A;  5IOH A;  2R17 A;  5GTU A;  1HP1 A;  1Z2W A;  3H60 A;  3E0J A;  1S70 A;  3LL8 A;  4V0W A;  3RL5 A;  3THN A;  1UF3 A;  1T71 A;  2USH A;  2Z72 A;  3AV0 A;  1Z2X A;  1WAR A;  3PSN A;  2WDD A;  4FBW A;  3D03 A;  4V0X A;  3ZTV A;  3QFK A;  4FBK A;  4I5N C;  2O8A A;  2WDC A;  3EGG A;  5C1V A;  2HYP A;  3IB7 A;  1OIE A;  5J28 A;  4B2O A;  4H2B A;  4O43 A;  3PSO A;  4H2F A;  5F3W A;  4ORA A;  4DSY A;  2AHD A;  3RL3 A;  1OI8 A;  4ZVZ A;  5JPE A;  4XPN A;  3IVD A;  2DXL A;  2HY1 A;  1U32 A;  4MOY A;  2BDX A;  3RQZ A;  1FJM A;  4FBQ A;  1IT6 A;  2A22 A;  3QFO A;  4UT3 A;  1S95 A;  2IE3 C;  5DNY A;  3DSC A;  2NPP C;  3H66 A;  2CV9 A;  1T70 A;  2KKN A;  4FCX A;  3QFN A;  3RL4 A;  4O4K A;  2BCD A;  2IAE C;  2NYM C;  4V0V A;  2QFR A;  3H69 A;  2YEQ A;  2Z06 A;  4M0V A;  1II7 A;  2BQ8 X;  2ZO9 B;  1USH A;  3H63 A;  3IVE A;  4IL1 A;  4UT2 A;  3FGA C;  4OR9 A;  3IB8 A;  2NYL C;  4H1S A;  3E7B A;  5B8I A;  1UTE A;  1W24 A;  4NZV A;  3C9F A;  1WAO 1;  4MOV A;  2Z1A A;  4O24 A;  2QFP A;  4KBP A;  3ICF A;  3H64 A;  4MP0 A;  2HYO A;  1S8E A;  3AUZ A;  1G5B A;  3H68 A;  4LU9 A;  4UT3 B;  3V4Y A;  3DW8 C;  3KBP A;  1SU1 A;  3CK2 A;  3FLO A;  3TGH A;  3K7W C;  3N5U A;  2ZBM A;  1HO5 A;  3E7A A;  3H67 A;  4Q7F A;  2ZOA A;  1TCO A;  3P71 C;  2XMO A;  4JA9 A;  4LAC C;  4F0Z A;  5JJT A;  4ORB A;  4G9J A;  4UWQ A;  1S3L A;  3GVE A;  2YVT A;  3JYF A;  4DHL A;  2P6B A;  4TUI A;  4KKZ A;  2GJU A;  2QJC A;  4WWL A;  4J6O A;  1AUI A;  1OID A;  2DFJ A;  2JOG A;  2WDF A;  1MF8 A; 
#chains in the Genus database with same CATH homology
 4IYP C;  4ORC A;  3C5W C;  1JK7 A;  1M63 A;  4HD0 A;  1QFC A;  4O5G A;  3DSD A;  2O8G A;  4H2G A;  4H1Y P;  1HPU A;  1KBP A;  5EQV A;  4H2I A;  5JPF A;  1V73 A;  1QHW A;  1XZW A;  4YKE A;  1NNW A;  4LTY A;  5INB A;  3ZU0 A;  2NXF A;  2IE4 C;  4I5L C;  2Q8U A;  4TUG A;  1XM7 A;  3THO B;  3EGH A;  3H61 A;  2DXN A;  4DT2 A;  3T1I A;  3QG5 C;  1S3N A;  3K7V C;  4JA7 A;  3QFM A;  3HVQ A;  1S3M A;  3H62 B;  4ZX2 A;  5HPE A;  2WDE A;  5IOH A;  2R17 A;  5GTU A;  1HP1 A;  1Z2W A;  3H60 A;  3E0J A;  1S70 A;  3LL8 A;  4V0W A;  3RL5 A;  3THN A;  1UF3 A;  1T71 A;  2USH A;  2Z72 A;  3AV0 A;  1Z2X A;  1WAR A;  3PSN A;  2WDD A;  4FBW A;  3D03 A;  4V0X A;  3ZTV A;  3QFK A;  4FBK A;  4I5N C;  2O8A A;  2WDC A;  3EGG A;  5C1V A;  2HYP A;  3IB7 A;  1OIE A;  5J28 A;  4B2O A;  4H2B A;  4O43 A;  3PSO A;  4H2F A;  5F3W A;  4ORA A;  4DSY A;  2AHD A;  3RL3 A;  1OI8 A;  4ZVZ A;  5JPE A;  4XPN A;  3IVD A;  2DXL A;  2HY1 A;  1U32 A;  4MOY A;  2BDX A;  3RQZ A;  1FJM A;  4FBQ A;  1IT6 A;  2A22 A;  3QFO A;  4UT3 A;  1S95 A;  2IE3 C;  5DNY A;  3DSC A;  2NPP C;  3H66 A;  2CV9 A;  1T70 A;  2KKN A;  4FCX A;  3QFN A;  3RL4 A;  4O4K A;  2BCD A;  2IAE C;  2NYM C;  4V0V A;  2QFR A;  3H69 A;  2YEQ A;  2Z06 A;  4M0V A;  1II7 A;  2BQ8 X;  2ZO9 B;  1USH A;  3H63 A;  3IVE A;  4IL1 A;  4UT2 A;  3FGA C;  4OR9 A;  3IB8 A;  2NYL C;  4H1S A;  3E7B A;  5B8I A;  1UTE A;  1W24 A;  4NZV A;  3C9F A;  1WAO 1;  4MOV A;  2Z1A A;  4O24 A;  2QFP A;  4KBP A;  3ICF A;  3H64 A;  4MP0 A;  2HYO A;  1S8E A;  3AUZ A;  1G5B A;  3H68 A;  4LU9 A;  4UT3 B;  3V4Y A;  3DW8 C;  3KBP A;  1SU1 A;  3CK2 A;  3FLO A;  3TGH A;  3K7W C;  3N5U A;  2ZBM A;  1HO5 A;  3E7A A;  3H67 A;  4Q7F A;  2ZOA A;  1TCO A;  3P71 C;  2XMO A;  4JA9 A;  4LAC C;  4F0Z A;  5JJT A;  4ORB A;  4G9J A;  4UWQ A;  1S3L A;  3GVE A;  2YVT A;  3JYF A;  4DHL A;  2P6B A;  4TUI A;  4KKZ A;  2GJU A;  2QJC A;  4WWL A;  4J6O A;  1AUI A;  1OID A;  2DFJ A;  2JOG A;  2WDF A;  1MF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...