2DG3A

Wildtype fk506-binding protein complexed with rapamycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 23
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg3A00
1FKKA 1ZCNA 1P5QA 1J4RA 1Q1CA 2RURA 3O5FA 3UQIA 5BXJA 4U85A 2LPVA 1W26A 1U79A 2RUQA 4J4NA 2PV2A 2XP6A 2MF9A 2XP5A 3GPKA 1PINA 4FN2A 1FD9A 1ROUA 3PRBA 3VAWA 1NMVA 1FKGA 2KR7A 3TDBA 3IKDA 3O5RA 4ODKA 3IHZA 4MGVA 1J4HA 2RSEA 1BL4A 3KZ7A 2ZR4A 3KADA 1F8AB 5B8IC 4ODOA 1D7HA 1J6YA 3JYJA 3KAFA 2DG3A 2PPOA 1JNTA 4U84A 5DIVA 2RQSA 4JFMA 3PA7A 2ZQUA 4JFIA 4JYSA 4DRPA 4GGQA 4DZ2A 1EYMA 3TC5A 1ROTA 4W9PA 2FKEA 2XP3A 2JZVA 3O5DA 4DZ3A 3WH0A 2KGJA 3ODKA 5D75A 4TX0A 5J6EA 2AWGA 1Q6HA 3O5GA 4TYOA 1J4IA 2XPAA 2PV1A 1PBKA 1FKJA 3KABA 2F2DA 4ITZA 3UI6A 1QZ2A 4W9OA 5DITA 4JFLA 4DRJA 4DIPA 4FAPA 2M1IA 3KAGA 3NRKA 3NTPA 3O5JA 3O5PA 4JFJA 3EY6A 2FAPA 3H9RB 4DH0A 4DRNA 2XP8A 2F21A 4O2TA 1FKIA 3CGMA 1Y0OA 3FAPA 4QT3A 2ITKA 3RFWA 5HT1A 4DRQA 1C9HA 2PPNA 4QT2A 1T11A 1D7JA 1QPFA 4C02B 5HKGA 2XP9A 1L1PA 2F4EA 2M08A 4JFKA 3O5IA 3LUOA 1QPLA 4NNRA 4TW6A 1D6OA 3O5QA 2DG4A 5HTGA 3RGCA 3KCEA 4ODQA 1JNSA 5HW7A 2LJ4A 1Q6IA 4BF8A 3KACA 4G2PA 1N1AA 3O5MA 2ZR6A 4J4OA 3IK8A 5I98A 3UQAA 2D9FA 2KI3A 4G50A 3NI6A 4ODPA 4ODNA 4QIBA 2M2AA 1ZK6A 2L2SA 1FAPA 2MLYA 2LKNA 3O5OA 1FJDA 1R9HA 2OFNA 1FKFA 1Q6UA 2KFWA 1FKRA 5HW8A 5HUAA 4LAVA 1FKDA 4DRHA 3UF8A 2LGOA 2Q5AA 2ZQVA 3B7XA 3JYMA 2RUCA 1FKLA 4TW8A 5DIUA 4DRKA 4DROA 1BKFA 2MNTA 2ZR5A 4GIVA 1YW5A 3OOBA 5GPGA 1FKHA 1TCOC 2K8IA 1FKBA 1NSGA 1M5YA 2PBCA 2Y78A 5HWCA 1EQ3A 3KAIA 2DG9A 2RUDA 5HWBA 2IF4A 1KT1A 2VN1A 4R0XA 2MLXA 4LAYA 5HW6A 4DRMA 2KE0A 1NMWA 4DT4A 4IPXA 1JVWA 1YATA 3JXVA 4IQCA 3O5LA 4ODMA 4DRIA 4LAXA 4IQ2A 3UQBA 1B6CA 3IKGA 3O5EA 1D7IA 2MPHA 2XP4A 2XPBA 2UZ5A 3KAHA 4N19A 4ODLA 4LAWA 4U86A 3UI4A 1F40A 2PPPA 2KO7A 2PV3A 2VCDA 1KT0A 4TW7A 3TCZA 3MDYB 2ZQSA 1FKSA 1FKTA 2MLZA 2ZQTA 4TNSA 3CGNA 4W9QA 2N87A 4ODRA 3O5KA 3I6CA 2XP7A 3UI5A 1HXVA 3PRDA 1A7XA 4MSPA
chains in the Genus database with same CATH superfamily
1E6PA 2ESCA 1SYTA 5BXJA 4U85A 2RUQA 2OLHA 3GPKA 4QZVB 2XP5A 1PINA 3PRBA 3VAWA 2KR7A 3TDBA 4ODKA 3IHZA 4MGVA 1J4HA 3KZ7A 2ZR4A 1OWQA 1J6YA 1LL6A 3KAFA 4IT4A 5DIVA 2RQSA 3ARPA 2ZQUA 3PA7A 1EYMA 4ZS6A 3O5DA 3ARSA 1H0GA 2A3BA 2XPAA 2PV1A 3WD0A 4WIWA 2DPEA 1ZB5A 4L3NA 3UI6A 4W9OA 1JCHB 1OGGA 4WKHA 2WLZA 4JFLA 4DRJA 4MTVA 3KAGA 3NTPA 3H9RB 2XP8A 2ETNA 1UR9A 3FAPA 1E6NA 4ZPVR 1LQ0A 1C9HA 2PPNA 1ZBVA 1LL4A 1XHGA 2DT2A 1JNSA 5GQBA 1FFRA 1Q6IA 1HJVA 4J4OA 2ZR6A 3UQAA 3IK8A 2D9FA 2KI3A 5DO2A 3G6MA 3GTYX 1FJDA 4HBEA 4AY1A 1Q6UA 4LAVA 3RM8A 3WQVA 4TW8A 4DRKA 4MPKA 2ZR5A 4GIVA 2DSUA 1GPFA 1FKHA 5HWCA 3CHDA 2IF4A 1LG2A 2YBUA 4LAYA 2O92A 4DRMA 3JXVA 1YATA 4MNMA 3O5LA 4Z2JA 2F23A 4DRIA 4LAXA 5GPRA 4WKAA 4Z2HA 1HKIA 4MAVA 3AROA 1FKSA 3WD3A 4TNSA 3ALFA 3AS0A 4ODRA 3O5KA 2XP7A 1E15A 4DH0A 1EIBA 1SR0A 1P5QA 1J4RA 1Q1CA 3UQIA 1U79A 4FN2A 3GU0A 1NH6A 1ROUA 1GRJA 1BL4A 2A3AA 4ODOA 1D7HA 4ZPTR 3JYJA 4XAKA 3ARWA 1JNTA 2YBTA 4WJXA 4JFMA 4DZ2A 4KQZA 3FXYA 3ALGA 4W9PA 4Z2IA 2WM0A 4LGXA 4DZ3A 1FFQA 1JNDA 2DSZA 1W1VA 4TYOA 4IT6A 1UR8A 1FKJA 3ARTA 2F2DA 4HARA 5DITA 2DT0A 2M1IA 3O5JA 4JFJA 3EY6A 2F21A 2WLYA 1FKIA 3CGMA 4QT3A 5HT1A 4DRQA 1QPFA 2EULA 3PR9A 3AS1A 1GOIA 1QPLA 4NNRA 1D6OA 3O5QA 2DG4A 2B5UB 1KFWA 4BF8A 1VF8A 5I98A 4G50A 2M2AA 1FAPA 2MLYA 2LKNA 2O9OA 3O5OA 2DT1A 2OFNA 1FKRA 2KFWA 1W1YA 1E44A 1FKDA 4UDMA 2LGOA 5DF0A 2G41A 2P4VA 3WL0A 4Z2KA 5DIUA 1ZBKA 2MNTA 3ARXA 3CZ8A 2K8IA 1FKBA 2PI6A 4DT4A 4IPXA 1JVWA 2IUZA 1W9VA 1ZBCA 3B9EA 4ODMA 3O5EA 1D7IA 1JNEA 2XP4A 1HJXA 4ODLA 1WB0A 2PPPA 4HBOA 2KO7A 2PV3A 3WD4A 3MDYB 2ZQSA 2MLZA 3EIPA 4W9QA 1NWTA 3I6CA 4P8WA 1FKKA 1E6RA 4DWSA 2RURA 3O5FA 4DWSC 2XP6A 1FD9A 1NMVA 1FKGA 1O6IA 3O5RA 3AS2A 3KADA 2DG3A 3WKZA 3RM9A 4U84A 4JYSA 5JH8A 1ROTA 2XP3A 2AWGA 1K9TA 1HKKA 1Q6HA 3WQWA 4DWSD 1PBKA 3KABA 4ITZA 1QZ2A 1OGBA 4Q7NA 4FAPA 2DSWA 4P8VA 4ML4A 4DRNA 3AS3A 1W1TA 2ITKA 3OA5A 1D7JA 5HKGA 1L1PA 2M08A 3O5IA 3LUOA 1E6ZA 2LJ4A 1N1AA 1XRVA 4QIBA 1W9PA 3CHEA 2DT3A 2L2SA 3W4RA 3BMBA 1R9HA 1E9LA 5HUAA 4P8UA 4P8XA 4L72B 1LJYA 3BXWA 3RMEA 1NWSA 1GUVA 4R5EA 5GPGA 1TCOC 1NSGA 1NWRA 1WNOA 3KAIA 2DG9A 4R0XA 5HW6A 2KE0A 1NMWA 1W1PA 4Q22A 4NZCA 1X6LA 4KR0B 3UQBA 3IKGA 2XPBA 2AOSA 4U86A 3UI4A 1F40A 1LG1A 4URIA 3TCZA 2VCDA 1KT0A 4TW7A 3CHCA 3B8SA 2ZQTA 4Z2GA 1ZU8A 2N87A 1RD6A 1A7XA 4DWSB 1IX5A 1ZCNA 3ARQA 1ZBWA 2LPVA 1W26A 1W9UA 4J4NA 2PV2A 2MF9A 3B9AA 3IKDA 1NWUA 2RSEA 3QOKA 5B8IC 1F8AB 4WK9A 4S3JA 1EDQA 2PPOA 4S3KA 4MNJA 4JFIA 4DRPA 4GGQA 5DEZA 3TC5A 2DSVA 3WL1A 2FKEA 2JZVA 3WH0A 2KGJA 3ODKA 5D75A 4TX0A 5J6EA 3O5GA 1LL7A 4MNKA 1J4IA 4Z2LA 1TFVA 1EHNA 3ARUA 4PTMA 4DIPA 3O5PA 3NRKA 3CH9A 1HKJA 2FAPA 4O2TA 1Y0OA 3WD2A 3WD1A 3RFWA 2A3CA 1CTNA 4QT2A 1T11A 1D2KA 4C02B 2XP9A 2F4EA 4JFKA 4TW6A 4W5UA 5HTGA 3RGCA 3KCEA 4MNLA 4ODQA 3ARRA 5HW7A 2QF8A 4ZPWR 3KACA 4G2PA 3O5MA 3WIJA 1ITXA 3NI6A 2A3EA 4ODPA 2PN0A 4ODNA 1ZK6A 1H0IA 1HJWA 1ZL1A 1FKFA 5HW8A 2G8ZA 4DRHA 3UF8A 2Q5AA 2ZQVA 3B7XA 4WKFA 3JYMA 2RUCA 1FKLA 3ARYA 3AQUA 4DROA 3G6LA 1BKFA 1YW5A 3OOBA 1HKMA 2PBCA 1M5YA 2Y78A 5HBFA 1EQ3A 2RUDA 3ARVA 5HWBA 1KT1A 2VN1A 2MLXA 4IQCA 4IQ2A 1B6CA 3CHFA 2MPHA 3KAHA 2UZ5A 3B9DA 4N19A 4LAWA 2B31A 1X6NA 3PRAA 2WK2A 1FKTA 3CGNA 3FY1A 2FDMA 3ARZA 4NSBA 3RM4A 3UI5A 1WAWA 1HXVA 3PRDA 4MSPA
chains in the Genus database with same CATH topology
1E6PA 2ESCA 1SYTA 5BXJA 4U85A 2RUQA 2OLHA 3GPKA 4QZVB 2XP5A 1PINA 3PRBA 3VAWA 2KR7A 3TDBA 4ODKA 3IHZA 4MGVA 1J4HA 3KZ7A 2ZR4A 1OWQA 1J6YA 1LL6A 3KAFA 4IT4A 5DIVA 2RQSA 3ARPA 2ZQUA 3PA7A 1EYMA 4ZS6A 3O5DA 3ARSA 1H0GA 2A3BA 2XPAA 2PV1A 3WD0A 4WIWA 2DPEA 1ZB5A 4L3NA 3UI6A 4W9OA 1OGGA 4WKHA 2WLZA 4JFLA 4DRJA 4MTVA 3KAGA 3NTPA 3H9RB 2XP8A 1UR9A 3FAPA 1E6NA 4ZPVR 1LQ0A 1C9HA 2PPNA 1ZBVA 1LL4A 1XHGA 2DT2A 1JNSA 5GQBA 1FFRA 1Q6IA 1HJVA 4J4OA 2ZR6A 3UQAA 3IK8A 2D9FA 2KI3A 5DO2A 3G6MA 1FJDA 4HBEA 4AY1A 1Q6UA 4LAVA 3RM8A 3WQVA 4TW8A 4DRKA 4MPKA 2ZR5A 4GIVA 2DSUA 1GPFA 1FKHA 5HWCA 3CHDA 2IF4A 1LG2A 2YBUA 4LAYA 2O92A 4DRMA 3JXVA 1YATA 4MNMA 3O5LA 4Z2JA 4DRIA 4LAXA 5GPRA 4WKAA 4Z2HA 1HKIA 4MAVA 3AROA 1FKSA 3WD3A 4TNSA 3ALFA 3AS0A 4ODRA 3O5KA 2XP7A 1E15A 4DH0A 1EIBA 1SR0A 1P5QA 1J4RA 1Q1CA 3UQIA 1U79A 4FN2A 1NH6A 1ROUA 1BL4A 2A3AA 4ODOA 1D7HA 4ZPTR 3JYJA 4XAKA 3ARWA 1JNTA 2YBTA 4WJXA 4JFMA 4DZ2A 4KQZA 3FXYA 3ALGA 4W9PA 4Z2IA 2WM0A 4LGXA 4DZ3A 1FFQA 1JNDA 2DSZA 1W1VA 4TYOA 4IT6A 1UR8A 1FKJA 3ARTA 2F2DA 4HARA 5DITA 2DT0A 2M1IA 3O5JA 4JFJA 3EY6A 2F21A 2WLYA 1FKIA 3CGMA 4QT3A 5HT1A 4DRQA 1QPFA 3PR9A 3AS1A 1GOIA 1QPLA 4NNRA 1D6OA 3O5QA 2DG4A 1KFWA 4BF8A 1VF8A 5I98A 4G50A 2M2AA 1FAPA 2MLYA 2LKNA 2O9OA 3O5OA 2DT1A 2OFNA 1FKRA 2KFWA 1W1YA 1FKDA 2LGOA 5DF0A 2G41A 3WL0A 4Z2KA 5DIUA 1ZBKA 2MNTA 3ARXA 3CZ8A 2K8IA 1FKBA 2PI6A 4DT4A 4IPXA 1JVWA 2IUZA 1W9VA 1ZBCA 3B9EA 4ODMA 3O5EA 1D7IA 1JNEA 2XP4A 1HJXA 4ODLA 1WB0A 2PPPA 4HBOA 2KO7A 2PV3A 3WD4A 3MDYB 2ZQSA 2MLZA 4W9QA 1NWTA 3I6CA 4P8WA 1FKKA 1E6RA 4DWSA 2RURA 3O5FA 4DWSC 2XP6A 1FD9A 1NMVA 1FKGA 1O6IA 3O5RA 3AS2A 3KADA 2DG3A 3WKZA 3RM9A 4U84A 4JYSA 5JH8A 1ROTA 2XP3A 2AWGA 1K9TA 1HKKA 1Q6HA 3WQWA 4DWSD 1PBKA 3KABA 4ITZA 1QZ2A 1OGBA 4Q7NA 4FAPA 2DSWA 4P8VA 4ML4A 4DRNA 3AS3A 1W1TA 2ITKA 3OA5A 1D7JA 5HKGA 1L1PA 2M08A 3O5IA 3LUOA 1E6ZA 2LJ4A 1N1AA 1XRVA 4QIBA 1W9PA 3CHEA 2DT3A 2L2SA 3W4RA 1R9HA 1E9LA 5HUAA 4P8UA 4P8XA 4L72B 1LJYA 3BXWA 3RMEA 1NWSA 1GUVA 4R5EA 5GPGA 1TCOC 1NSGA 1NWRA 1WNOA 3KAIA 2DG9A 4R0XA 5HW6A 2KE0A 1NMWA 1W1PA 4Q22A 4NZCA 1X6LA 4KR0B 3UQBA 3IKGA 2XPBA 2AOSA 4U86A 3UI4A 1F40A 1LG1A 4URIA 3TCZA 2VCDA 1KT0A 4TW7A 3CHCA 3B8SA 2ZQTA 4Z2GA 1ZU8A 2N87A 1RD6A 1A7XA 4DWSB 1IX5A 1ZCNA 3ARQA 1ZBWA 2LPVA 1W26A 1W9UA 4J4NA 2PV2A 2MF9A 3B9AA 3IKDA 1NWUA 2RSEA 3QOKA 5B8IC 1F8AB 4WK9A 4S3JA 1EDQA 2PPOA 4S3KA 4MNJA 4JFIA 4DRPA 4GGQA 5DEZA 3TC5A 2DSVA 3WL1A 2FKEA 2JZVA 3WH0A 2KGJA 3ODKA 5D75A 4TX0A 5J6EA 3O5GA 1LL7A 4MNKA 1J4IA 4Z2LA 1TFVA 1EHNA 3ARUA 4PTMA 4DIPA 3O5PA 3NRKA 3CH9A 1HKJA 2FAPA 4O2TA 1Y0OA 3WD2A 3WD1A 3RFWA 2A3CA 1CTNA 4QT2A 1T11A 1D2KA 4C02B 2XP9A 2F4EA 4JFKA 4TW6A 4W5UA 5HTGA 3RGCA 3KCEA 4MNLA 4ODQA 3ARRA 5HW7A 2QF8A 4ZPWR 3KACA 4G2PA 3O5MA 3WIJA 1ITXA 3NI6A 2A3EA 4ODPA 4ODNA 1ZK6A 1H0IA 1HJWA 1ZL1A 1FKFA 5HW8A 2G8ZA 4DRHA 3UF8A 2Q5AA 2ZQVA 3B7XA 4WKFA 3JYMA 2RUCA 1FKLA 3ARYA 3AQUA 4DROA 3G6LA 1BKFA 1YW5A 3OOBA 1HKMA 2PBCA 1M5YA 2Y78A 5HBFA 1EQ3A 2RUDA 3ARVA 5HWBA 1KT1A 2VN1A 2MLXA 4IQCA 4IQ2A 1B6CA 3CHFA 2MPHA 3KAHA 2UZ5A 3B9DA 4N19A 4LAWA 2B31A 1X6NA 3PRAA 2WK2A 1FKTA 3CGNA 3FY1A 2FDMA 3ARZA 4NSBA 3RM4A 3UI5A 1WAWA 1HXVA 3PRDA 4MSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKK A;  1ZCN A;  1P5Q A;  1J4R A;  1Q1C A;  2RUR A;  3O5F A;  3UQI A;  5BXJ A;  4U85 A;  2LPV A;  1W26 A;  1U79 A;  2RUQ A;  4J4N A;  2PV2 A;  2XP6 A;  2MF9 A;  2XP5 A;  3GPK A;  1PIN A;  4FN2 A;  1FD9 A;  1ROU A;  3PRB A;  3VAW A;  1NMV A;  1FKG A;  2KR7 A;  3TDB A;  3IKD A;  3O5R A;  4ODK A;  3IHZ A;  4MGV A;  1J4H A;  2RSE A;  1BL4 A;  3KZ7 A;  2ZR4 A;  3KAD A;  1F8A B;  5B8I C;  4ODO A;  1D7H A;  1J6Y A;  3JYJ A;  3KAF A;  2DG3 A;  2PPO A;  1JNT A;  4U84 A;  5DIV A;  2RQS A;  4JFM A;  3PA7 A;  2ZQU A;  4JFI A;  4JYS A;  4DRP A;  4GGQ A;  4DZ2 A;  1EYM A;  3TC5 A;  1ROT A;  4W9P A;  2FKE A;  2XP3 A;  2JZV A;  3O5D A;  4DZ3 A;  3WH0 A;  2KGJ A;  3ODK A;  5D75 A;  4TX0 A;  5J6E A;  2AWG A;  1Q6H A;  3O5G A;  4TYO A;  1J4I A;  2XPA A;  2PV1 A;  1PBK A;  1FKJ A;  3KAB A;  2F2D A;  4ITZ A;  3UI6 A;  1QZ2 A;  4W9O A;  5DIT A;  4JFL A;  4DRJ A;  4DIP A;  4FAP A;  2M1I A;  3KAG A;  3NRK A;  3NTP A;  3O5J A;  3O5P A;  4JFJ A;  3EY6 A;  2FAP A;  3H9R B;  4DH0 A;  4DRN A;  2XP8 A;  2F21 A;  4O2T A;  1FKI A;  3CGM A;  1Y0O A;  3FAP A;  4QT3 A;  2ITK A;  3RFW A;  5HT1 A;  4DRQ A;  1C9H A;  2PPN A;  4QT2 A;  1T11 A;  1D7J A;  1QPF A;  4C02 B;  5HKG A;  2XP9 A;  1L1P A;  2F4E A;  2M08 A;  4JFK A;  3O5I A;  3LUO A;  1QPL A;  4NNR A;  4TW6 A;  1D6O A;  3O5Q A;  2DG4 A;  5HTG A;  3RGC A;  3KCE A;  4ODQ A;  1JNS A;  5HW7 A;  2LJ4 A;  1Q6I A;  4BF8 A;  3KAC A;  4G2P A;  1N1A A;  3O5M A;  2ZR6 A;  4J4O A;  3IK8 A;  5I98 A;  3UQA A;  2D9F A;  2KI3 A;  4G50 A;  3NI6 A;  4ODP A;  4ODN A;  4QIB A;  2M2A A;  1ZK6 A;  2L2S A;  1FAP A;  2MLY A;  2LKN A;  3O5O A;  1FJD A;  1R9H A;  2OFN A;  1FKF A;  1Q6U A;  2KFW A;  1FKR A;  5HW8 A;  5HUA A;  4LAV A;  1FKD A;  4DRH A;  3UF8 A;  2LGO A;  2Q5A A;  2ZQV A;  3B7X A;  3JYM A;  2RUC A;  1FKL A;  4TW8 A;  5DIU A;  4DRK A;  4DRO A;  1BKF A;  2MNT A;  2ZR5 A;  4GIV A;  1YW5 A;  3OOB A;  5GPG A;  1FKH A;  1TCO C;  2K8I A;  1FKB A;  1NSG A;  1M5Y A;  2PBC A;  2Y78 A;  5HWC A;  1EQ3 A;  3KAI A;  2DG9 A;  2RUD A;  5HWB A;  2IF4 A;  1KT1 A;  2VN1 A;  4R0X A;  2MLX A;  4LAY A;  5HW6 A;  4DRM A;  2KE0 A;  1NMW A;  4DT4 A;  4IPX A;  1JVW A;  1YAT A;  3JXV A;  4IQC A;  3O5L A;  4ODM A;  4DRI A;  4LAX A;  4IQ2 A;  3UQB A;  1B6C A;  3IKG A;  3O5E A;  1D7I A;  2MPH A;  2XP4 A;  2XPB A;  2UZ5 A;  3KAH A;  4N19 A;  4ODL A;  4LAW A;  4U86 A;  3UI4 A;  1F40 A;  2PPP A;  2KO7 A;  2PV3 A;  2VCD A;  1KT0 A;  4TW7 A;  3TCZ A;  3MDY B;  2ZQS A;  1FKS A;  1FKT A;  2MLZ A;  2ZQT A;  4TNS A;  3CGN A;  4W9Q A;  2N87 A;  4ODR A;  3O5K A;  3I6C A;  2XP7 A;  3UI5 A;  1HXV A;  3PRD A;  1A7X A;  4MSP A; 
#chains in the Genus database with same CATH topology
 1E6P A;  2ESC A;  1SYT A;  5BXJ A;  4U85 A;  2RUQ A;  2OLH A;  3GPK A;  4QZV B;  2XP5 A;  1PIN A;  3PRB A;  3VAW A;  2KR7 A;  3TDB A;  4ODK A;  3IHZ A;  4MGV A;  1J4H A;  3KZ7 A;  2ZR4 A;  1OWQ A;  1J6Y A;  1LL6 A;  3KAF A;  4IT4 A;  5DIV A;  2RQS A;  3ARP A;  2ZQU A;  3PA7 A;  1EYM A;  4ZS6 A;  3O5D A;  3ARS A;  1H0G A;  2A3B A;  2XPA A;  2PV1 A;  3WD0 A;  4WIW A;  2DPE A;  1ZB5 A;  4L3N A;  3UI6 A;  4W9O A;  1JCH B;  1OGG A;  4WKH A;  2WLZ A;  4JFL A;  4DRJ A;  4MTV A;  3KAG A;  3NTP A;  3H9R B;  2XP8 A;  2ETN A;  1UR9 A;  3FAP A;  1E6N A;  4ZPV R;  1LQ0 A;  1C9H A;  2PPN A;  1ZBV A;  1LL4 A;  1XHG A;  2DT2 A;  1JNS A;  5GQB A;  1FFR A;  1Q6I A;  1HJV A;  4J4O A;  2ZR6 A;  3UQA A;  3IK8 A;  2D9F A;  2KI3 A;  5DO2 A;  3G6M A;  3GTY X;  1FJD A;  4HBE A;  4AY1 A;  1Q6U A;  4LAV A;  3RM8 A;  3WQV A;  4TW8 A;  4DRK A;  4MPK A;  2ZR5 A;  4GIV A;  2DSU A;  1GPF A;  1FKH A;  5HWC A;  3CHD A;  2IF4 A;  1LG2 A;  2YBU A;  4LAY A;  2O92 A;  4DRM A;  3JXV A;  1YAT A;  4MNM A;  3O5L A;  4Z2J A;  2F23 A;  4DRI A;  4LAX A;  5GPR A;  4WKA A;  4Z2H A;  1HKI A;  4MAV A;  3ARO A;  1FKS A;  3WD3 A;  4TNS A;  3ALF A;  3AS0 A;  4ODR A;  3O5K A;  2XP7 A;  1E15 A;  4DH0 A;  1EIB A;  1SR0 A;  1P5Q A;  1J4R A;  1Q1C A;  3UQI A;  1U79 A;  4FN2 A;  3GU0 A;  1NH6 A;  1ROU A;  1GRJ A;  1BL4 A;  2A3A A;  4ODO A;  1D7H A;  4ZPT R;  3JYJ A;  4XAK A;  3ARW A;  1JNT A;  2YBT A;  4WJX A;  4JFM A;  4DZ2 A;  4KQZ A;  3FXY A;  3ALG A;  4W9P A;  4Z2I A;  2WM0 A;  4LGX A;  4DZ3 A;  1FFQ A;  1JND A;  2DSZ A;  1W1V A;  4TYO A;  4IT6 A;  1UR8 A;  1FKJ A;  3ART A;  2F2D A;  4HAR A;  5DIT A;  2DT0 A;  2M1I A;  3O5J A;  4JFJ A;  3EY6 A;  2F21 A;  2WLY A;  1FKI A;  3CGM A;  4QT3 A;  5HT1 A;  4DRQ A;  1QPF A;  2EUL A;  3PR9 A;  3AS1 A;  1GOI A;  1QPL A;  4NNR A;  1D6O A;  3O5Q A;  2DG4 A;  2B5U B;  1KFW A;  4BF8 A;  1VF8 A;  5I98 A;  4G50 A;  2M2A A;  1FAP A;  2MLY A;  2LKN A;  2O9O A;  3O5O A;  2DT1 A;  2OFN A;  1FKR A;  2KFW A;  1W1Y A;  1E44 A;  1FKD A;  4UDM A;  2LGO A;  5DF0 A;  2G41 A;  2P4V A;  3WL0 A;  4Z2K A;  5DIU A;  1ZBK A;  2MNT A;  3ARX A;  3CZ8 A;  2K8I A;  1FKB A;  2PI6 A;  4DT4 A;  4IPX A;  1JVW A;  2IUZ A;  1W9V A;  1ZBC A;  3B9E A;  4ODM A;  3O5E A;  1D7I A;  1JNE A;  2XP4 A;  1HJX A;  4ODL A;  1WB0 A;  2PPP A;  4HBO A;  2KO7 A;  2PV3 A;  3WD4 A;  3MDY B;  2ZQS A;  2MLZ A;  3EIP A;  4W9Q A;  1NWT A;  3I6C A;  4P8W A;  1FKK A;  1E6R A;  4DWS A;  2RUR A;  3O5F A;  4DWS C;  2XP6 A;  1FD9 A;  1NMV A;  1FKG A;  1O6I A;  3O5R A;  3AS2 A;  3KAD A;  2DG3 A;  3WKZ A;  3RM9 A;  4U84 A;  4JYS A;  5JH8 A;  1ROT A;  2XP3 A;  2AWG A;  1K9T A;  1HKK A;  1Q6H A;  3WQW A;  4DWS D;  1PBK A;  3KAB A;  4ITZ A;  1QZ2 A;  1OGB A;  4Q7N A;  4FAP A;  2DSW A;  4P8V A;  4ML4 A;  4DRN A;  3AS3 A;  1W1T A;  2ITK A;  3OA5 A;  1D7J A;  5HKG A;  1L1P A;  2M08 A;  3O5I A;  3LUO A;  1E6Z A;  2LJ4 A;  1N1A A;  1XRV A;  4QIB A;  1W9P A;  3CHE A;  2DT3 A;  2L2S A;  3W4R A;  3BMB A;  1R9H A;  1E9L A;  5HUA A;  4P8U A;  4P8X A;  4L72 B;  1LJY A;  3BXW A;  3RME A;  1NWS A;  1GUV A;  4R5E A;  5GPG A;  1TCO C;  1NSG A;  1NWR A;  1WNO A;  3KAI A;  2DG9 A;  4R0X A;  5HW6 A;  2KE0 A;  1NMW A;  1W1P A;  4Q22 A;  4NZC A;  1X6L A;  4KR0 B;  3UQB A;  3IKG A;  2XPB A;  2AOS A;  4U86 A;  3UI4 A;  1F40 A;  1LG1 A;  4URI A;  3TCZ A;  2VCD A;  1KT0 A;  4TW7 A;  3CHC A;  3B8S A;  2ZQT A;  4Z2G A;  1ZU8 A;  2N87 A;  1RD6 A;  1A7X A;  4DWS B;  1IX5 A;  1ZCN A;  3ARQ A;  1ZBW A;  2LPV A;  1W26 A;  1W9U A;  4J4N A;  2PV2 A;  2MF9 A;  3B9A A;  3IKD A;  1NWU A;  2RSE A;  3QOK A;  5B8I C;  1F8A B;  4WK9 A;  4S3J A;  1EDQ A;  2PPO A;  4S3K A;  4MNJ A;  4JFI A;  4DRP A;  4GGQ A;  5DEZ A;  3TC5 A;  2DSV A;  3WL1 A;  2FKE A;  2JZV A;  3WH0 A;  2KGJ A;  3ODK A;  5D75 A;  4TX0 A;  5J6E A;  3O5G A;  1LL7 A;  4MNK A;  1J4I A;  4Z2L A;  1TFV A;  1EHN A;  3ARU A;  4PTM A;  4DIP A;  3O5P A;  3NRK A;  3CH9 A;  1HKJ A;  2FAP A;  4O2T A;  1Y0O A;  3WD2 A;  3WD1 A;  3RFW A;  2A3C A;  1CTN A;  4QT2 A;  1T11 A;  1D2K A;  4C02 B;  2XP9 A;  2F4E A;  4JFK A;  4TW6 A;  4W5U A;  5HTG A;  3RGC A;  3KCE A;  4MNL A;  4ODQ A;  3ARR A;  5HW7 A;  2QF8 A;  4ZPW R;  3KAC A;  4G2P A;  3O5M A;  3WIJ A;  1ITX A;  3NI6 A;  2A3E A;  4ODP A;  2PN0 A;  4ODN A;  1ZK6 A;  1H0I A;  1HJW A;  1ZL1 A;  1FKF A;  5HW8 A;  2G8Z A;  4DRH A;  3UF8 A;  2Q5A A;  2ZQV A;  3B7X A;  4WKF A;  3JYM A;  2RUC A;  1FKL A;  3ARY A;  3AQU A;  4DRO A;  3G6L A;  1BKF A;  1YW5 A;  3OOB A;  1HKM A;  2PBC A;  1M5Y A;  2Y78 A;  5HBF A;  1EQ3 A;  2RUD A;  3ARV A;  5HWB A;  1KT1 A;  2VN1 A;  2MLX A;  4IQC A;  4IQ2 A;  1B6C A;  3CHF A;  2MPH A;  3KAH A;  2UZ5 A;  3B9D A;  4N19 A;  4LAW A;  2B31 A;  1X6N A;  3PRA A;  2WK2 A;  1FKT A;  3CGN A;  3FY1 A;  2FDM A;  3ARZ A;  4NSB A;  3RM4 A;  3UI5 A;  1WAW A;  1HXV A;  3PRD A;  4MSP A; 
#chains in the Genus database with same CATH homology
 1E6P A;  2ESC A;  1SYT A;  5BXJ A;  4U85 A;  2RUQ A;  2OLH A;  3GPK A;  4QZV B;  2XP5 A;  1PIN A;  3PRB A;  3VAW A;  2KR7 A;  3TDB A;  4ODK A;  3IHZ A;  4MGV A;  1J4H A;  3KZ7 A;  2ZR4 A;  1OWQ A;  1J6Y A;  1LL6 A;  3KAF A;  4IT4 A;  5DIV A;  2RQS A;  3ARP A;  2ZQU A;  3PA7 A;  1EYM A;  4ZS6 A;  3O5D A;  3ARS A;  1H0G A;  2A3B A;  2XPA A;  2PV1 A;  3WD0 A;  4WIW A;  2DPE A;  1ZB5 A;  4L3N A;  3UI6 A;  4W9O A;  1OGG A;  4WKH A;  2WLZ A;  4JFL A;  4DRJ A;  4MTV A;  3KAG A;  3NTP A;  3H9R B;  2XP8 A;  1UR9 A;  3FAP A;  1E6N A;  4ZPV R;  1LQ0 A;  1C9H A;  2PPN A;  1ZBV A;  1LL4 A;  1XHG A;  2DT2 A;  1JNS A;  5GQB A;  1FFR A;  1Q6I A;  1HJV A;  4J4O A;  2ZR6 A;  3UQA A;  3IK8 A;  2D9F A;  2KI3 A;  5DO2 A;  3G6M A;  1FJD A;  4HBE A;  4AY1 A;  1Q6U A;  4LAV A;  3RM8 A;  3WQV A;  4TW8 A;  4DRK A;  4MPK A;  2ZR5 A;  4GIV A;  2DSU A;  1GPF A;  1FKH A;  5HWC A;  3CHD A;  2IF4 A;  1LG2 A;  2YBU A;  4LAY A;  2O92 A;  4DRM A;  3JXV A;  1YAT A;  4MNM A;  3O5L A;  4Z2J A;  4DRI A;  4LAX A;  5GPR A;  4WKA A;  4Z2H A;  1HKI A;  4MAV A;  3ARO A;  1FKS A;  3WD3 A;  4TNS A;  3ALF A;  3AS0 A;  4ODR A;  3O5K A;  2XP7 A;  1E15 A;  4DH0 A;  1EIB A;  1SR0 A;  1P5Q A;  1J4R A;  1Q1C A;  3UQI A;  1U79 A;  4FN2 A;  1NH6 A;  1ROU A;  1BL4 A;  2A3A A;  4ODO A;  1D7H A;  4ZPT R;  3JYJ A;  4XAK A;  3ARW A;  1JNT A;  2YBT A;  4WJX A;  4JFM A;  4DZ2 A;  4KQZ A;  3FXY A;  3ALG A;  4W9P A;  4Z2I A;  2WM0 A;  4LGX A;  4DZ3 A;  1FFQ A;  1JND A;  2DSZ A;  1W1V A;  4TYO A;  4IT6 A;  1UR8 A;  1FKJ A;  3ART A;  2F2D A;  4HAR A;  5DIT A;  2DT0 A;  2M1I A;  3O5J A;  4JFJ A;  3EY6 A;  2F21 A;  2WLY A;  1FKI A;  3CGM A;  4QT3 A;  5HT1 A;  4DRQ A;  1QPF A;  3PR9 A;  3AS1 A;  1GOI A;  1QPL A;  4NNR A;  1D6O A;  3O5Q A;  2DG4 A;  1KFW A;  4BF8 A;  1VF8 A;  5I98 A;  4G50 A;  2M2A A;  1FAP A;  2MLY A;  2LKN A;  2O9O A;  3O5O A;  2DT1 A;  2OFN A;  1FKR A;  2KFW A;  1W1Y A;  1FKD A;  2LGO A;  5DF0 A;  2G41 A;  3WL0 A;  4Z2K A;  5DIU A;  1ZBK A;  2MNT A;  3ARX A;  3CZ8 A;  2K8I A;  1FKB A;  2PI6 A;  4DT4 A;  4IPX A;  1JVW A;  2IUZ A;  1W9V A;  1ZBC A;  3B9E A;  4ODM A;  3O5E A;  1D7I A;  1JNE A;  2XP4 A;  1HJX A;  4ODL A;  1WB0 A;  2PPP A;  4HBO A;  2KO7 A;  2PV3 A;  3WD4 A;  3MDY B;  2ZQS A;  2MLZ A;  4W9Q A;  1NWT A;  3I6C A;  4P8W A;  1FKK A;  1E6R A;  4DWS A;  2RUR A;  3O5F A;  4DWS C;  2XP6 A;  1FD9 A;  1NMV A;  1FKG A;  1O6I A;  3O5R A;  3AS2 A;  3KAD A;  2DG3 A;  3WKZ A;  3RM9 A;  4U84 A;  4JYS A;  5JH8 A;  1ROT A;  2XP3 A;  2AWG A;  1K9T A;  1HKK A;  1Q6H A;  3WQW A;  4DWS D;  1PBK A;  3KAB A;  4ITZ A;  1QZ2 A;  1OGB A;  4Q7N A;  4FAP A;  2DSW A;  4P8V A;  4ML4 A;  4DRN A;  3AS3 A;  1W1T A;  2ITK A;  3OA5 A;  1D7J A;  5HKG A;  1L1P A;  2M08 A;  3O5I A;  3LUO A;  1E6Z A;  2LJ4 A;  1N1A A;  1XRV A;  4QIB A;  1W9P A;  3CHE A;  2DT3 A;  2L2S A;  3W4R A;  1R9H A;  1E9L A;  5HUA A;  4P8U A;  4P8X A;  4L72 B;  1LJY A;  3BXW A;  3RME A;  1NWS A;  1GUV A;  4R5E A;  5GPG A;  1TCO C;  1NSG A;  1NWR A;  1WNO A;  3KAI A;  2DG9 A;  4R0X A;  5HW6 A;  2KE0 A;  1NMW A;  1W1P A;  4Q22 A;  4NZC A;  1X6L A;  4KR0 B;  3UQB A;  3IKG A;  2XPB A;  2AOS A;  4U86 A;  3UI4 A;  1F40 A;  1LG1 A;  4URI A;  3TCZ A;  2VCD A;  1KT0 A;  4TW7 A;  3CHC A;  3B8S A;  2ZQT A;  4Z2G A;  1ZU8 A;  2N87 A;  1RD6 A;  1A7X A;  4DWS B;  1IX5 A;  1ZCN A;  3ARQ A;  1ZBW A;  2LPV A;  1W26 A;  1W9U A;  4J4N A;  2PV2 A;  2MF9 A;  3B9A A;  3IKD A;  1NWU A;  2RSE A;  3QOK A;  5B8I C;  1F8A B;  4WK9 A;  4S3J A;  1EDQ A;  2PPO A;  4S3K A;  4MNJ A;  4JFI A;  4DRP A;  4GGQ A;  5DEZ A;  3TC5 A;  2DSV A;  3WL1 A;  2FKE A;  2JZV A;  3WH0 A;  2KGJ A;  3ODK A;  5D75 A;  4TX0 A;  5J6E A;  3O5G A;  1LL7 A;  4MNK A;  1J4I A;  4Z2L A;  1TFV A;  1EHN A;  3ARU A;  4PTM A;  4DIP A;  3O5P A;  3NRK A;  3CH9 A;  1HKJ A;  2FAP A;  4O2T A;  1Y0O A;  3WD2 A;  3WD1 A;  3RFW A;  2A3C A;  1CTN A;  4QT2 A;  1T11 A;  1D2K A;  4C02 B;  2XP9 A;  2F4E A;  4JFK A;  4TW6 A;  4W5U A;  5HTG A;  3RGC A;  3KCE A;  4MNL A;  4ODQ A;  3ARR A;  5HW7 A;  2QF8 A;  4ZPW R;  3KAC A;  4G2P A;  3O5M A;  3WIJ A;  1ITX A;  3NI6 A;  2A3E A;  4ODP A;  4ODN A;  1ZK6 A;  1H0I A;  1HJW A;  1ZL1 A;  1FKF A;  5HW8 A;  2G8Z A;  4DRH A;  3UF8 A;  2Q5A A;  2ZQV A;  3B7X A;  4WKF A;  3JYM A;  2RUC A;  1FKL A;  3ARY A;  3AQU A;  4DRO A;  3G6L A;  1BKF A;  1YW5 A;  3OOB A;  1HKM A;  2PBC A;  1M5Y A;  2Y78 A;  5HBF A;  1EQ3 A;  2RUD A;  3ARV A;  5HWB A;  1KT1 A;  2VN1 A;  2MLX A;  4IQC A;  4IQ2 A;  1B6C A;  3CHF A;  2MPH A;  3KAH A;  2UZ5 A;  3B9D A;  4N19 A;  4LAW A;  2B31 A;  1X6N A;  3PRA A;  2WK2 A;  1FKT A;  3CGN A;  3FY1 A;  2FDM A;  3ARZ A;  4NSB A;  3RM4 A;  3UI5 A;  1WAW A;  1HXV A;  3PRD A;  4MSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...