2DG3A

Wildtype fk506-binding protein complexed with rapamycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 23
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg3A00
1FKJA 3IK8A 5HW8A 2MNTA 2LJ4A 3KADA 4ODNA 3ODKA 2XP7A 2F21A 4TW6A 1D6OA 2XP9A 4DRPA 2XPAA 2DG4A 3NRKA 4DRNA 2ZR6A 1KT1A 4JFIA 1FKBA 2PV2A 1NMWA 3B7XA 4BF8A 1JNSA 1EQ3A 3UF8A 4TX0A 2KE0A 2KFWA 3KAGA 1KT0A 1Q6UA 1EYMA 4MGVA 1D7IA 4JFJA 3IKGA 3O5LA 4GIVA 1U79A 2JZVA 5HWBA 3O5FA 1J4HA 4QT3A 3KZ7A 4MSPA 1FD9A 1FKDA 2F4EA 4W9PA 3UI5A 3IKDA 4ODPA 3KAFA 5HTGA 1FKRA 1Q6HA 2XP6A 3PA7A 4U86A 5D75A 4ODRA 1BKFA 1JVWA 4U85A 3MDYB 4JFKA 2OFNA 1FKFA 3TCZA 2DG3A 1ZCNA 2VN1A 2ITKA 2LGOA 1P5QA 1D7JA 4DRHA 3O5GA 1HXVA 4DRMA 3WH0A 5BXJA 1YATA 2RUDA 2PBCA 2K8IA 3O5MA 3VAWA 1FKIA 2LKNA 2DG9A 2M2AA 3JYMA 4DRIA 4FN2A 1FKGA 4IQ2A 5HUAA 4LAVA 2MLZA 3PRDA 3PRBA 3RFWA 4J4OA 3H9RB 4G50A 3UQBA 4DRQA 4TYOA 2Y78A 3FAPA 5GPGA 1NSGA 1ROUA 1ZK6A 2MLYA 2VCDA 1A7XA 3JYJA 1Q6IA 2PV1A 1FKHA 2ZQTA 3NI6A 4R0XA 3RGCA 2ZR4A 1PINA 3KABA 5HKGA 1Q1CA 1ROTA 5HW7A 1FKLA 1TCOC 2XP3A 3O5PA 1N1AA 4TNSA 3O5DA 4JFMA 4DROA 4ODLA 4GGQA 2ZQUA 3NTPA 4U84A 2PPNA 1FKKA 3O5EA 4IQCA 3UQAA 4N19A 2MLXA 2F2DA 3UQIA 4W9QA 1FAPA 2ZQSA 4JFLA 5DIVA 4DRKA 1F8AB 4NNRA 1QPFA 2D9FA 1JNTA 2AWGA 1FJDA 2L2SA 1FKTA 3I6CA 1NMVA 2XP4A 4IPXA 4QIBA 2PV3A 3KAIA 3EY6A 4LAYA 1BL4A 2RURA 3O5RA 2MF9A 4DZ2A 3TC5A 1QZ2A 3UI6A 2UZ5A 2KGJA 3JXVA 3O5KA 4ITZA 4DIPA 3O5OA 2RSEA 4DH0A 1QPLA 2PPPA 4FAPA 2N87A 3CGNA 4DT4A 4J4NA 4ODMA 3KAHA 5HWCA 2ZR5A 2IF4A 2FKEA 2PPOA 2XPBA 4O2TA 5B8IC 3OOBA 1YW5A 1J4IA 1R9HA 2Q5AA 4QT2A 1B6CA 5DIUA 2M08A 1D7HA 4LAXA 5I98A 4TW8A 2RQSA 3TDBA 5J6EA 4ODQA 4ODOA 2KO7A 3KCEA 3O5JA 4DRJA 3KACA 1C9HA 2KR7A 2RUCA 4LAWA 1M5YA 4ODKA 3LUOA 4TW7A 4JYSA 1J4RA 2KI3A 2M1IA 3CGMA 4G2PA 2XP5A 3GPKA 2FAPA 1PBKA 3UI4A 1Y0OA 4C02B 5DITA 4DZ3A 1F40A 3IHZA 4W9OA 5HW6A 2RUQA 1W26A 2ZQVA 1T11A 2XP8A 3O5IA 2MPHA 5HT1A 1L1PA 3O5QA 1J6YA 1FKSA 2LPVA
chains in the Genus database with same CATH superfamily
2MNTA 3ODKA 4LGXA 1FFQA 4DRPA 3NRKA 5HW6A 4PTMA 1KT1A 1ZBWA 2PV2A 3AS3A 4TX0A 1KT0A 4MGVA 1LL6A 4JFJA 3AS2A 2JZVA 5HWBA 4WKAA 2DSUA 1H0GA 4QT3A 4MSPA 1FKDA 2F4EA 3UI5A 1W1YA 3AROA 4ODPA 3WQWA 2PI6A 1EHNA 1Q6HA 3W4RA 3PA7A 4U85A 4JFKA 2OFNA 4WJXA 2DG3A 4IT6A 2LGOA 1P5QA 4DRHA 1LL7A 1W1TA 5BXJA 2PBCA 3JYMA 4DRIA 3RM8A 3ARYA 2MLZA 1HJXA 4J4OA 3OA5A 4TYOA 2Y78A 3FAPA 1NSGA 1E44A 1A7XA 4R0XA 1Q6IA 1FKHA 4MTVA 3KABA 2G8ZA 5HKGA 1FKLA 2ESCA 4TNSA 1NWTA 4DROA 3WD0A 4IQCA 3G6MA 1LJYA 3ARPA 3AQUA 1F8AB 3WD4A 1TFVA 1ZU8A 1JNTA 4LAYA 1BL4A 3O5RA 3TC5A 1XHGA 1QZ2A 1IX5A 4Z2IA 1E9LA 4DIPA 1QPLA 2WLYA 4HBOA 4J4NA 5GQBA 1WAWA 2ZR5A 2IF4A 2FKEA 4O2TA 5B8IC 1YW5A 1R9HA 1W9VA 2Q5AA 3PR9A 1B6CA 4URIA 1GUVA 4XAKA 3TDBA 5J6EA 4ODQA 3WIJA 4ODOA 3WD1A 1OWQA 1XRVA 2RUCA 3ARUA 3EIPA 3CGMA 4C02B 3GPKA 1PBKA 3UI4A 4W5UA 1F40A 3IHZA 2YBUA 2ZQVA 4Q22A 3O5QA 1K9TA 2LPVA 3IK8A 3B9DA 3ALFA 5DO2A 4MNLA 3FXYA 3CHCA 4ODNA 3ARRA 1ZBKA 3GTYX 2G41A 4P8WA 2DT2A 2F23A 1NH6A 2EULA 2KFWA 4Z2HA 1NWRA 1D7IA 5DEZA 1HKJA 3WD3A 3IKDA 5HTGA 1FKRA 1X6LA 1UR9A 4U86A 4DWSA 5D75A 4ODRA 4WKFA 3TCZA 1HXVA 2WK2A 1ZL1A 2K8IA 2LKNA 2DG9A 2M2AA 1FKGA 2B5UB 2P4VA 4IQ2A 4LAVA 3PRDA 1JNDA 3RFWA 2A3CA 3CH9A 3UQBA 2DT1A 2A3BA 5GPGA 2MLYA 4DWSD 4KQZA 5HW7A 3ARTA 1W1PA 5JH8A 3O5DA 4U84A 1FKKA 4KR0B 1ZBVA 3UQIA 2WLZA 2ZQSA 4JFLA 4QZVB 1OGBA 4P8VA 3EY6A 3WL1A 3CZ8A 2RURA 3UI6A 4WKHA 3RM9A 3O5KA 3B8SA 2PPPA 4FAPA 4MNMA 5HWCA 1LQ0A 3OOBA 4QT2A 1J4IA 5DIUA 3ARZA 4MNJA 4MAVA 3KCEA 2DSVA 4Q7NA 3BXWA 3QOKA 1RD6A 3KACA 1CTNA 3B9AA 4LAWA 1LL4A 4JYSA 1J4RA 4DZ3A 2FAPA 4HBEA 1LG2A 1JCHB 1W26A 1T11A 3O5IA 2B31A 1L1PA 1J6YA 2IUZA 2LJ4A 4UDMA 3KADA 2XP7A 2F21A 1KFWA 2XP9A 4WIWA 4ML4A 2XPAA 3GU0A 4DWSB 2ZR6A 1FKBA 4BF8A 1NMWA 1W9PA 3UF8A 2KE0A 2A3AA 4GIVA 4S3JA 3O5FA 1J4HA 4DWSC 2O9OA 1FD9A 4W9PA 1X6NA 3KAFA 4WK9A 1LG1A 3AS0A 4S3KA 3MDYB 4NSBA 2ITKA 1E6RA 1D7JA 3O5GA 1SYTA 3RMEA 4Z2LA 1YATA 2RUDA 3O5MA 1FKIA 4Z2JA 4FN2A 3ARXA 2YBTA 3H9RB 2AOSA 1HKIA 4DRQA 2DT0A 1ZK6A 3WKZA 2VCDA 2ZQTA 3NI6A 2ZR4A 4Z2KA 1Q1CA 4IT4A 4L72B 1TCOC 2XP3A 3O5PA 2DSZA 2ZQUA 3NTPA 3O5EA 3UQAA 2MLXA 2F2DA 4W9QA 1JNEA 1FAPA 5DIVA 4DRKA 1SR0A 1QPFA 1VF8A 2L2SA 3I6CA 1NMVA 2XP4A 4QIBA 2PV3A 2ETNA 5GPRA 1WNOA 3ARSA 2QF8A 2A3EA 2UZ5A 4AY1A 3O5OA 2RSEA 5HBFA 2N87A 4DT4A 4ODMA 2XPBA 1D7HA 4LAXA 1GOIA 2KO7A 4DRJA 1C9HA 1M5YA 1ITXA 4ODKA 3LUOA 3CHFA 4TW7A 1GRJA 2KI3A 4G2PA 1W1VA 2M1IA 3CHEA 2XP5A 1Y0OA 2RUQA 4P8UA 2MPHA 1EDQA 4TW6A 1HKKA 1FKJA 3FY1A 5HW8A 3ARWA 3B9EA 2OLHA 1D6OA 2DG4A 4DRNA 1JNSA 4JFIA 3B7XA 1EQ3A 3KAGA 1Q6UA 1EYMA 2DT3A 3IKGA 3O5LA 4NZCA 4Z2GA 1U79A 1ZB5A 3KZ7A 4HARA 3PRAA 2XP6A 1BKFA 1JVWA 3ARVA 1FKFA 1ZCNA 2VN1A 4DRMA 3WH0A 3ALGA 1GPFA 3VAWA 4ZPVR 4ZS6A 5HUAA 3PRBA 4G50A 1O6IA 1E6NA 5DF0A 1ROUA 4R5EA 2DSWA 3JYJA 2FDMA 1E15A 2PV1A 3RGCA 1PINA 1W9UA 1ROTA 1N1AA 1NWUA 4JFMA 4ODLA 2DPEA 4GGQA 2PPNA 3AS1A 3G6LA 3ARQA 4N19A 1E6PA 4NNRA 1HKMA 2D9FA 2AWGA 1FJDA 1FKTA 4IPXA 1OGGA 3RM4A 3KAIA 1EIBA 2O92A 2MF9A 4DZ2A 4P8XA 4ZPTR 2KGJA 3JXVA 4ITZA 3BMBA 1HJWA 4MPKA 1FFRA 4MNKA 4DH0A 2WM0A 1H0IA 3CGNA 1E6ZA 3KAHA 3WL0A 2PPOA 4ZPWR 2M08A 3CHDA 5I98A 4TW8A 2RQSA 1D2KA 1UR8A 3WD2A 3O5JA 1NWSA 1WB0A 2KR7A 1ZBCA 5DITA 4L3NA 1HJVA 4W9OA 2XP8A 2PN0A 3WQVA 5HT1A 1FKSA
chains in the Genus database with same CATH topology
2MNTA 3ODKA 4LGXA 1FFQA 4DRPA 3NRKA 5HW6A 4PTMA 1KT1A 1ZBWA 2PV2A 3AS3A 4TX0A 1KT0A 4MGVA 1LL6A 4JFJA 3AS2A 2JZVA 5HWBA 4WKAA 2DSUA 1H0GA 4QT3A 4MSPA 1FKDA 2F4EA 3UI5A 1W1YA 3AROA 4ODPA 3WQWA 2PI6A 1EHNA 1Q6HA 3W4RA 3PA7A 4U85A 4JFKA 2OFNA 4WJXA 2DG3A 4IT6A 2LGOA 1P5QA 4DRHA 1LL7A 1W1TA 5BXJA 2PBCA 3JYMA 4DRIA 3RM8A 3ARYA 2MLZA 1HJXA 4J4OA 3OA5A 4TYOA 2Y78A 3FAPA 1NSGA 1A7XA 4R0XA 1Q6IA 1FKHA 4MTVA 3KABA 2G8ZA 5HKGA 1FKLA 2ESCA 4TNSA 1NWTA 4DROA 3WD0A 4IQCA 3G6MA 1LJYA 3ARPA 3AQUA 1F8AB 3WD4A 1TFVA 1ZU8A 1JNTA 4LAYA 1BL4A 3O5RA 3TC5A 1XHGA 1QZ2A 1IX5A 4Z2IA 1E9LA 4DIPA 1QPLA 2WLYA 4HBOA 4J4NA 5GQBA 1WAWA 2ZR5A 2IF4A 2FKEA 4O2TA 5B8IC 1YW5A 1R9HA 1W9VA 2Q5AA 3PR9A 1B6CA 4URIA 1GUVA 4XAKA 3TDBA 5J6EA 4ODQA 3WIJA 4ODOA 3WD1A 1OWQA 1XRVA 2RUCA 3ARUA 3CGMA 4C02B 3GPKA 1PBKA 3UI4A 4W5UA 1F40A 3IHZA 2YBUA 2ZQVA 4Q22A 3O5QA 1K9TA 2LPVA 3IK8A 3B9DA 3ALFA 5DO2A 4MNLA 3FXYA 3CHCA 4ODNA 3ARRA 1ZBKA 4P8WA 2G41A 2DT2A 1NH6A 2KFWA 4Z2HA 1NWRA 1D7IA 5DEZA 1HKJA 3WD3A 3IKDA 5HTGA 1FKRA 1X6LA 1UR9A 4U86A 4DWSA 5D75A 4ODRA 4WKFA 3TCZA 1HXVA 2WK2A 1ZL1A 2K8IA 2LKNA 2DG9A 2M2AA 1FKGA 4IQ2A 4LAVA 3PRDA 1JNDA 3RFWA 2A3CA 3CH9A 3UQBA 2DT1A 2A3BA 5GPGA 2MLYA 4DWSD 4KQZA 5HW7A 3ARTA 1W1PA 5JH8A 3O5DA 4U84A 1FKKA 4KR0B 1ZBVA 3UQIA 2WLZA 2ZQSA 4JFLA 4QZVB 1OGBA 4P8VA 3EY6A 3WL1A 3CZ8A 2RURA 3UI6A 4WKHA 3RM9A 3O5KA 3B8SA 2PPPA 4FAPA 4MNMA 5HWCA 1LQ0A 3OOBA 4QT2A 1J4IA 5DIUA 3ARZA 4MNJA 4MAVA 3KCEA 2DSVA 4Q7NA 3BXWA 3QOKA 1RD6A 3KACA 1CTNA 3B9AA 4LAWA 1LL4A 4JYSA 1J4RA 4DZ3A 2FAPA 4HBEA 1LG2A 1W26A 1T11A 3O5IA 2B31A 1L1PA 1J6YA 2IUZA 2LJ4A 3KADA 2XP7A 2F21A 1KFWA 2XP9A 4WIWA 4ML4A 2XPAA 4DWSB 2ZR6A 1FKBA 4BF8A 1NMWA 1W9PA 3UF8A 2KE0A 2A3AA 4GIVA 4S3JA 3O5FA 1J4HA 4DWSC 2O9OA 1FD9A 4W9PA 1X6NA 3KAFA 4WK9A 1LG1A 3AS0A 4S3KA 3MDYB 4NSBA 2ITKA 1E6RA 1D7JA 3O5GA 1SYTA 3RMEA 4Z2LA 1YATA 2RUDA 3O5MA 1FKIA 4Z2JA 4FN2A 3ARXA 2YBTA 3H9RB 2AOSA 1HKIA 4DRQA 2DT0A 1ZK6A 3WKZA 2VCDA 2ZQTA 3NI6A 2ZR4A 4Z2KA 1Q1CA 4IT4A 4L72B 1TCOC 2XP3A 3O5PA 2DSZA 2ZQUA 3NTPA 3O5EA 3UQAA 2MLXA 2F2DA 4W9QA 1JNEA 1FAPA 5DIVA 4DRKA 1SR0A 1QPFA 1VF8A 2L2SA 3I6CA 1NMVA 2XP4A 4QIBA 2PV3A 5GPRA 1WNOA 3ARSA 2QF8A 2A3EA 2UZ5A 4AY1A 3O5OA 2RSEA 5HBFA 2N87A 4DT4A 4ODMA 2XPBA 1D7HA 4LAXA 1GOIA 2KO7A 4DRJA 1C9HA 1M5YA 1ITXA 4ODKA 3LUOA 3CHFA 4TW7A 2KI3A 4G2PA 1W1VA 2M1IA 3CHEA 2XP5A 1Y0OA 2RUQA 4P8UA 2MPHA 1EDQA 4TW6A 1HKKA 1FKJA 3FY1A 5HW8A 3ARWA 3B9EA 2OLHA 1D6OA 2DG4A 4DRNA 1JNSA 4JFIA 3B7XA 1EQ3A 3KAGA 1Q6UA 1EYMA 2DT3A 3IKGA 3O5LA 4NZCA 4Z2GA 1U79A 1ZB5A 3KZ7A 4HARA 3PRAA 2XP6A 1BKFA 1JVWA 3ARVA 1FKFA 1ZCNA 2VN1A 4DRMA 3WH0A 3ALGA 1GPFA 3VAWA 4ZPVR 4ZS6A 5HUAA 3PRBA 4G50A 1O6IA 1E6NA 5DF0A 1ROUA 4R5EA 2DSWA 3JYJA 2FDMA 1E15A 2PV1A 3RGCA 1PINA 1W9UA 1ROTA 1N1AA 1NWUA 4JFMA 4ODLA 2DPEA 4GGQA 2PPNA 3AS1A 3G6LA 3ARQA 4N19A 1E6PA 4NNRA 1HKMA 2D9FA 2AWGA 1FJDA 1FKTA 4IPXA 1OGGA 3RM4A 3KAIA 1EIBA 2O92A 2MF9A 4DZ2A 4P8XA 4ZPTR 2KGJA 3JXVA 4ITZA 1HJWA 4MPKA 1FFRA 4MNKA 4DH0A 2WM0A 1H0IA 3CGNA 1E6ZA 3KAHA 3WL0A 2PPOA 4ZPWR 2M08A 3CHDA 5I98A 4TW8A 2RQSA 1D2KA 1UR8A 3WD2A 3O5JA 1NWSA 1WB0A 2KR7A 1ZBCA 5DITA 4L3NA 1HJVA 4W9OA 2XP8A 3WQVA 5HT1A 1FKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKJ A;  3IK8 A;  5HW8 A;  2MNT A;  2LJ4 A;  3KAD A;  4ODN A;  3ODK A;  2XP7 A;  2F21 A;  4TW6 A;  1D6O A;  2XP9 A;  4DRP A;  2XPA A;  2DG4 A;  3NRK A;  4DRN A;  2ZR6 A;  1KT1 A;  4JFI A;  1FKB A;  2PV2 A;  1NMW A;  3B7X A;  4BF8 A;  1JNS A;  1EQ3 A;  3UF8 A;  4TX0 A;  2KE0 A;  2KFW A;  3KAG A;  1KT0 A;  1Q6U A;  1EYM A;  4MGV A;  1D7I A;  4JFJ A;  3IKG A;  3O5L A;  4GIV A;  1U79 A;  2JZV A;  5HWB A;  3O5F A;  1J4H A;  4QT3 A;  3KZ7 A;  4MSP A;  1FD9 A;  1FKD A;  2F4E A;  4W9P A;  3UI5 A;  3IKD A;  4ODP A;  3KAF A;  5HTG A;  1FKR A;  1Q6H A;  2XP6 A;  3PA7 A;  4U86 A;  5D75 A;  4ODR A;  1BKF A;  1JVW A;  4U85 A;  3MDY B;  4JFK A;  2OFN A;  1FKF A;  3TCZ A;  2DG3 A;  1ZCN A;  2VN1 A;  2ITK A;  2LGO A;  1P5Q A;  1D7J A;  4DRH A;  3O5G A;  1HXV A;  4DRM A;  3WH0 A;  5BXJ A;  1YAT A;  2RUD A;  2PBC A;  2K8I A;  3O5M A;  3VAW A;  1FKI A;  2LKN A;  2DG9 A;  2M2A A;  3JYM A;  4DRI A;  4FN2 A;  1FKG A;  4IQ2 A;  5HUA A;  4LAV A;  2MLZ A;  3PRD A;  3PRB A;  3RFW A;  4J4O A;  3H9R B;  4G50 A;  3UQB A;  4DRQ A;  4TYO A;  2Y78 A;  3FAP A;  5GPG A;  1NSG A;  1ROU A;  1ZK6 A;  2MLY A;  2VCD A;  1A7X A;  3JYJ A;  1Q6I A;  2PV1 A;  1FKH A;  2ZQT A;  3NI6 A;  4R0X A;  3RGC A;  2ZR4 A;  1PIN A;  3KAB A;  5HKG A;  1Q1C A;  1ROT A;  5HW7 A;  1FKL A;  1TCO C;  2XP3 A;  3O5P A;  1N1A A;  4TNS A;  3O5D A;  4JFM A;  4DRO A;  4ODL A;  4GGQ A;  2ZQU A;  3NTP A;  4U84 A;  2PPN A;  1FKK A;  3O5E A;  4IQC A;  3UQA A;  4N19 A;  2MLX A;  2F2D A;  3UQI A;  4W9Q A;  1FAP A;  2ZQS A;  4JFL A;  5DIV A;  4DRK A;  1F8A B;  4NNR A;  1QPF A;  2D9F A;  1JNT A;  2AWG A;  1FJD A;  2L2S A;  1FKT A;  3I6C A;  1NMV A;  2XP4 A;  4IPX A;  4QIB A;  2PV3 A;  3KAI A;  3EY6 A;  4LAY A;  1BL4 A;  2RUR A;  3O5R A;  2MF9 A;  4DZ2 A;  3TC5 A;  1QZ2 A;  3UI6 A;  2UZ5 A;  2KGJ A;  3JXV A;  3O5K A;  4ITZ A;  4DIP A;  3O5O A;  2RSE A;  4DH0 A;  1QPL A;  2PPP A;  4FAP A;  2N87 A;  3CGN A;  4DT4 A;  4J4N A;  4ODM A;  3KAH A;  5HWC A;  2ZR5 A;  2IF4 A;  2FKE A;  2PPO A;  2XPB A;  4O2T A;  5B8I C;  3OOB A;  1YW5 A;  1J4I A;  1R9H A;  2Q5A A;  4QT2 A;  1B6C A;  5DIU A;  2M08 A;  1D7H A;  4LAX A;  5I98 A;  4TW8 A;  2RQS A;  3TDB A;  5J6E A;  4ODQ A;  4ODO A;  2KO7 A;  3KCE A;  3O5J A;  4DRJ A;  3KAC A;  1C9H A;  2KR7 A;  2RUC A;  4LAW A;  1M5Y A;  4ODK A;  3LUO A;  4TW7 A;  4JYS A;  1J4R A;  2KI3 A;  2M1I A;  3CGM A;  4G2P A;  2XP5 A;  3GPK A;  2FAP A;  1PBK A;  3UI4 A;  1Y0O A;  4C02 B;  5DIT A;  4DZ3 A;  1F40 A;  3IHZ A;  4W9O A;  5HW6 A;  2RUQ A;  1W26 A;  2ZQV A;  1T11 A;  2XP8 A;  3O5I A;  2MPH A;  5HT1 A;  1L1P A;  3O5Q A;  1J6Y A;  1FKS A;  2LPV A; 
#chains in the Genus database with same CATH topology
 2MNT A;  3ODK A;  4LGX A;  1FFQ A;  4DRP A;  3NRK A;  5HW6 A;  4PTM A;  1KT1 A;  1ZBW A;  2PV2 A;  3AS3 A;  4TX0 A;  1KT0 A;  4MGV A;  1LL6 A;  4JFJ A;  3AS2 A;  2JZV A;  5HWB A;  4WKA A;  2DSU A;  1H0G A;  4QT3 A;  4MSP A;  1FKD A;  2F4E A;  3UI5 A;  1W1Y A;  3ARO A;  4ODP A;  3WQW A;  2PI6 A;  1EHN A;  1Q6H A;  3W4R A;  3PA7 A;  4U85 A;  4JFK A;  2OFN A;  4WJX A;  2DG3 A;  4IT6 A;  2LGO A;  1P5Q A;  4DRH A;  1LL7 A;  1W1T A;  5BXJ A;  2PBC A;  3JYM A;  4DRI A;  3RM8 A;  3ARY A;  2MLZ A;  1HJX A;  4J4O A;  3OA5 A;  4TYO A;  2Y78 A;  3FAP A;  1NSG A;  1E44 A;  1A7X A;  4R0X A;  1Q6I A;  1FKH A;  4MTV A;  3KAB A;  2G8Z A;  5HKG A;  1FKL A;  2ESC A;  4TNS A;  1NWT A;  4DRO A;  3WD0 A;  4IQC A;  3G6M A;  1LJY A;  3ARP A;  3AQU A;  1F8A B;  3WD4 A;  1TFV A;  1ZU8 A;  1JNT A;  4LAY A;  1BL4 A;  3O5R A;  3TC5 A;  1XHG A;  1QZ2 A;  1IX5 A;  4Z2I A;  1E9L A;  4DIP A;  1QPL A;  2WLY A;  4HBO A;  4J4N A;  5GQB A;  1WAW A;  2ZR5 A;  2IF4 A;  2FKE A;  4O2T A;  5B8I C;  1YW5 A;  1R9H A;  1W9V A;  2Q5A A;  3PR9 A;  1B6C A;  4URI A;  1GUV A;  4XAK A;  3TDB A;  5J6E A;  4ODQ A;  3WIJ A;  4ODO A;  3WD1 A;  1OWQ A;  1XRV A;  2RUC A;  3ARU A;  3EIP A;  3CGM A;  4C02 B;  3GPK A;  1PBK A;  3UI4 A;  4W5U A;  1F40 A;  3IHZ A;  2YBU A;  2ZQV A;  4Q22 A;  3O5Q A;  1K9T A;  2LPV A;  3IK8 A;  3B9D A;  3ALF A;  5DO2 A;  4MNL A;  3FXY A;  3CHC A;  4ODN A;  3ARR A;  1ZBK A;  3GTY X;  2G41 A;  4P8W A;  2DT2 A;  2F23 A;  1NH6 A;  2EUL A;  2KFW A;  4Z2H A;  1NWR A;  1D7I A;  5DEZ A;  1HKJ A;  3WD3 A;  3IKD A;  5HTG A;  1FKR A;  1X6L A;  1UR9 A;  4U86 A;  4DWS A;  5D75 A;  4ODR A;  4WKF A;  3TCZ A;  1HXV A;  2WK2 A;  1ZL1 A;  2K8I A;  2LKN A;  2DG9 A;  2M2A A;  1FKG A;  2B5U B;  2P4V A;  4IQ2 A;  4LAV A;  3PRD A;  1JND A;  3RFW A;  2A3C A;  3CH9 A;  3UQB A;  2DT1 A;  2A3B A;  5GPG A;  2MLY A;  4DWS D;  4KQZ A;  5HW7 A;  3ART A;  1W1P A;  5JH8 A;  3O5D A;  4U84 A;  1FKK A;  4KR0 B;  1ZBV A;  3UQI A;  2WLZ A;  2ZQS A;  4JFL A;  4QZV B;  1OGB A;  4P8V A;  3EY6 A;  3WL1 A;  3CZ8 A;  2RUR A;  3UI6 A;  4WKH A;  3RM9 A;  3O5K A;  3B8S A;  2PPP A;  4FAP A;  4MNM A;  5HWC A;  1LQ0 A;  3OOB A;  4QT2 A;  1J4I A;  5DIU A;  3ARZ A;  4MNJ A;  4MAV A;  3KCE A;  2DSV A;  4Q7N A;  3BXW A;  3QOK A;  1RD6 A;  3KAC A;  1CTN A;  3B9A A;  4LAW A;  1LL4 A;  4JYS A;  1J4R A;  4DZ3 A;  2FAP A;  4HBE A;  1LG2 A;  1JCH B;  1W26 A;  1T11 A;  3O5I A;  2B31 A;  1L1P A;  1J6Y A;  2IUZ A;  2LJ4 A;  4UDM A;  3KAD A;  2XP7 A;  2F21 A;  1KFW A;  2XP9 A;  4WIW A;  4ML4 A;  2XPA A;  3GU0 A;  4DWS B;  2ZR6 A;  1FKB A;  4BF8 A;  1NMW A;  1W9P A;  3UF8 A;  2KE0 A;  2A3A A;  4GIV A;  4S3J A;  3O5F A;  1J4H A;  4DWS C;  2O9O A;  1FD9 A;  4W9P A;  1X6N A;  3KAF A;  4WK9 A;  1LG1 A;  3AS0 A;  4S3K A;  3MDY B;  4NSB A;  2ITK A;  1E6R A;  1D7J A;  3O5G A;  1SYT A;  3RME A;  4Z2L A;  1YAT A;  2RUD A;  3O5M A;  1FKI A;  4Z2J A;  4FN2 A;  3ARX A;  2YBT A;  3H9R B;  2AOS A;  1HKI A;  4DRQ A;  2DT0 A;  1ZK6 A;  3WKZ A;  2VCD A;  2ZQT A;  3NI6 A;  2ZR4 A;  4Z2K A;  1Q1C A;  4IT4 A;  4L72 B;  1TCO C;  2XP3 A;  3O5P A;  2DSZ A;  2ZQU A;  3NTP A;  3O5E A;  3UQA A;  2MLX A;  2F2D A;  4W9Q A;  1JNE A;  1FAP A;  5DIV A;  4DRK A;  1SR0 A;  1QPF A;  1VF8 A;  2L2S A;  3I6C A;  1NMV A;  2XP4 A;  4QIB A;  2PV3 A;  2ETN A;  5GPR A;  1WNO A;  3ARS A;  2QF8 A;  2A3E A;  2UZ5 A;  4AY1 A;  3O5O A;  2RSE A;  5HBF A;  2N87 A;  4DT4 A;  4ODM A;  2XPB A;  1D7H A;  4LAX A;  1GOI A;  2KO7 A;  4DRJ A;  1C9H A;  1M5Y A;  1ITX A;  4ODK A;  3LUO A;  3CHF A;  4TW7 A;  1GRJ A;  2KI3 A;  4G2P A;  1W1V A;  2M1I A;  3CHE A;  2XP5 A;  1Y0O A;  2RUQ A;  4P8U A;  2MPH A;  1EDQ A;  4TW6 A;  1HKK A;  1FKJ A;  3FY1 A;  5HW8 A;  3ARW A;  3B9E A;  2OLH A;  1D6O A;  2DG4 A;  4DRN A;  1JNS A;  4JFI A;  3B7X A;  1EQ3 A;  3KAG A;  1Q6U A;  1EYM A;  2DT3 A;  3IKG A;  3O5L A;  4NZC A;  4Z2G A;  1U79 A;  1ZB5 A;  3KZ7 A;  4HAR A;  3PRA A;  2XP6 A;  1BKF A;  1JVW A;  3ARV A;  1FKF A;  1ZCN A;  2VN1 A;  4DRM A;  3WH0 A;  3ALG A;  1GPF A;  3VAW A;  4ZPV R;  4ZS6 A;  5HUA A;  3PRB A;  4G50 A;  1O6I A;  1E6N A;  5DF0 A;  1ROU A;  4R5E A;  2DSW A;  3JYJ A;  2FDM A;  1E15 A;  2PV1 A;  3RGC A;  1PIN A;  1W9U A;  1ROT A;  1N1A A;  1NWU A;  4JFM A;  4ODL A;  2DPE A;  4GGQ A;  2PPN A;  3AS1 A;  3G6L A;  3ARQ A;  4N19 A;  1E6P A;  4NNR A;  1HKM A;  2D9F A;  2AWG A;  1FJD A;  1FKT A;  4IPX A;  1OGG A;  3RM4 A;  3KAI A;  1EIB A;  2O92 A;  2MF9 A;  4DZ2 A;  4P8X A;  4ZPT R;  2KGJ A;  3JXV A;  4ITZ A;  3BMB A;  1HJW A;  4MPK A;  1FFR A;  4MNK A;  4DH0 A;  2WM0 A;  1H0I A;  3CGN A;  1E6Z A;  3KAH A;  3WL0 A;  2PPO A;  4ZPW R;  2M08 A;  3CHD A;  5I98 A;  4TW8 A;  2RQS A;  1D2K A;  1UR8 A;  3WD2 A;  3O5J A;  1NWS A;  1WB0 A;  2KR7 A;  1ZBC A;  5DIT A;  4L3N A;  1HJV A;  4W9O A;  2XP8 A;  2PN0 A;  3WQV A;  5HT1 A;  1FKS A; 
#chains in the Genus database with same CATH homology
 2MNT A;  3ODK A;  4LGX A;  1FFQ A;  4DRP A;  3NRK A;  5HW6 A;  4PTM A;  1KT1 A;  1ZBW A;  2PV2 A;  3AS3 A;  4TX0 A;  1KT0 A;  4MGV A;  1LL6 A;  4JFJ A;  3AS2 A;  2JZV A;  5HWB A;  4WKA A;  2DSU A;  1H0G A;  4QT3 A;  4MSP A;  1FKD A;  2F4E A;  3UI5 A;  1W1Y A;  3ARO A;  4ODP A;  3WQW A;  2PI6 A;  1EHN A;  1Q6H A;  3W4R A;  3PA7 A;  4U85 A;  4JFK A;  2OFN A;  4WJX A;  2DG3 A;  4IT6 A;  2LGO A;  1P5Q A;  4DRH A;  1LL7 A;  1W1T A;  5BXJ A;  2PBC A;  3JYM A;  4DRI A;  3RM8 A;  3ARY A;  2MLZ A;  1HJX A;  4J4O A;  3OA5 A;  4TYO A;  2Y78 A;  3FAP A;  1NSG A;  1A7X A;  4R0X A;  1Q6I A;  1FKH A;  4MTV A;  3KAB A;  2G8Z A;  5HKG A;  1FKL A;  2ESC A;  4TNS A;  1NWT A;  4DRO A;  3WD0 A;  4IQC A;  3G6M A;  1LJY A;  3ARP A;  3AQU A;  1F8A B;  3WD4 A;  1TFV A;  1ZU8 A;  1JNT A;  4LAY A;  1BL4 A;  3O5R A;  3TC5 A;  1XHG A;  1QZ2 A;  1IX5 A;  4Z2I A;  1E9L A;  4DIP A;  1QPL A;  2WLY A;  4HBO A;  4J4N A;  5GQB A;  1WAW A;  2ZR5 A;  2IF4 A;  2FKE A;  4O2T A;  5B8I C;  1YW5 A;  1R9H A;  1W9V A;  2Q5A A;  3PR9 A;  1B6C A;  4URI A;  1GUV A;  4XAK A;  3TDB A;  5J6E A;  4ODQ A;  3WIJ A;  4ODO A;  3WD1 A;  1OWQ A;  1XRV A;  2RUC A;  3ARU A;  3CGM A;  4C02 B;  3GPK A;  1PBK A;  3UI4 A;  4W5U A;  1F40 A;  3IHZ A;  2YBU A;  2ZQV A;  4Q22 A;  3O5Q A;  1K9T A;  2LPV A;  3IK8 A;  3B9D A;  3ALF A;  5DO2 A;  4MNL A;  3FXY A;  3CHC A;  4ODN A;  3ARR A;  1ZBK A;  4P8W A;  2G41 A;  2DT2 A;  1NH6 A;  2KFW A;  4Z2H A;  1NWR A;  1D7I A;  5DEZ A;  1HKJ A;  3WD3 A;  3IKD A;  5HTG A;  1FKR A;  1X6L A;  1UR9 A;  4U86 A;  4DWS A;  5D75 A;  4ODR A;  4WKF A;  3TCZ A;  1HXV A;  2WK2 A;  1ZL1 A;  2K8I A;  2LKN A;  2DG9 A;  2M2A A;  1FKG A;  4IQ2 A;  4LAV A;  3PRD A;  1JND A;  3RFW A;  2A3C A;  3CH9 A;  3UQB A;  2DT1 A;  2A3B A;  5GPG A;  2MLY A;  4DWS D;  4KQZ A;  5HW7 A;  3ART A;  1W1P A;  5JH8 A;  3O5D A;  4U84 A;  1FKK A;  4KR0 B;  1ZBV A;  3UQI A;  2WLZ A;  2ZQS A;  4JFL A;  4QZV B;  1OGB A;  4P8V A;  3EY6 A;  3WL1 A;  3CZ8 A;  2RUR A;  3UI6 A;  4WKH A;  3RM9 A;  3O5K A;  3B8S A;  2PPP A;  4FAP A;  4MNM A;  5HWC A;  1LQ0 A;  3OOB A;  4QT2 A;  1J4I A;  5DIU A;  3ARZ A;  4MNJ A;  4MAV A;  3KCE A;  2DSV A;  4Q7N A;  3BXW A;  3QOK A;  1RD6 A;  3KAC A;  1CTN A;  3B9A A;  4LAW A;  1LL4 A;  4JYS A;  1J4R A;  4DZ3 A;  2FAP A;  4HBE A;  1LG2 A;  1W26 A;  1T11 A;  3O5I A;  2B31 A;  1L1P A;  1J6Y A;  2IUZ A;  2LJ4 A;  3KAD A;  2XP7 A;  2F21 A;  1KFW A;  2XP9 A;  4WIW A;  4ML4 A;  2XPA A;  4DWS B;  2ZR6 A;  1FKB A;  4BF8 A;  1NMW A;  1W9P A;  3UF8 A;  2KE0 A;  2A3A A;  4GIV A;  4S3J A;  3O5F A;  1J4H A;  4DWS C;  2O9O A;  1FD9 A;  4W9P A;  1X6N A;  3KAF A;  4WK9 A;  1LG1 A;  3AS0 A;  4S3K A;  3MDY B;  4NSB A;  2ITK A;  1E6R A;  1D7J A;  3O5G A;  1SYT A;  3RME A;  4Z2L A;  1YAT A;  2RUD A;  3O5M A;  1FKI A;  4Z2J A;  4FN2 A;  3ARX A;  2YBT A;  3H9R B;  2AOS A;  1HKI A;  4DRQ A;  2DT0 A;  1ZK6 A;  3WKZ A;  2VCD A;  2ZQT A;  3NI6 A;  2ZR4 A;  4Z2K A;  1Q1C A;  4IT4 A;  4L72 B;  1TCO C;  2XP3 A;  3O5P A;  2DSZ A;  2ZQU A;  3NTP A;  3O5E A;  3UQA A;  2MLX A;  2F2D A;  4W9Q A;  1JNE A;  1FAP A;  5DIV A;  4DRK A;  1SR0 A;  1QPF A;  1VF8 A;  2L2S A;  3I6C A;  1NMV A;  2XP4 A;  4QIB A;  2PV3 A;  5GPR A;  1WNO A;  3ARS A;  2QF8 A;  2A3E A;  2UZ5 A;  4AY1 A;  3O5O A;  2RSE A;  5HBF A;  2N87 A;  4DT4 A;  4ODM A;  2XPB A;  1D7H A;  4LAX A;  1GOI A;  2KO7 A;  4DRJ A;  1C9H A;  1M5Y A;  1ITX A;  4ODK A;  3LUO A;  3CHF A;  4TW7 A;  2KI3 A;  4G2P A;  1W1V A;  2M1I A;  3CHE A;  2XP5 A;  1Y0O A;  2RUQ A;  4P8U A;  2MPH A;  1EDQ A;  4TW6 A;  1HKK A;  1FKJ A;  3FY1 A;  5HW8 A;  3ARW A;  3B9E A;  2OLH A;  1D6O A;  2DG4 A;  4DRN A;  1JNS A;  4JFI A;  3B7X A;  1EQ3 A;  3KAG A;  1Q6U A;  1EYM A;  2DT3 A;  3IKG A;  3O5L A;  4NZC A;  4Z2G A;  1U79 A;  1ZB5 A;  3KZ7 A;  4HAR A;  3PRA A;  2XP6 A;  1BKF A;  1JVW A;  3ARV A;  1FKF A;  1ZCN A;  2VN1 A;  4DRM A;  3WH0 A;  3ALG A;  1GPF A;  3VAW A;  4ZPV R;  4ZS6 A;  5HUA A;  3PRB A;  4G50 A;  1O6I A;  1E6N A;  5DF0 A;  1ROU A;  4R5E A;  2DSW A;  3JYJ A;  2FDM A;  1E15 A;  2PV1 A;  3RGC A;  1PIN A;  1W9U A;  1ROT A;  1N1A A;  1NWU A;  4JFM A;  4ODL A;  2DPE A;  4GGQ A;  2PPN A;  3AS1 A;  3G6L A;  3ARQ A;  4N19 A;  1E6P A;  4NNR A;  1HKM A;  2D9F A;  2AWG A;  1FJD A;  1FKT A;  4IPX A;  1OGG A;  3RM4 A;  3KAI A;  1EIB A;  2O92 A;  2MF9 A;  4DZ2 A;  4P8X A;  4ZPT R;  2KGJ A;  3JXV A;  4ITZ A;  1HJW A;  4MPK A;  1FFR A;  4MNK A;  4DH0 A;  2WM0 A;  1H0I A;  3CGN A;  1E6Z A;  3KAH A;  3WL0 A;  2PPO A;  4ZPW R;  2M08 A;  3CHD A;  5I98 A;  4TW8 A;  2RQS A;  1D2K A;  1UR8 A;  3WD2 A;  3O5J A;  1NWS A;  1WB0 A;  2KR7 A;  1ZBC A;  5DIT A;  4L3N A;  1HJV A;  4W9O A;  2XP8 A;  3WQV A;  5HT1 A;  1FKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...