2DG3A

Wildtype fk506-binding protein complexed with rapamycin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 23
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg3A00
3IK8A 5GPGA 2RUQA 5HWBA 1F40A 3UI5A 4BF8A 5DIUA 3NI6A 1U79A 2MPHA 4GGQA 1HXVA 2DG3A 1YW5A 4QT2A 3KAFA 3UI4A 3O5QA 4IQCA 2LPVA 4GIVA 1D7HA 3PRBA 1KT0A 2MLXA 5HKGA 5HWCA 4U86A 3TDBA 1YATA 2FKEA 1FD9A 4W9PA 3VAWA 4QIBA 2ZQVA 2PV3A 4TNSA 4NNRA 4TW6A 2PPPA 3O5LA 1ROTA 3TCZA 4LAWA 1EYMA 5HT1A 1FKDA 4MGVA 2K8IA 2ZR4A 1Y0OA 3LUOA 1KT1A 3CGMA 3RGCA 4MSPA 4O2TA 1QPFA 3O5JA 1FJDA 1Q6HA 2PPOA 4IPXA 2AWGA 4TW7A 3O5DA 1NMVA 1D7IA 2XP4A 3PA7A 4DRHA 3JYMA 4FN2A 3WH0A 2PBCA 3KCEA 4DRNA 1JNTA 3I6CA 1B6CA 4ODLA 3KADA 3O5PA 2RQSA 1Q6UA 3IKGA 4TW8A 1ROUA 2Y78A 3O5KA 3OOBA 2OFNA 4IQ2A 4N19A 4ITZA 1PBKA 1J6YA 2ZR5A 2D9FA 2DG4A 3CGNA 1W26A 1FKRA 2M2AA 1FKLA 2F4EA 5DIVA 2LJ4A 4DROA 2ITKA 1J4RA 2KI3A 2XP8A 1ZCNA 4J4NA 3MDYB 2PV2A 4ODRA 4DRQA 2XPBA 3FAPA 2IF4A 3RFWA 1FKBA 3TC5A 1R9HA 3KABA 4ODKA 5I98A 1BL4A 1F8AB 2XP3A 3NRKA 2Q5AA 5BXJA 4J4OA 4G50A 4DT4A 2PV1A 5HW6A 4W9QA 2RUDA 2RURA 2ZQTA 2XP9A 2F2DA 2MNTA 2VCDA 4JFIA 4LAYA 1FKGA 1N1AA 4ODPA 2XPAA 1FAPA 4DIPA 5B8IC 1EQ3A 2XP5A 3UI6A 3KAHA 1NSGA 3KAGA 3H9RB 5D75A 1QPLA 2N87A 1FKIA 4QT3A 4DH0A 2JZVA 1FKHA 1L1PA 2KR7A 1A7XA 1TCOC 5J6EA 2DG9A 4ODMA 3EY6A 4U84A 5HTGA 4TX0A 4G2PA 1JNSA 1D6OA 3O5RA 4ODQA 2KO7A 2LGOA 3KAIA 2PPNA 1P5QA 5HUAA 3JYJA 3ODKA 1QZ2A 1FKFA 2ZQSA 4DZ2A 4U85A 2FAPA 1PINA 3KACA 3PRDA 1M5YA 2LKNA 2ZR6A 4DRMA 1D7JA 1FKTA 1C9HA 3JXVA 1J4IA 1J4HA 4LAXA 3UQAA 4DRJA 4DRKA 2UZ5A 1Q6IA 4ODOA 2L2SA 3O5GA 3UQIA 4W9OA 1FKSA 3KZ7A 3NTPA 3IKDA 4JYSA 1Q1CA 2XP6A 4DRIA 4JFLA 4DRPA 1BKFA 2KGJA 4JFKA 2RSEA 4C02B 3O5OA 3O5MA 4ODNA 3GPKA 5HW7A 3UF8A 4FAPA 2MLZA 2KFWA 4LAVA 5DITA 1JVWA 1FKJA 2ZQUA 2KE0A 2RUCA 2VN1A 3B7XA 3O5FA 4TYOA 3UQBA 2M08A 2MF9A 4JFJA 1T11A 4JFMA 4DZ3A 2M1IA 3O5IA 2XP7A 2F21A 3IHZA 3O5EA 5HW8A 4R0XA 1NMWA 1ZK6A 2MLYA 1FKKA
chains in the Genus database with same CATH superfamily
1F40A 1U79A 4GGQA 4QT2A 3UI4A 4DWSA 2DPEA 4W5UA 4GIVA 3PRBA 4QZVB 4P8VA 5HKGA 3TDBA 1YATA 1FD9A 1FFQA 2ZQVA 3AS0A 4NNRA 4TW6A 1EYMA 1FKDA 4O2TA 4MNLA 3O5JA 1FJDA 1Q6HA 2PPOA 5DO2A 3O5DA 3WD0A 2XP4A 1LJYA 3FXYA 4ODLA 3AROA 2P4VA 2Y78A 5GQBA 4IQ2A 1J6YA 1E6ZA 1E9LA 2ZR5A 1XHGA 1ZB5A 3PR9A 4KQZA 3RM8A 3G6MA 5DIVA 2ETNA 2ITKA 4UDMA 4ODRA 2PV2A 3WD3A 2IF4A 1R9HA 3KABA 4ODKA 4Q22A 1OWQA 3NRKA 4DWSC 2ZQTA 2F2DA 2MNTA 4LAYA 1JCHB 1N1AA 4ODPA 5B8IC 2DT3A 1D2KA 2XP5A 4P8UA 1EIBA 5D75A 4DH0A 2DSVA 1FKHA 2DG9A 1WNOA 3QOKA 1LL6A 3KAIA 5HUAA 1P5QA 3JYJA 3WQVA 1FKFA 3B8SA 4DZ2A 1M5YA 2LKNA 3JXVA 1J4IA 1J4HA 1W1YA 4DRJA 1UR9A 3UQIA 1JNEA 3KZ7A 3NTPA 1HKMA 3IKDA 2XP6A 4DRIA 4JFLA 2A3EA 1EDQA 2WK2A 3PRAA 4ZS6A 5DITA 1ZBVA 4TYOA 1FKJA 4URIA 2KE0A 1HKJA 1LG2A 1T11A 4DZ3A 1HJVA 3O5EA 1NMWA 1ZK6A 1FKKA 5JH8A 1X6LA 3UI5A 4BF8A 4P8WA 3G6LA 3NI6A 2FDMA 4R5EA 2DG3A 1GRJA 2DSUA 4IQCA 1OGGA 1D7HA 3GU0A 4NZCA 1LL7A 2FKEA 4U86A 3B9EA 2DT1A 3O5LA 4LAWA 3WQWA 4MGVA 2K8IA 1O6IA 2DT0A 5HBFA 3ARPA 4TW7A 1NMVA 1D7IA 1H0IA 4DRHA 3WH0A 4DRNA 1W9UA 3ARVA 1B6CA 1ZBWA 3KADA 4HBEA 3O5PA 1Q6UA 2YBTA 3OOBA 2OFNA 4ITZA 1PBKA 2DG4A 3CGNA 1W26A 1FKLA 4WJXA 2G41A 1J4RA 2KI3A 4J4NA 3MDYB 1KFWA 1F8AB 2XP3A 4DT4A 5DEZA 2PN0A 5HW6A 2RURA 2XP9A 4JFIA 4NSBA 1FKGA 1JNDA 3UI6A 1NSGA 1QPLA 2F23A 3ARUA 1ZU8A 2KR7A 4Z2HA 1A7XA 1TCOC 1GPFA 2IUZA 3RMEA 4L3NA 2DT2A 4TX0A 3O5RA 4ODQA 2LGOA 4XAKA 2ZQSA 3KACA 4MPKA 3CH9A 1D7JA 4LAXA 3UQAA 2UZ5A 2L2SA 3OA5A 4DWSB 2QF8A 4DRPA 3O5OA 3AQUA 4WKAA 2MLZA 3UF8A 2KFWA 1WAWA 1HKIA 4KR0B 2ZQUA 3O5FA 3B7XA 1GUVA 2M08A 3ARYA 2AOSA 4MNJA 2F21A 3BMBA 4R0XA 1E15A 1NWTA 3IK8A 5HWBA 2RUQA 1E44A 2MPHA 1HXVA 1W9PA 2A3AA 2YBUA 1LL4A 4MAVA 3WL0A 4L72B 2WM0A 1W1VA 2MLXA 3ARQA 4MTVA 3W4RA 3ALGA 5HWCA 3ARZA 3VAWA 2PV3A 1IX5A 4WKHA 1ROTA 3CZ8A 5HT1A 1WB0A 2ZR4A 1Y0OA 4WKFA 1KT1A 3RGCA 4MSPA 1W1PA 1QPFA 4DWSD 4IPXA 2AWGA 1VF8A 2PI6A 3WD4A 4MNMA 2WLYA 1NWUA 3ARRA 3JYMA 4FN2A 3KCEA 1JNTA 3I6CA 2O92A 3B9AA 1OGBA 2RQSA 3IKGA 3O5KA 4N19A 4Z2KA 4Z2GA 1FKRA 4S3JA 4AY1A 4DROA 2F4EA 2LJ4A 1CTNA 1SR0A 3CHEA 2EULA 2OLHA 2XP8A 3B9DA 1NH6A 3CHDA 4DRQA 2XPBA 3WD1A 3FAPA 2Q5AA 3FY1A 4G50A 1HJXA 2PV1A 4W9QA 2RUDA 4WK9A 2VCDA 1K9TA 1FAPA 1EQ3A 1W1TA 4ZPWR 3KAHA 2G8ZA 3KAGA 3WD2A 3H9RB 1FKIA 4QT3A 5J6EA 4U84A 3EY6A 4G2PA 4S3KA 2KO7A 2PPNA 1XRVA 1W9VA 3RM4A 4U85A 1PINA 3PRDA 2B5UB 4DRMA 3ARSA 4DRKA 1Q6IA 3O5GA 4W9OA 1GOIA 1ZBKA 4Z2JA 2DSWA 4JYSA 1Q1CA 2KGJA 4JFKA 3O5MA 5HW7A 4LAVA 1NWRA 2RUCA 2MF9A 3ARWA 4PTMA 4Z2LA 2M1IA 1FFRA 1ZBCA 1X6NA 3IHZA 5HW8A 2MLYA 1E6NA 3WL1A 5GPGA 5DIUA 1E6RA 3EIPA 1YW5A 3KAFA 3O5QA 2LPVA 1KT0A 2A3BA 2B31A 4W9PA 4QIBA 4TNSA 2PPPA 3TCZA 4Q7NA 1HKKA 3LUOA 3CGMA 4Z2IA 1RD6A 3CHCA 3PA7A 3AS1A 2PBCA 3ALFA 1EHNA 1HJWA 4ZPTR 4TW8A 1ROUA 4P8XA 2D9FA 2M2AA 2WLZA 3CHFA 4LGXA 1E6PA 1ZCNA 1H0GA 4IT4A 3RFWA 5I98A 1FKBA 3TC5A 1BL4A 5BXJA 4J4OA 2ESCA 3ARTA 1ITXA 1ZL1A 1TFVA 4MNKA 2XPAA 4DIPA 4ZPVR 3AS3A 3AS2A 4ML4A 1NWSA 2N87A 1UR8A 2JZVA 4IT6A 1L1PA 3GTYX 3ARXA 4ODMA 3WKZA 2A3CA 5HTGA 1JNSA 1D6OA 5GPRA 4HBOA 3ODKA 1QZ2A 2FAPA 5DF0A 2ZR6A 1FKTA 1C9HA 4ODOA 1FKSA 4HARA 2DSZA 1LQ0A 4WIWA 1BKFA 2RSEA 4C02B 4ODNA 3GPKA 4FAPA 3WIJA 1JVWA 2VN1A 3UQBA 3RM9A 2O9OA 4JFMA 3O5IA 2XP7A 3BXWA 4JFJA 1SYTA 1LG1A
chains in the Genus database with same CATH topology
1F40A 1U79A 4GGQA 4QT2A 3UI4A 4DWSA 2DPEA 4W5UA 4GIVA 3PRBA 4QZVB 4P8VA 5HKGA 3TDBA 1YATA 1FD9A 1FFQA 2ZQVA 3AS0A 4NNRA 4TW6A 1EYMA 1FKDA 4O2TA 4MNLA 3O5JA 1FJDA 1Q6HA 2PPOA 5DO2A 3O5DA 3WD0A 2XP4A 1LJYA 3FXYA 4ODLA 3AROA 2Y78A 5GQBA 4IQ2A 1J6YA 1E6ZA 1E9LA 2ZR5A 1XHGA 1ZB5A 3PR9A 4KQZA 3RM8A 3G6MA 5DIVA 2ITKA 4ODRA 2PV2A 3WD3A 2IF4A 1R9HA 3KABA 4ODKA 4Q22A 1OWQA 3NRKA 4DWSC 2ZQTA 2F2DA 2MNTA 4LAYA 1N1AA 4ODPA 5B8IC 2DT3A 1D2KA 2XP5A 4P8UA 1EIBA 5D75A 4DH0A 2DSVA 1FKHA 2DG9A 1WNOA 3QOKA 1LL6A 3KAIA 5HUAA 1P5QA 3JYJA 3WQVA 1FKFA 3B8SA 4DZ2A 1M5YA 2LKNA 3JXVA 1J4IA 1J4HA 1W1YA 4DRJA 1UR9A 3UQIA 1JNEA 3KZ7A 3NTPA 1HKMA 3IKDA 2XP6A 4DRIA 4JFLA 2A3EA 1EDQA 2WK2A 3PRAA 4ZS6A 5DITA 1ZBVA 4TYOA 1FKJA 4URIA 2KE0A 1HKJA 1LG2A 1T11A 4DZ3A 1HJVA 3O5EA 1NMWA 1ZK6A 1FKKA 5JH8A 1X6LA 3UI5A 4BF8A 4P8WA 3G6LA 3NI6A 2FDMA 4R5EA 2DG3A 2DSUA 4IQCA 1OGGA 1D7HA 4NZCA 1LL7A 2FKEA 4U86A 3B9EA 2DT1A 3O5LA 4LAWA 3WQWA 4MGVA 2K8IA 1O6IA 2DT0A 5HBFA 3ARPA 4TW7A 1NMVA 1D7IA 1H0IA 4DRHA 3WH0A 4DRNA 1W9UA 3ARVA 1B6CA 1ZBWA 3KADA 4HBEA 3O5PA 1Q6UA 2YBTA 3OOBA 2OFNA 4ITZA 1PBKA 2DG4A 3CGNA 1W26A 1FKLA 4WJXA 2G41A 1J4RA 2KI3A 4J4NA 3MDYB 1KFWA 1F8AB 2XP3A 4DT4A 5DEZA 5HW6A 2RURA 2XP9A 4JFIA 4NSBA 1FKGA 1JNDA 3UI6A 1NSGA 1QPLA 3ARUA 1ZU8A 2KR7A 4Z2HA 1A7XA 1TCOC 1GPFA 2IUZA 3RMEA 4L3NA 2DT2A 4TX0A 3O5RA 4ODQA 2LGOA 4XAKA 2ZQSA 3KACA 4MPKA 3CH9A 1D7JA 4LAXA 3UQAA 2UZ5A 2L2SA 3OA5A 4DWSB 2QF8A 4DRPA 3O5OA 3AQUA 4WKAA 2MLZA 3UF8A 2KFWA 1WAWA 1HKIA 4KR0B 2ZQUA 3O5FA 3B7XA 1GUVA 2M08A 3ARYA 2AOSA 4MNJA 2F21A 4R0XA 1E15A 1NWTA 3IK8A 5HWBA 2RUQA 2MPHA 1HXVA 1W9PA 2A3AA 2YBUA 1LL4A 4MAVA 3WL0A 4L72B 2WM0A 1W1VA 2MLXA 3ARQA 4MTVA 3W4RA 3ALGA 5HWCA 3ARZA 3VAWA 2PV3A 1IX5A 4WKHA 1ROTA 3CZ8A 5HT1A 1WB0A 2ZR4A 1Y0OA 4WKFA 1KT1A 3RGCA 4MSPA 1W1PA 1QPFA 4DWSD 4IPXA 2AWGA 1VF8A 2PI6A 3WD4A 4MNMA 2WLYA 1NWUA 3ARRA 3JYMA 4FN2A 3KCEA 1JNTA 3I6CA 2O92A 3B9AA 1OGBA 2RQSA 3IKGA 3O5KA 4N19A 4Z2KA 4Z2GA 1FKRA 4S3JA 4AY1A 4DROA 2F4EA 2LJ4A 1CTNA 1SR0A 3CHEA 2OLHA 2XP8A 3B9DA 1NH6A 3CHDA 4DRQA 2XPBA 3WD1A 3FAPA 2Q5AA 3FY1A 4G50A 1HJXA 2PV1A 4W9QA 2RUDA 4WK9A 2VCDA 1K9TA 1FAPA 1EQ3A 1W1TA 4ZPWR 3KAHA 2G8ZA 3KAGA 3WD2A 3H9RB 1FKIA 4QT3A 5J6EA 4U84A 3EY6A 4G2PA 4S3KA 2KO7A 2PPNA 1XRVA 1W9VA 3RM4A 4U85A 1PINA 3PRDA 4DRMA 3ARSA 4DRKA 1Q6IA 3O5GA 4W9OA 1GOIA 1ZBKA 4Z2JA 2DSWA 4JYSA 1Q1CA 2KGJA 4JFKA 3O5MA 5HW7A 4LAVA 1NWRA 2RUCA 2MF9A 3ARWA 4PTMA 4Z2LA 2M1IA 1FFRA 1ZBCA 1X6NA 3IHZA 5HW8A 2MLYA 1E6NA 3WL1A 5GPGA 5DIUA 1E6RA 1YW5A 3KAFA 3O5QA 2LPVA 1KT0A 2A3BA 2B31A 4W9PA 4QIBA 4TNSA 2PPPA 3TCZA 4Q7NA 1HKKA 3LUOA 3CGMA 4Z2IA 1RD6A 3CHCA 3PA7A 3AS1A 2PBCA 3ALFA 1EHNA 1HJWA 4ZPTR 4TW8A 1ROUA 4P8XA 2D9FA 2M2AA 2WLZA 3CHFA 4LGXA 1E6PA 1ZCNA 1H0GA 4IT4A 3RFWA 5I98A 1FKBA 3TC5A 1BL4A 5BXJA 4J4OA 2ESCA 1ITXA 3ARTA 1ZL1A 1TFVA 4MNKA 2XPAA 4DIPA 4ZPVR 3AS3A 3AS2A 4ML4A 1NWSA 2N87A 1UR8A 2JZVA 4IT6A 1L1PA 3ARXA 4ODMA 3WKZA 2A3CA 5HTGA 1JNSA 1D6OA 5GPRA 4HBOA 3ODKA 1QZ2A 2FAPA 5DF0A 2ZR6A 1FKTA 1C9HA 4ODOA 1FKSA 4HARA 2DSZA 1LQ0A 4WIWA 1BKFA 2RSEA 4C02B 4ODNA 3GPKA 4FAPA 3WIJA 1JVWA 2VN1A 3UQBA 3RM9A 2O9OA 4JFMA 3O5IA 2XP7A 3BXWA 4JFJA 1SYTA 1LG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK8 A;  5GPG A;  2RUQ A;  5HWB A;  1F40 A;  3UI5 A;  4BF8 A;  5DIU A;  3NI6 A;  1U79 A;  2MPH A;  4GGQ A;  1HXV A;  2DG3 A;  1YW5 A;  4QT2 A;  3KAF A;  3UI4 A;  3O5Q A;  4IQC A;  2LPV A;  4GIV A;  1D7H A;  3PRB A;  1KT0 A;  2MLX A;  5HKG A;  5HWC A;  4U86 A;  3TDB A;  1YAT A;  2FKE A;  1FD9 A;  4W9P A;  3VAW A;  4QIB A;  2ZQV A;  2PV3 A;  4TNS A;  4NNR A;  4TW6 A;  2PPP A;  3O5L A;  1ROT A;  3TCZ A;  4LAW A;  1EYM A;  5HT1 A;  1FKD A;  4MGV A;  2K8I A;  2ZR4 A;  1Y0O A;  3LUO A;  1KT1 A;  3CGM A;  3RGC A;  4MSP A;  4O2T A;  1QPF A;  3O5J A;  1FJD A;  1Q6H A;  2PPO A;  4IPX A;  2AWG A;  4TW7 A;  3O5D A;  1NMV A;  1D7I A;  2XP4 A;  3PA7 A;  4DRH A;  3JYM A;  4FN2 A;  3WH0 A;  2PBC A;  3KCE A;  4DRN A;  1JNT A;  3I6C A;  1B6C A;  4ODL A;  3KAD A;  3O5P A;  2RQS A;  1Q6U A;  3IKG A;  4TW8 A;  1ROU A;  2Y78 A;  3O5K A;  3OOB A;  2OFN A;  4IQ2 A;  4N19 A;  4ITZ A;  1PBK A;  1J6Y A;  2ZR5 A;  2D9F A;  2DG4 A;  3CGN A;  1W26 A;  1FKR A;  2M2A A;  1FKL A;  2F4E A;  5DIV A;  2LJ4 A;  4DRO A;  2ITK A;  1J4R A;  2KI3 A;  2XP8 A;  1ZCN A;  4J4N A;  3MDY B;  2PV2 A;  4ODR A;  4DRQ A;  2XPB A;  3FAP A;  2IF4 A;  3RFW A;  1FKB A;  3TC5 A;  1R9H A;  3KAB A;  4ODK A;  5I98 A;  1BL4 A;  1F8A B;  2XP3 A;  3NRK A;  2Q5A A;  5BXJ A;  4J4O A;  4G50 A;  4DT4 A;  2PV1 A;  5HW6 A;  4W9Q A;  2RUD A;  2RUR A;  2ZQT A;  2XP9 A;  2F2D A;  2MNT A;  2VCD A;  4JFI A;  4LAY A;  1FKG A;  1N1A A;  4ODP A;  2XPA A;  1FAP A;  4DIP A;  5B8I C;  1EQ3 A;  2XP5 A;  3UI6 A;  3KAH A;  1NSG A;  3KAG A;  3H9R B;  5D75 A;  1QPL A;  2N87 A;  1FKI A;  4QT3 A;  4DH0 A;  2JZV A;  1FKH A;  1L1P A;  2KR7 A;  1A7X A;  1TCO C;  5J6E A;  2DG9 A;  4ODM A;  3EY6 A;  4U84 A;  5HTG A;  4TX0 A;  4G2P A;  1JNS A;  1D6O A;  3O5R A;  4ODQ A;  2KO7 A;  2LGO A;  3KAI A;  2PPN A;  1P5Q A;  5HUA A;  3JYJ A;  3ODK A;  1QZ2 A;  1FKF A;  2ZQS A;  4DZ2 A;  4U85 A;  2FAP A;  1PIN A;  3KAC A;  3PRD A;  1M5Y A;  2LKN A;  2ZR6 A;  4DRM A;  1D7J A;  1FKT A;  1C9H A;  3JXV A;  1J4I A;  1J4H A;  4LAX A;  3UQA A;  4DRJ A;  4DRK A;  2UZ5 A;  1Q6I A;  4ODO A;  2L2S A;  3O5G A;  3UQI A;  4W9O A;  1FKS A;  3KZ7 A;  3NTP A;  3IKD A;  4JYS A;  1Q1C A;  2XP6 A;  4DRI A;  4JFL A;  4DRP A;  1BKF A;  2KGJ A;  4JFK A;  2RSE A;  4C02 B;  3O5O A;  3O5M A;  4ODN A;  3GPK A;  5HW7 A;  3UF8 A;  4FAP A;  2MLZ A;  2KFW A;  4LAV A;  5DIT A;  1JVW A;  1FKJ A;  2ZQU A;  2KE0 A;  2RUC A;  2VN1 A;  3B7X A;  3O5F A;  4TYO A;  3UQB A;  2M08 A;  2MF9 A;  4JFJ A;  1T11 A;  4JFM A;  4DZ3 A;  2M1I A;  3O5I A;  2XP7 A;  2F21 A;  3IHZ A;  3O5E A;  5HW8 A;  4R0X A;  1NMW A;  1ZK6 A;  2MLY A;  1FKK A; 
#chains in the Genus database with same CATH topology
 1F40 A;  1U79 A;  4GGQ A;  4QT2 A;  3UI4 A;  4DWS A;  2DPE A;  4W5U A;  4GIV A;  3PRB A;  4QZV B;  4P8V A;  5HKG A;  3TDB A;  1YAT A;  1FD9 A;  1FFQ A;  2ZQV A;  3AS0 A;  4NNR A;  4TW6 A;  1EYM A;  1FKD A;  4O2T A;  4MNL A;  3O5J A;  1FJD A;  1Q6H A;  2PPO A;  5DO2 A;  3O5D A;  3WD0 A;  2XP4 A;  1LJY A;  3FXY A;  4ODL A;  3ARO A;  2P4V A;  2Y78 A;  5GQB A;  4IQ2 A;  1J6Y A;  1E6Z A;  1E9L A;  2ZR5 A;  1XHG A;  1ZB5 A;  3PR9 A;  4KQZ A;  3RM8 A;  3G6M A;  5DIV A;  2ETN A;  2ITK A;  4UDM A;  4ODR A;  2PV2 A;  3WD3 A;  2IF4 A;  1R9H A;  3KAB A;  4ODK A;  4Q22 A;  1OWQ A;  3NRK A;  4DWS C;  2ZQT A;  2F2D A;  2MNT A;  4LAY A;  1JCH B;  1N1A A;  4ODP A;  5B8I C;  2DT3 A;  1D2K A;  2XP5 A;  4P8U A;  1EIB A;  5D75 A;  4DH0 A;  2DSV A;  1FKH A;  2DG9 A;  1WNO A;  3QOK A;  1LL6 A;  3KAI A;  5HUA A;  1P5Q A;  3JYJ A;  3WQV A;  1FKF A;  3B8S A;  4DZ2 A;  1M5Y A;  2LKN A;  3JXV A;  1J4I A;  1J4H A;  1W1Y A;  4DRJ A;  1UR9 A;  3UQI A;  1JNE A;  3KZ7 A;  3NTP A;  1HKM A;  3IKD A;  2XP6 A;  4DRI A;  4JFL A;  2A3E A;  1EDQ A;  2WK2 A;  3PRA A;  4ZS6 A;  5DIT A;  1ZBV A;  4TYO A;  1FKJ A;  4URI A;  2KE0 A;  1HKJ A;  1LG2 A;  1T11 A;  4DZ3 A;  1HJV A;  3O5E A;  1NMW A;  1ZK6 A;  1FKK A;  5JH8 A;  1X6L A;  3UI5 A;  4BF8 A;  4P8W A;  3G6L A;  3NI6 A;  2FDM A;  4R5E A;  2DG3 A;  1GRJ A;  2DSU A;  4IQC A;  1OGG A;  1D7H A;  3GU0 A;  4NZC A;  1LL7 A;  2FKE A;  4U86 A;  3B9E A;  2DT1 A;  3O5L A;  4LAW A;  3WQW A;  4MGV A;  2K8I A;  1O6I A;  2DT0 A;  5HBF A;  3ARP A;  4TW7 A;  1NMV A;  1D7I A;  1H0I A;  4DRH A;  3WH0 A;  4DRN A;  1W9U A;  3ARV A;  1B6C A;  1ZBW A;  3KAD A;  4HBE A;  3O5P A;  1Q6U A;  2YBT A;  3OOB A;  2OFN A;  4ITZ A;  1PBK A;  2DG4 A;  3CGN A;  1W26 A;  1FKL A;  4WJX A;  2G41 A;  1J4R A;  2KI3 A;  4J4N A;  3MDY B;  1KFW A;  1F8A B;  2XP3 A;  4DT4 A;  5DEZ A;  2PN0 A;  5HW6 A;  2RUR A;  2XP9 A;  4JFI A;  4NSB A;  1FKG A;  1JND A;  3UI6 A;  1NSG A;  1QPL A;  2F23 A;  3ARU A;  1ZU8 A;  2KR7 A;  4Z2H A;  1A7X A;  1TCO C;  1GPF A;  2IUZ A;  3RME A;  4L3N A;  2DT2 A;  4TX0 A;  3O5R A;  4ODQ A;  2LGO A;  4XAK A;  2ZQS A;  3KAC A;  4MPK A;  3CH9 A;  1D7J A;  4LAX A;  3UQA A;  2UZ5 A;  2L2S A;  3OA5 A;  4DWS B;  2QF8 A;  4DRP A;  3O5O A;  3AQU A;  4WKA A;  2MLZ A;  3UF8 A;  2KFW A;  1WAW A;  1HKI A;  4KR0 B;  2ZQU A;  3O5F A;  3B7X A;  1GUV A;  2M08 A;  3ARY A;  2AOS A;  4MNJ A;  2F21 A;  3BMB A;  4R0X A;  1E15 A;  1NWT A;  3IK8 A;  5HWB A;  2RUQ A;  1E44 A;  2MPH A;  1HXV A;  1W9P A;  2A3A A;  2YBU A;  1LL4 A;  4MAV A;  3WL0 A;  4L72 B;  2WM0 A;  1W1V A;  2MLX A;  3ARQ A;  4MTV A;  3W4R A;  3ALG A;  5HWC A;  3ARZ A;  3VAW A;  2PV3 A;  1IX5 A;  4WKH A;  1ROT A;  3CZ8 A;  5HT1 A;  1WB0 A;  2ZR4 A;  1Y0O A;  4WKF A;  1KT1 A;  3RGC A;  4MSP A;  1W1P A;  1QPF A;  4DWS D;  4IPX A;  2AWG A;  1VF8 A;  2PI6 A;  3WD4 A;  4MNM A;  2WLY A;  1NWU A;  3ARR A;  3JYM A;  4FN2 A;  3KCE A;  1JNT A;  3I6C A;  2O92 A;  3B9A A;  1OGB A;  2RQS A;  3IKG A;  3O5K A;  4N19 A;  4Z2K A;  4Z2G A;  1FKR A;  4S3J A;  4AY1 A;  4DRO A;  2F4E A;  2LJ4 A;  1CTN A;  1SR0 A;  3CHE A;  2EUL A;  2OLH A;  2XP8 A;  3B9D A;  1NH6 A;  3CHD A;  4DRQ A;  2XPB A;  3WD1 A;  3FAP A;  2Q5A A;  3FY1 A;  4G50 A;  1HJX A;  2PV1 A;  4W9Q A;  2RUD A;  4WK9 A;  2VCD A;  1K9T A;  1FAP A;  1EQ3 A;  1W1T A;  4ZPW R;  3KAH A;  2G8Z A;  3KAG A;  3WD2 A;  3H9R B;  1FKI A;  4QT3 A;  5J6E A;  4U84 A;  3EY6 A;  4G2P A;  4S3K A;  2KO7 A;  2PPN A;  1XRV A;  1W9V A;  3RM4 A;  4U85 A;  1PIN A;  3PRD A;  2B5U B;  4DRM A;  3ARS A;  4DRK A;  1Q6I A;  3O5G A;  4W9O A;  1GOI A;  1ZBK A;  4Z2J A;  2DSW A;  4JYS A;  1Q1C A;  2KGJ A;  4JFK A;  3O5M A;  5HW7 A;  4LAV A;  1NWR A;  2RUC A;  2MF9 A;  3ARW A;  4PTM A;  4Z2L A;  2M1I A;  1FFR A;  1ZBC A;  1X6N A;  3IHZ A;  5HW8 A;  2MLY A;  1E6N A;  3WL1 A;  5GPG A;  5DIU A;  1E6R A;  3EIP A;  1YW5 A;  3KAF A;  3O5Q A;  2LPV A;  1KT0 A;  2A3B A;  2B31 A;  4W9P A;  4QIB A;  4TNS A;  2PPP A;  3TCZ A;  4Q7N A;  1HKK A;  3LUO A;  3CGM A;  4Z2I A;  1RD6 A;  3CHC A;  3PA7 A;  3AS1 A;  2PBC A;  3ALF A;  1EHN A;  1HJW A;  4ZPT R;  4TW8 A;  1ROU A;  4P8X A;  2D9F A;  2M2A A;  2WLZ A;  3CHF A;  4LGX A;  1E6P A;  1ZCN A;  1H0G A;  4IT4 A;  3RFW A;  5I98 A;  1FKB A;  3TC5 A;  1BL4 A;  5BXJ A;  4J4O A;  2ESC A;  3ART A;  1ITX A;  1ZL1 A;  1TFV A;  4MNK A;  2XPA A;  4DIP A;  4ZPV R;  3AS3 A;  3AS2 A;  4ML4 A;  1NWS A;  2N87 A;  1UR8 A;  2JZV A;  4IT6 A;  1L1P A;  3GTY X;  3ARX A;  4ODM A;  3WKZ A;  2A3C A;  5HTG A;  1JNS A;  1D6O A;  5GPR A;  4HBO A;  3ODK A;  1QZ2 A;  2FAP A;  5DF0 A;  2ZR6 A;  1FKT A;  1C9H A;  4ODO A;  1FKS A;  4HAR A;  2DSZ A;  1LQ0 A;  4WIW A;  1BKF A;  2RSE A;  4C02 B;  4ODN A;  3GPK A;  4FAP A;  3WIJ A;  1JVW A;  2VN1 A;  3UQB A;  3RM9 A;  2O9O A;  4JFM A;  3O5I A;  2XP7 A;  3BXW A;  4JFJ A;  1SYT A;  1LG1 A; 
#chains in the Genus database with same CATH homology
 1F40 A;  1U79 A;  4GGQ A;  4QT2 A;  3UI4 A;  4DWS A;  2DPE A;  4W5U A;  4GIV A;  3PRB A;  4QZV B;  4P8V A;  5HKG A;  3TDB A;  1YAT A;  1FD9 A;  1FFQ A;  2ZQV A;  3AS0 A;  4NNR A;  4TW6 A;  1EYM A;  1FKD A;  4O2T A;  4MNL A;  3O5J A;  1FJD A;  1Q6H A;  2PPO A;  5DO2 A;  3O5D A;  3WD0 A;  2XP4 A;  1LJY A;  3FXY A;  4ODL A;  3ARO A;  2Y78 A;  5GQB A;  4IQ2 A;  1J6Y A;  1E6Z A;  1E9L A;  2ZR5 A;  1XHG A;  1ZB5 A;  3PR9 A;  4KQZ A;  3RM8 A;  3G6M A;  5DIV A;  2ITK A;  4ODR A;  2PV2 A;  3WD3 A;  2IF4 A;  1R9H A;  3KAB A;  4ODK A;  4Q22 A;  1OWQ A;  3NRK A;  4DWS C;  2ZQT A;  2F2D A;  2MNT A;  4LAY A;  1N1A A;  4ODP A;  5B8I C;  2DT3 A;  1D2K A;  2XP5 A;  4P8U A;  1EIB A;  5D75 A;  4DH0 A;  2DSV A;  1FKH A;  2DG9 A;  1WNO A;  3QOK A;  1LL6 A;  3KAI A;  5HUA A;  1P5Q A;  3JYJ A;  3WQV A;  1FKF A;  3B8S A;  4DZ2 A;  1M5Y A;  2LKN A;  3JXV A;  1J4I A;  1J4H A;  1W1Y A;  4DRJ A;  1UR9 A;  3UQI A;  1JNE A;  3KZ7 A;  3NTP A;  1HKM A;  3IKD A;  2XP6 A;  4DRI A;  4JFL A;  2A3E A;  1EDQ A;  2WK2 A;  3PRA A;  4ZS6 A;  5DIT A;  1ZBV A;  4TYO A;  1FKJ A;  4URI A;  2KE0 A;  1HKJ A;  1LG2 A;  1T11 A;  4DZ3 A;  1HJV A;  3O5E A;  1NMW A;  1ZK6 A;  1FKK A;  5JH8 A;  1X6L A;  3UI5 A;  4BF8 A;  4P8W A;  3G6L A;  3NI6 A;  2FDM A;  4R5E A;  2DG3 A;  2DSU A;  4IQC A;  1OGG A;  1D7H A;  4NZC A;  1LL7 A;  2FKE A;  4U86 A;  3B9E A;  2DT1 A;  3O5L A;  4LAW A;  3WQW A;  4MGV A;  2K8I A;  1O6I A;  2DT0 A;  5HBF A;  3ARP A;  4TW7 A;  1NMV A;  1D7I A;  1H0I A;  4DRH A;  3WH0 A;  4DRN A;  1W9U A;  3ARV A;  1B6C A;  1ZBW A;  3KAD A;  4HBE A;  3O5P A;  1Q6U A;  2YBT A;  3OOB A;  2OFN A;  4ITZ A;  1PBK A;  2DG4 A;  3CGN A;  1W26 A;  1FKL A;  4WJX A;  2G41 A;  1J4R A;  2KI3 A;  4J4N A;  3MDY B;  1KFW A;  1F8A B;  2XP3 A;  4DT4 A;  5DEZ A;  5HW6 A;  2RUR A;  2XP9 A;  4JFI A;  4NSB A;  1FKG A;  1JND A;  3UI6 A;  1NSG A;  1QPL A;  3ARU A;  1ZU8 A;  2KR7 A;  4Z2H A;  1A7X A;  1TCO C;  1GPF A;  2IUZ A;  3RME A;  4L3N A;  2DT2 A;  4TX0 A;  3O5R A;  4ODQ A;  2LGO A;  4XAK A;  2ZQS A;  3KAC A;  4MPK A;  3CH9 A;  1D7J A;  4LAX A;  3UQA A;  2UZ5 A;  2L2S A;  3OA5 A;  4DWS B;  2QF8 A;  4DRP A;  3O5O A;  3AQU A;  4WKA A;  2MLZ A;  3UF8 A;  2KFW A;  1WAW A;  1HKI A;  4KR0 B;  2ZQU A;  3O5F A;  3B7X A;  1GUV A;  2M08 A;  3ARY A;  2AOS A;  4MNJ A;  2F21 A;  4R0X A;  1E15 A;  1NWT A;  3IK8 A;  5HWB A;  2RUQ A;  2MPH A;  1HXV A;  1W9P A;  2A3A A;  2YBU A;  1LL4 A;  4MAV A;  3WL0 A;  4L72 B;  2WM0 A;  1W1V A;  2MLX A;  3ARQ A;  4MTV A;  3W4R A;  3ALG A;  5HWC A;  3ARZ A;  3VAW A;  2PV3 A;  1IX5 A;  4WKH A;  1ROT A;  3CZ8 A;  5HT1 A;  1WB0 A;  2ZR4 A;  1Y0O A;  4WKF A;  1KT1 A;  3RGC A;  4MSP A;  1W1P A;  1QPF A;  4DWS D;  4IPX A;  2AWG A;  1VF8 A;  2PI6 A;  3WD4 A;  4MNM A;  2WLY A;  1NWU A;  3ARR A;  3JYM A;  4FN2 A;  3KCE A;  1JNT A;  3I6C A;  2O92 A;  3B9A A;  1OGB A;  2RQS A;  3IKG A;  3O5K A;  4N19 A;  4Z2K A;  4Z2G A;  1FKR A;  4S3J A;  4AY1 A;  4DRO A;  2F4E A;  2LJ4 A;  1CTN A;  1SR0 A;  3CHE A;  2OLH A;  2XP8 A;  3B9D A;  1NH6 A;  3CHD A;  4DRQ A;  2XPB A;  3WD1 A;  3FAP A;  2Q5A A;  3FY1 A;  4G50 A;  1HJX A;  2PV1 A;  4W9Q A;  2RUD A;  4WK9 A;  2VCD A;  1K9T A;  1FAP A;  1EQ3 A;  1W1T A;  4ZPW R;  3KAH A;  2G8Z A;  3KAG A;  3WD2 A;  3H9R B;  1FKI A;  4QT3 A;  5J6E A;  4U84 A;  3EY6 A;  4G2P A;  4S3K A;  2KO7 A;  2PPN A;  1XRV A;  1W9V A;  3RM4 A;  4U85 A;  1PIN A;  3PRD A;  4DRM A;  3ARS A;  4DRK A;  1Q6I A;  3O5G A;  4W9O A;  1GOI A;  1ZBK A;  4Z2J A;  2DSW A;  4JYS A;  1Q1C A;  2KGJ A;  4JFK A;  3O5M A;  5HW7 A;  4LAV A;  1NWR A;  2RUC A;  2MF9 A;  3ARW A;  4PTM A;  4Z2L A;  2M1I A;  1FFR A;  1ZBC A;  1X6N A;  3IHZ A;  5HW8 A;  2MLY A;  1E6N A;  3WL1 A;  5GPG A;  5DIU A;  1E6R A;  1YW5 A;  3KAF A;  3O5Q A;  2LPV A;  1KT0 A;  2A3B A;  2B31 A;  4W9P A;  4QIB A;  4TNS A;  2PPP A;  3TCZ A;  4Q7N A;  1HKK A;  3LUO A;  3CGM A;  4Z2I A;  1RD6 A;  3CHC A;  3PA7 A;  3AS1 A;  2PBC A;  3ALF A;  1EHN A;  1HJW A;  4ZPT R;  4TW8 A;  1ROU A;  4P8X A;  2D9F A;  2M2A A;  2WLZ A;  3CHF A;  4LGX A;  1E6P A;  1ZCN A;  1H0G A;  4IT4 A;  3RFW A;  5I98 A;  1FKB A;  3TC5 A;  1BL4 A;  5BXJ A;  4J4O A;  2ESC A;  1ITX A;  3ART A;  1ZL1 A;  1TFV A;  4MNK A;  2XPA A;  4DIP A;  4ZPV R;  3AS3 A;  3AS2 A;  4ML4 A;  1NWS A;  2N87 A;  1UR8 A;  2JZV A;  4IT6 A;  1L1P A;  3ARX A;  4ODM A;  3WKZ A;  2A3C A;  5HTG A;  1JNS A;  1D6O A;  5GPR A;  4HBO A;  3ODK A;  1QZ2 A;  2FAP A;  5DF0 A;  2ZR6 A;  1FKT A;  1C9H A;  4ODO A;  1FKS A;  4HAR A;  2DSZ A;  1LQ0 A;  4WIW A;  1BKF A;  2RSE A;  4C02 B;  4ODN A;  3GPK A;  4FAP A;  3WIJ A;  1JVW A;  2VN1 A;  3UQB A;  3RM9 A;  2O9O A;  4JFM A;  3O5I A;  2XP7 A;  3BXW A;  4JFJ A;  1SYT A;  1LG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...