2DG5A

Crystal structure of gamma-glutamyl transpeptidase from escherichia coli in complex with hydrolyzed glutathione
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
351
structure length
351
Chain Sequence
EEDVFHPVRAKQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKNGNTTAIDFREMAPAKATRDMFLDDQGNPDSKKSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYGSEVLPNHENSKAIFWKEGEPLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRSEYLGDPDFVKVPWQALTNKAYAKSIADQIDINKAKPSSEIRPGKLAPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-glutamyltranspeptidase
publication title Crystal structures of gamma-glutamyltranspeptidase from Escherichia coli, a key enzyme in glutathione metabolism, and its reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 97
structure length 351
sequence length 351
chains with identical sequence C
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2006-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2dg5A02
2E0XA 4GG2A 4GDXA 2DBXA 2NQOA 4ZC6A 2DG5A 2E0YA 3FNMA 2Z8KA 3WHQA 4ZBKA 5B5TA 2QM6A 2QMCA 3A75A 2Z8IA 2DBUA 2DBWA 2Z8JA 3WHRA 3WHSA 4OTUA 4ZCGA 2V36A 5BPKA 4Z9OA 4OTTA
chains in the Genus database with same CATH superfamily
1FOUA 2BX8A 4Z69A 3V03A 4W4UB 2BXAA 4GG2A 1H9ZA 3A73A 2DBXA 1HK4A 4ZC6A 5IFOA 4D7XA 3LU8A 4DHXB 5HOZA 3MHHB 3LU6A 4N3ZA 2EFCA 4LA0A 2Z8KA 3JQZA 4IW1A 3H3AA 3KIKA 1KDXA 3SQJA 3ICXA 3VQIA 4ZBQA 2BXCA 3KJLA 2AJEA 2LQIA 2YDFA 4G03A 5IJEA 4ZUXV 2DBWA 3TDLA 1MIVA 4LUHA 2XW0A 4L9KA 2DYOA 3MHSB 4MBEC 1E7CA 4OR0A 3NVIA 1TXUA 4I9OA 3V08A 2BXQA 5IJFA 4OTUA 3GQXA 4JK4A 1MA9A 1HK5A 4BY9C 2GUTA 5IIHA 4LUFA 2BXIA 4L8UA 2LQHA 2XSIA 2EFHA 3GQUA 4FJCB 1MUSA 3GA9L 2BXFA 2NQOA 5GHKA 2DG5A 1BM0A 5IJ5A 1NT2B 3V09A 2LXTA 4LB9A 2VDBA 3WHQA 4ZBKA 4F5VA 5B5TA 1E7FA 4K71A 2BXKA 2VUFA 1BKEA 3NVKA 1MIYA 2Z8IA 1E7GA 4J2VA 2DBUA 1LNSA 1E7IA 4IW2A 5GIOA 4HGKA 1GNJA 2I2ZA 1GNIA 2LXSA 3W1SA 3NMUA 3PLAA 5GINA 4BKEA 1E7AA 2OT3A 4LB2A 3G9KD 4FK5B 2VUEA 4S1YA 2BXEA 4E99A 2BXNA 3FWCC 1MM8A 4M70B 4GDXA 2AGHB 3BPJA 4TQ0A 1UORA 2BXPA 2NNWA 2E0YA 2DYMA 3SIUB 2XVQA 1VFIA 3NVMA 1HA2A 2BXLA 2XVVA 3FWBC 1H5WA 1VZSA 2XVWA 3LU7A 5IIXA 2OZBB 4GDLB 4FIPB 5D7GA 1E7EA 1E7BA 1O9XA 2XMOA 2XW1A 3JRYA 2EFEA 2KBZA 4G01A 3WHRA 4K2CA 2LOQA 3B9LA 1AO6A 4GDKB 2XVUA 4ZCGA 2V36A 5BPKA 5IIUA 4N0UD 2JUHA 1N5UA 5ID7A 4Z9OA 4OTTA 2E0XA 4F5UA 1BJ5A 3H37A 4DM0A 1IJGA 5ID9A 3M99C 3UIVA 4F5SA 3FNMA 4EMXA 2BXOA 4C31B 2BXMA 4PO0A 5GIPA 2KWFA 4HGMB 4ZBRA 2CKXA 1SB0A 4G04A 2BXDA 4NAWB 1KW2A 2I30A 3SIVB 4N0FD 1KXPD 2BXHA 1E7HA 1TF0A 2QM6A 4OT2A 1HK1A 2QMCA 4F5TA 3A75A 4TQ1A 2K0NA 3ECPA 1JNBA 3B9MA 2QHBA 2EFDA 1MUHA 1HK2A 2ROHA 1J78A 1LOTA 2Z8JA 5DQFA 3WHSA 3CX9A 1E78A 1HK3A 2BXGA 2BXBA 1MIWA 5DBYA 4WA6B 5FUOA 1J7EA 4L9QA
chains in the Genus database with same CATH topology
1FOUA 2BX8A 4Z69A 3V03A 4W4UB 2BXAA 4GG2A 1H9ZA 3A73A 2DBXA 1HK4A 4ZC6A 5IFOA 3LU8A 4DHXB 5HOZA 3MHHB 3LU6A 4N3ZA 2EFCA 4LA0A 2Z8KA 3JQZA 4IW1A 3H3AA 3KIKA 3SQJA 3ICXA 3VQIA 4ZBQA 2BXCA 3KJLA 2AJEA 5IJEA 2YDFA 4G03A 4ZUXV 2DBWA 3TDLA 1MIVA 4LUHA 2XW0A 4L9KA 2DYOA 3MHSB 4MBEC 1E7CA 4OR0A 3NVIA 1TXUA 3V08A 2BXQA 5IJFA 4OTUA 3GQXA 4JK4A 1MA9A 1HK5A 4BY9C 5IIHA 4LUFA 2BXIA 4L8UA 2XSIA 3GQUA 2EFHA 4FJCB 3GA9L 2BXFA 2NQOA 5GHKA 2DG5A 1BM0A 5IJ5A 1NT2B 3V09A 4LB9A 2VDBA 3WHQA 4ZBKA 4F5VA 5B5TA 1E7FA 4K71A 2BXKA 2VUFA 1BKEA 3NVKA 1MIYA 2Z8IA 1E7GA 4J2VA 2DBUA 1LNSA 1E7IA 4IW2A 5GIOA 4HGKA 1GNJA 2I2ZA 1GNIA 3W1SA 3PLAA 3NMUA 5GINA 4BKEA 1E7AA 2OT3A 4LB2A 3G9KD 4FK5B 2VUEA 4S1YA 2BXEA 4E99A 2BXNA 3FWCC 4M70B 4GDXA 4TQ0A 1UORA 2BXPA 2NNWA 2E0YA 2DYMA 3SIUB 2XVQA 1VFIA 3NVMA 1HA2A 2BXLA 2XVVA 3FWBC 1H5WA 1VZSA 2XVWA 3LU7A 5IIXA 2OZBB 4GDLB 4FIPB 5D7GA 1E7EA 1E7BA 1O9XA 2XMOA 2XW1A 3JRYA 2EFEA 2KBZA 4G01A 3WHRA 4K2CA 2LOQA 3B9LA 1AO6A 4GDKB 2XVUA 4ZCGA 2V36A 5BPKA 5IIUA 4N0UD 2JUHA 1N5UA 5ID7A 4Z9OA 4OTTA 2E0XA 4F5UA 1BJ5A 3H37A 1IJGA 5ID9A 3M99C 3UIVA 4F5SA 3FNMA 4EMXA 2BXOA 4C31B 2BXMA 4PO0A 5GIPA 4HGMB 4ZBRA 2CKXA 4G04A 2BXDA 4NAWB 1KW2A 2I30A 3SIVB 4N0FD 1KXPD 2BXHA 1E7HA 1TF0A 2QM6A 4OT2A 1HK1A 2QMCA 4F5TA 3A75A 4TQ1A 1JNBA 3B9MA 2QHBA 2EFDA 1HK2A 2ROHA 1J78A 1LOTA 2Z8JA 5DQFA 3WHSA 3CX9A 1E78A 1HK3A 2BXGA 2BXBA 1MIWA 5DBYA 4WA6B 5FUOA 1J7EA 4L9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E0X A;  4GG2 A;  4GDX A;  2DBX A;  2NQO A;  4ZC6 A;  2DG5 A;  2E0Y A;  3FNM A;  2Z8K A;  3WHQ A;  4ZBK A;  5B5T A;  2QM6 A;  2QMC A;  3A75 A;  2Z8I A;  2DBU A;  2DBW A;  2Z8J A;  3WHR A;  3WHS A;  4OTU A;  4ZCG A;  2V36 A;  5BPK A;  4Z9O A;  4OTT A; 
#chains in the Genus database with same CATH topology
 1FOU A;  2BX8 A;  4Z69 A;  3V03 A;  4W4U B;  2BXA A;  4GG2 A;  1H9Z A;  3A73 A;  2DBX A;  1HK4 A;  4ZC6 A;  5IFO A;  4D7X A;  3LU8 A;  4DHX B;  5HOZ A;  3MHH B;  3LU6 A;  4N3Z A;  2EFC A;  4LA0 A;  2Z8K A;  3JQZ A;  4IW1 A;  3H3A A;  3KIK A;  1KDX A;  3SQJ A;  3ICX A;  3VQI A;  4ZBQ A;  2BXC A;  3KJL A;  2AJE A;  2LQI A;  2YDF A;  4G03 A;  5IJE A;  4ZUX V;  2DBW A;  3TDL A;  1MIV A;  4LUH A;  2XW0 A;  4L9K A;  2DYO A;  3MHS B;  4MBE C;  1E7C A;  4OR0 A;  3NVI A;  1TXU A;  4I9O A;  3V08 A;  2BXQ A;  5IJF A;  4OTU A;  3GQX A;  4JK4 A;  1MA9 A;  1HK5 A;  4BY9 C;  2GUT A;  5IIH A;  4LUF A;  2BXI A;  4L8U A;  2LQH A;  2XSI A;  2EFH A;  3GQU A;  4FJC B;  1MUS A;  3GA9 L;  2BXF A;  2NQO A;  5GHK A;  2DG5 A;  1BM0 A;  5IJ5 A;  1NT2 B;  3V09 A;  2LXT A;  4LB9 A;  2VDB A;  3WHQ A;  4ZBK A;  4F5V A;  5B5T A;  1E7F A;  4K71 A;  2BXK A;  2VUF A;  1BKE A;  3NVK A;  1MIY A;  2Z8I A;  1E7G A;  4J2V A;  2DBU A;  1LNS A;  1E7I A;  4IW2 A;  5GIO A;  4HGK A;  1GNJ A;  2I2Z A;  1GNI A;  2LXS A;  3W1S A;  3NMU A;  3PLA A;  5GIN A;  4BKE A;  1E7A A;  2OT3 A;  4LB2 A;  3G9K D;  4FK5 B;  2VUE A;  4S1Y A;  2BXE A;  4E99 A;  2BXN A;  3FWC C;  1MM8 A;  4M70 B;  4GDX A;  2AGH B;  3BPJ A;  4TQ0 A;  1UOR A;  2BXP A;  2NNW A;  2E0Y A;  2DYM A;  3SIU B;  2XVQ A;  1VFI A;  3NVM A;  1HA2 A;  2BXL A;  2XVV A;  3FWB C;  1H5W A;  1VZS A;  2XVW A;  3LU7 A;  5IIX A;  2OZB B;  4GDL B;  4FIP B;  5D7G A;  1E7E A;  1E7B A;  1O9X A;  2XMO A;  2XW1 A;  3JRY A;  2EFE A;  2KBZ A;  4G01 A;  3WHR A;  4K2C A;  2LOQ A;  3B9L A;  1AO6 A;  4GDK B;  2XVU A;  4ZCG A;  2V36 A;  5BPK A;  5IIU A;  4N0U D;  2JUH A;  1N5U A;  5ID7 A;  4Z9O A;  4OTT A;  2E0X A;  4F5U A;  1BJ5 A;  3H37 A;  4DM0 A;  1IJG A;  5ID9 A;  3M99 C;  3UIV A;  4F5S A;  3FNM A;  4EMX A;  2BXO A;  4C31 B;  2BXM A;  4PO0 A;  5GIP A;  2KWF A;  4HGM B;  4ZBR A;  2CKX A;  1SB0 A;  4G04 A;  2BXD A;  4NAW B;  1KW2 A;  2I30 A;  3SIV B;  4N0F D;  1KXP D;  2BXH A;  1E7H A;  1TF0 A;  2QM6 A;  4OT2 A;  1HK1 A;  2QMC A;  4F5T A;  3A75 A;  4TQ1 A;  2K0N A;  3ECP A;  1JNB A;  3B9M A;  2QHB A;  2EFD A;  1MUH A;  1HK2 A;  2ROH A;  1J78 A;  1LOT A;  2Z8J A;  5DQF A;  3WHS A;  3CX9 A;  1E78 A;  1HK3 A;  2BXG A;  2BXB A;  1MIW A;  5DBY A;  4WA6 B;  5FUO A;  1J7E A;  4L9Q A; 
#chains in the Genus database with same CATH homology
 1FOU A;  2BX8 A;  4Z69 A;  3V03 A;  4W4U B;  2BXA A;  4GG2 A;  1H9Z A;  3A73 A;  2DBX A;  1HK4 A;  4ZC6 A;  5IFO A;  3LU8 A;  4DHX B;  5HOZ A;  3MHH B;  3LU6 A;  4N3Z A;  2EFC A;  4LA0 A;  2Z8K A;  3JQZ A;  4IW1 A;  3H3A A;  3KIK A;  3SQJ A;  3ICX A;  3VQI A;  4ZBQ A;  2BXC A;  3KJL A;  2AJE A;  5IJE A;  2YDF A;  4G03 A;  4ZUX V;  2DBW A;  3TDL A;  1MIV A;  4LUH A;  2XW0 A;  4L9K A;  2DYO A;  3MHS B;  4MBE C;  1E7C A;  4OR0 A;  3NVI A;  1TXU A;  3V08 A;  2BXQ A;  5IJF A;  4OTU A;  3GQX A;  4JK4 A;  1MA9 A;  1HK5 A;  4BY9 C;  5IIH A;  4LUF A;  2BXI A;  4L8U A;  2XSI A;  3GQU A;  2EFH A;  4FJC B;  3GA9 L;  2BXF A;  2NQO A;  5GHK A;  2DG5 A;  1BM0 A;  5IJ5 A;  1NT2 B;  3V09 A;  4LB9 A;  2VDB A;  3WHQ A;  4ZBK A;  4F5V A;  5B5T A;  1E7F A;  4K71 A;  2BXK A;  2VUF A;  1BKE A;  3NVK A;  1MIY A;  2Z8I A;  1E7G A;  4J2V A;  2DBU A;  1LNS A;  1E7I A;  4IW2 A;  5GIO A;  4HGK A;  1GNJ A;  2I2Z A;  1GNI A;  3W1S A;  3PLA A;  3NMU A;  5GIN A;  4BKE A;  1E7A A;  2OT3 A;  4LB2 A;  3G9K D;  4FK5 B;  2VUE A;  4S1Y A;  2BXE A;  4E99 A;  2BXN A;  3FWC C;  4M70 B;  4GDX A;  4TQ0 A;  1UOR A;  2BXP A;  2NNW A;  2E0Y A;  2DYM A;  3SIU B;  2XVQ A;  1VFI A;  3NVM A;  1HA2 A;  2BXL A;  2XVV A;  3FWB C;  1H5W A;  1VZS A;  2XVW A;  3LU7 A;  5IIX A;  2OZB B;  4GDL B;  4FIP B;  5D7G A;  1E7E A;  1E7B A;  1O9X A;  2XMO A;  2XW1 A;  3JRY A;  2EFE A;  2KBZ A;  4G01 A;  3WHR A;  4K2C A;  2LOQ A;  3B9L A;  1AO6 A;  4GDK B;  2XVU A;  4ZCG A;  2V36 A;  5BPK A;  5IIU A;  4N0U D;  2JUH A;  1N5U A;  5ID7 A;  4Z9O A;  4OTT A;  2E0X A;  4F5U A;  1BJ5 A;  3H37 A;  1IJG A;  5ID9 A;  3M99 C;  3UIV A;  4F5S A;  3FNM A;  4EMX A;  2BXO A;  4C31 B;  2BXM A;  4PO0 A;  5GIP A;  4HGM B;  4ZBR A;  2CKX A;  4G04 A;  2BXD A;  4NAW B;  1KW2 A;  2I30 A;  3SIV B;  4N0F D;  1KXP D;  2BXH A;  1E7H A;  1TF0 A;  2QM6 A;  4OT2 A;  1HK1 A;  2QMC A;  4F5T A;  3A75 A;  4TQ1 A;  1JNB A;  3B9M A;  2QHB A;  2EFD A;  1HK2 A;  2ROH A;  1J78 A;  1LOT A;  2Z8J A;  5DQF A;  3WHS A;  3CX9 A;  1E78 A;  1HK3 A;  2BXG A;  2BXB A;  1MIW A;  5DBY A;  4WA6 B;  5FUO A;  1J7E A;  4L9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...