2DG7A

Crystal structure of the putative transcriptional regulator sco0337 from streptomyces coelicolor a3(2)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
187
structure length
187
Chain Sequence
MARWDPGAEQRLKRAALELYSEHGYDNVTVTDIAERAGLTRRSYFRYFPDKREVLFGGSELLPPAVARAVLAADPGAAPLTAVLDAMSQVGAQLVAQVEGAAQRRAVIDASPELQERERTKSAAISRAVQDALVRRQVDADTAELVAQLATVAFGSAFRRWIDAEGHADFGSCLDTVTDRLRAVLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative transcriptional regulator
publication title Crystal structure of the putative transcriptional regulator SCO0337 from Streptomyces coelicolor A3(2)
rcsb
source organism Streptomyces coelicolor
molecule tags Gene regulation
total genus 69
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17754 TetR_C_14 MftR C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2dg7A00
1QPIA 3NRGA 4D7MA 5FHPA 4DW6A 1QVTA 2HYTA 3MNLA 1U9OA 4GCTA 1T33A 2NP3A 2RASA 3QPLA 2W53A 2G3BA 2OPTA 1JT6A 3V6GA 3ZQGA 3NXCA 3E7QA 4ABZA 4JKZA 3FK7A 2O7TA 4KWAA 4MK6A 3CDLA 4CGRA 3PPBA 3BQZA 4YZEA 3BR1A 3VVZA 4ME9A 3BRUA 3BR2A 1T56A 1Z0XA 3HE0A 3KNWA 1SGMA 2TCTA 2FBQA 5FGLA 5C4YA 2G7LA 2WGBA 3F1BA 3VUQA 5GPCA 1UI6A 2UXHA 3QKXA 4B3AA 1U9NA 3BHQA 2Y31A 5HAWA 1BJZA 1JUSA 3RD3A 2XDNA 1QVUA 3BTJA 5DAJA 3CJDA 2HQ5A 2NX4A 3ANGA 2Q24A 5F1JA 4L62A 4XK4A 3ANPA 4AC6A 1UI5A 2ZOZA 3LJLA 4M3DA 4GFLA 2F07A 2XPUA 2FD5A 2UXUA 5F27A 4M3BA 2IEKA 4AF5A 4D5FA 3WHCA 1A6IA 4V2FA 3CWRA 3BJBA 4JYKA 3AQSA 3HGGA 2FQ4A 3DCFA 2HXOA 2XPVA 2GENA 3CRJA 5EZHA 4D7NA 2QTQA 4HKUA 2WUIA 3BTIA 3B6CA 2WV1A 2ZCNA 3CCYA 2ZB9A 3BT9A 2YVEA 3Q3SA 2QCOA 2QWTA 3IH4A 5EFYA 4G12A 4JL3A 3ZQFA 4M3GA 2PBXA 5J1UA 3WHBA 2ZCXA 3QPSA 5K7ZA 2OERA 3ON2A 3LHQA 2QIBA 3ZQHA 3IUVA 5GP9A 4UDSA 5J1YA 4I6ZA 2PZ9A 5D18A 3BQYA 3O60A 5IOZA 5FKOA 2ID6A 3GEUA 3F0CA 2IU5A 3MVPA 4GCLA 5EYRA 5EZGA 5D19A 5IP6A 3EUPA 1ZK8A 3S5RA 4NN1A 3HTJA 5IOYA 3DPJA 3NNRA 3LSRA 3FRQA 4M3FA 3O8GA 1VI0A 2V57A 2REKA 3VW2A 4GCKA 3G1MA 3JSJA 5F0CA 1RKTA 5IPAA 3LSPA 5K7HA 4ICHA 1JUPA 3LWJA 2O7OA 3IH3A 3VIBA 3NI7A 2UXIA 4V2GA 3B81A 2GFNA 5FKNA 1RPWA 3Q0WA 3PASA 4JNNA 2G7GA 5FKMA 2X9DA 4W97A 3FK6A 3BNIA 3G1LA 2RHAA 4X1EA 2RAEA 3VOXA 2XGEA 3VOKA 2DTZA 3BR0A 3PM1A 2NS7A 2EH3A 5FKLA 2XB5A 3V78A 2JJ7A 2IBDA 2X6OA 2XRLA 3SFIA 4D5CA 4PXIA 3AQTA 4MO7A 5D1RA 2ZOYA 5J1RA 3KZ9A 2QKOA 2DG8A 2FJ1A 3DEWA 2NP5A 3COLA 5J3LA 3BTCA 2GUHA 5F0HA 3BTLA 5AQCA 2VKEA 2TRTA 3G56A 3SDGA 3TP3A 2HXIA 3FIWA 2HKUA 2OI8A 3VW1A 5CXIA 5K58A 4M3EA 3TP0A 4AUXA 3HTIA 5F08A 2OF7A 2XGDA 2UXOA 3P9TA 3EGQA 1ZKGA 3ON4A 5FKKA 2XGCA 3C07A 3VVYA 3VPRA 1JUMA 4GFKA 3Q0UA 3HTHA 4NELA 4ACIA 2GBYA 2Y30A 5HBUA 2Y2ZA 3BR5A 3ZQLA 3G7RA 3KKCA 5HSZA 4W1UA 3Q0VA 5F0FA 2VPRA 1JTYA 5CXGA 3NPIA 2VKVA 3B6AA 5FMPA 5H9TA 1JT0A 3BCGA 3T6NA 3O8HA 3HIMA 3VVXA 2YVHA 4B1RA 1ORKA 2DG7A 2FX0A 3BR6A 1RKWA 5F04A 2G0EA 3VW0A 2G7SA 3RH2A 2HYJA 2IAIA 3VP5A 3ZQIA 1Z77A 2JK3A 3BR3A 4MXMA 3HTAA 5CW8A 3G1OA 2XPWA 3IH2A 4AC0A 2D6YA 3C2BA 5GPAA 1JTXA 2QOPA 4I76A 3GZIA 2ID3A 3KKDA 3QBMA 3HGYA 2UXPA 3LSJA 2ZCMA 2I10A 3LOCA 5K7FA 3QQAA 2NS8A
chains in the Genus database with same CATH superfamily
1QPIA 3NRGA 4D7MA 5FHPA 4DW6A 1QVTA 2HYTA 3MNLA 1U9OA 4GCTA 1T33A 2NP3A 2RASA 3QPLA 2R7VA 2W53A 2A2FX 2G3BA 2OPTA 1JT6A 3V6GA 3ZQGA 3NXCA 3E7QA 4ABZA 4JKZA 3FK7A 2O7TA 4KWAA 4MK6A 3CDLA 4CGRA 3PPBA 3BQZA 4YZEA 3BR1A 3VVZA 4ME9A 3BRUA 3BR2A 1T56A 1Z0XA 3HE0A 3KNWA 2R7XA 2B1EA 1SGMA 2TCTA 2FBQA 5FGLA 5C4YA 2G7LA 2WGBA 3F1BA 3VUQA 5GPCA 1UI6A 2UXHA 3QKXA 4B3AA 3KYLA 1U9NA 3BHQA 2Y31A 5HAWA 1BJZA 1JUSA 3RD3A 2XDNA 1QVUA 3BTJA 5DAJA 3CJDA 4IRVA 2HQ5A 2NX4A 3ANGA 2Q24A 2R7TA 5F1JA 4L62A 4XK4A 3ANPA 4AC6A 1UI5A 2ZOZA 3LJLA 4M3DA 4GFLA 2F07A 2XPUA 2FD5A 2UXUA 5F27A 4M3BA 2IEKA 4AF5A 4D5FA 3WHCA 1A6IA 4V2FA 3CWRA 3BJBA 4JYKA 3AQSA 3FHNA 3HGGA 2FQ4A 3DCFA 2HXOA 2XPVA 2GENA 3CRJA 5EZHA 4D7NA 2QTQA 4HKUA 2WUIA 3BTIA 3B6CA 2WV1A 2ZCNA 3CCYA 2ZB9A 3BT9A 2YVEA 3Q3SA 2QCOA 2QWTA 3IH4A 5EFYA 4G12A 3DU5A 5CQGA 4JL3A 3ZQFA 4M3GA 2PBXA 5J1UA 3WHBA 2ZCXA 3QPSA 5K7ZA 2OERA 3ON2A 3LHQA 2QIBA 3ZQHA 3IUVA 5GP9A 4UDSA 5J1YA 2R7SA 4I6ZA 2PZ9A 4C2MA 5D18A 3BQYA 3O60A 5IOZA 5FKOA 2ID6A 4DVYP 3GEUA 3F0CA 2R7QA 2IU5A 3MVPA 4GCLA 5EYRA 5EZGA 5D19A 5IP6A 3EUPA 1ZK8A 3S5RA 4NN1A 3HTJA 5IOYA 3DPJA 3NNRA 3LSRA 3FRQA 4M3FA 2FJI1 3O8GA 1VI0A 2V57A 4OD4A 2REKA 3VW2A 4GCKA 3G1MA 3JSJA 5F0CA 1RKTA 5IPAA 3LSPA 5K7HA 4ICHA 1JUPA 3LWJA 2O7OA 3IH3A 3VIBA 3NI7A 2UXIA 4V2GA 3B81A 2GFNA 5FKNA 1RPWA 3Q0WA 3PASA 4JNNA 2G7GA 5FKMA 2X9DA 4W97A 3FK6A 3BNIA 3G1LA 2RHAA 4WIBA 4X1EA 3K8PC 2YVXA 2RAEA 3VOXA 2XGEA 3VOKA 2DTZA 3BR0A 3PM1A 2NS7A 2EH3A 5FKLA 4OD5A 2XB5A 3V78A 2JJ7A 2IBDA 2X6OA 2XRLA 2ZY9A 3SFIA 4D5CA 4PXIA 3AQTA 4MO7A 5D1RA 2ZOYA 5J1RA 4U9NA 3KZ9A 2QKOA 2DG8A 2FJ1A 3DEWA 3NS4A 2NP5A 3COLA 5J3LA 3BTCA 2GUHA 5F0HA 3BTLA 5AQCA 2VKEA 2TRTA 3G56A 3SDGA 3TP3A 2HXIA 3FIWA 2R7OA 2HKUA 2OI8A 3VW1A 5CXIA 5K58A 4M3EA 3TP0A 4AUXA 3HTIA 5F08A 2OF7A 2PFVA 2XGDA 2UXOA 3P9TA 3SWHA 3EGQA 1ZKGA 3ON4A 5FKKA 2XGCA 3C07A 3VVYA 3VPRA 1JUMA 4GFKA 3Q0UA 3HTHA 4NELA 4U9LA 4ACIA 2GBYA 2Y30A 5HBUA 2Y2ZA 3BR5A 3ZQLA 3G7RA 3KKCA 5HSZA 4W1UA 2R7RA 3Q0VA 5F0FA 2VPRA 1JTYA 2R7UA 2B3WA 5CXGA 3NPIA 2VKVA 3B6AA 5FMPA 5H9TA 1JT0A 3BCGA 3T6NA 3O8HA 3HIMA 3VVXA 2R7WA 2YVHA 4B1RA 1ORKA 2DG7A 2FX0A 3BR6A 1RKWA 5F04A 2G0EA 3VW0A 2G7SA 3RH2A 2HYJA 2IAIA 3DU6A 3VP5A 3ZQIA 1Z77A 2JK3A 3BR3A 4MXMA 3HTAA 5CW8A 3G1OA 2XPWA 3IH2A 4AC0A 2D6YA 3C2BA 5GPAA 1JTXA 2QOPA 4I76A 3GZIA 2ID3A 3KKDA 3QBMA 3VTIA 3HGYA 2UXPA 3LSJA 2ZCMA 2I10A 3LOCA 5K7FA 3QQAA 2NS8A
chains in the Genus database with same CATH topology
1QPIA 3NRGA 4D7MA 5FHPA 4DW6A 1QVTA 2HYTA 3MNLA 1U9OA 4GCTA 1T33A 2NP3A 2RASA 3QPLA 2W53A 2G3BA 2OPTA 1JT6A 3V6GA 3ZQGA 3NXCA 3E7QA 4ABZA 4JKZA 3FK7A 2O7TA 4KWAA 4MK6A 3CDLA 4CGRA 3PPBA 3BQZA 4YZEA 3BR1A 3VVZA 4ME9A 3BRUA 3BR2A 1T56A 1Z0XA 3HE0A 3KNWA 1SGMA 2TCTA 2FBQA 5FGLA 5C4YA 2G7LA 2WGBA 3F1BA 3VUQA 5GPCA 1UI6A 2UXHA 3QKXA 4B3AA 1U9NA 3BHQA 2Y31A 5HAWA 1BJZA 1JUSA 3RD3A 2XDNA 1QVUA 3BTJA 5DAJA 3CJDA 2HQ5A 2NX4A 3ANGA 2Q24A 5F1JA 4L62A 4XK4A 3ANPA 4AC6A 1UI5A 2ZOZA 3LJLA 4M3DA 4GFLA 2F07A 2XPUA 2FD5A 2UXUA 5F27A 4M3BA 2IEKA 4AF5A 4D5FA 3WHCA 1A6IA 4V2FA 3CWRA 3BJBA 4JYKA 3AQSA 3HGGA 2FQ4A 3DCFA 2HXOA 2XPVA 2GENA 3CRJA 5EZHA 4D7NA 2QTQA 4HKUA 2WUIA 3BTIA 3B6CA 2WV1A 2ZCNA 3CCYA 2ZB9A 3BT9A 2YVEA 3Q3SA 2QCOA 2QWTA 3IH4A 5EFYA 4G12A 4JL3A 3ZQFA 4M3GA 2PBXA 5J1UA 3WHBA 2ZCXA 3QPSA 5K7ZA 2OERA 3ON2A 3LHQA 2QIBA 3ZQHA 3IUVA 5GP9A 4UDSA 5J1YA 4I6ZA 2PZ9A 5D18A 3BQYA 3O60A 5IOZA 5FKOA 2ID6A 3GEUA 3F0CA 2IU5A 3MVPA 4GCLA 5EYRA 5EZGA 5D19A 5IP6A 3EUPA 1ZK8A 3S5RA 4NN1A 3HTJA 5IOYA 3DPJA 3NNRA 3LSRA 3FRQA 4M3FA 3O8GA 1VI0A 2V57A 2REKA 3VW2A 4GCKA 3G1MA 3JSJA 5F0CA 1RKTA 5IPAA 3LSPA 5K7HA 4ICHA 1JUPA 3LWJA 2O7OA 3IH3A 3VIBA 3NI7A 2UXIA 4V2GA 3B81A 2GFNA 5FKNA 1RPWA 3Q0WA 3PASA 4JNNA 2G7GA 5FKMA 2X9DA 4W97A 3FK6A 3BNIA 3G1LA 2RHAA 4X1EA 2RAEA 3VOXA 2XGEA 3VOKA 2DTZA 3BR0A 3PM1A 2NS7A 2EH3A 5FKLA 2XB5A 3V78A 2JJ7A 2IBDA 2X6OA 2XRLA 3SFIA 4D5CA 4PXIA 3AQTA 4MO7A 5D1RA 2ZOYA 5J1RA 3KZ9A 2QKOA 2DG8A 2FJ1A 3DEWA 2NP5A 3COLA 5J3LA 3BTCA 2GUHA 5F0HA 3BTLA 5AQCA 2VKEA 2TRTA 3G56A 3SDGA 3TP3A 2HXIA 3FIWA 2HKUA 2OI8A 3VW1A 5CXIA 5K58A 4M3EA 3TP0A 4AUXA 3HTIA 5F08A 2OF7A 2XGDA 2UXOA 3P9TA 3EGQA 1ZKGA 3ON4A 5FKKA 2XGCA 3C07A 3VVYA 3VPRA 1JUMA 4GFKA 3Q0UA 3HTHA 4NELA 4ACIA 2GBYA 2Y30A 5HBUA 2Y2ZA 3BR5A 3ZQLA 3G7RA 3KKCA 5HSZA 4W1UA 3Q0VA 5F0FA 2VPRA 1JTYA 5CXGA 3NPIA 2VKVA 3B6AA 5FMPA 5H9TA 1JT0A 3BCGA 3T6NA 3O8HA 3HIMA 3VVXA 2YVHA 4B1RA 1ORKA 2DG7A 2FX0A 3BR6A 1RKWA 5F04A 2G0EA 3VW0A 2G7SA 3RH2A 2HYJA 2IAIA 3VP5A 3ZQIA 1Z77A 2JK3A 3BR3A 4MXMA 3HTAA 5CW8A 3G1OA 2XPWA 3IH2A 4AC0A 2D6YA 3C2BA 5GPAA 1JTXA 2QOPA 4I76A 3GZIA 2ID3A 3KKDA 3QBMA 3HGYA 2UXPA 3LSJA 2ZCMA 2I10A 3LOCA 5K7FA 3QQAA 2NS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPI A;  3NRG A;  4D7M A;  5FHP A;  4DW6 A;  1QVT A;  2HYT A;  3MNL A;  1U9O A;  4GCT A;  1T33 A;  2NP3 A;  2RAS A;  3QPL A;  2W53 A;  2G3B A;  2OPT A;  1JT6 A;  3V6G A;  3ZQG A;  3NXC A;  3E7Q A;  4ABZ A;  4JKZ A;  3FK7 A;  2O7T A;  4KWA A;  4MK6 A;  3CDL A;  4CGR A;  3PPB A;  3BQZ A;  4YZE A;  3BR1 A;  3VVZ A;  4ME9 A;  3BRU A;  3BR2 A;  1T56 A;  1Z0X A;  3HE0 A;  3KNW A;  1SGM A;  2TCT A;  2FBQ A;  5FGL A;  5C4Y A;  2G7L A;  2WGB A;  3F1B A;  3VUQ A;  5GPC A;  1UI6 A;  2UXH A;  3QKX A;  4B3A A;  1U9N A;  3BHQ A;  2Y31 A;  5HAW A;  1BJZ A;  1JUS A;  3RD3 A;  2XDN A;  1QVU A;  3BTJ A;  5DAJ A;  3CJD A;  2HQ5 A;  2NX4 A;  3ANG A;  2Q24 A;  5F1J A;  4L62 A;  4XK4 A;  3ANP A;  4AC6 A;  1UI5 A;  2ZOZ A;  3LJL A;  4M3D A;  4GFL A;  2F07 A;  2XPU A;  2FD5 A;  2UXU A;  5F27 A;  4M3B A;  2IEK A;  4AF5 A;  4D5F A;  3WHC A;  1A6I A;  4V2F A;  3CWR A;  3BJB A;  4JYK A;  3AQS A;  3HGG A;  2FQ4 A;  3DCF A;  2HXO A;  2XPV A;  2GEN A;  3CRJ A;  5EZH A;  4D7N A;  2QTQ A;  4HKU A;  2WUI A;  3BTI A;  3B6C A;  2WV1 A;  2ZCN A;  3CCY A;  2ZB9 A;  3BT9 A;  2YVE A;  3Q3S A;  2QCO A;  2QWT A;  3IH4 A;  5EFY A;  4G12 A;  4JL3 A;  3ZQF A;  4M3G A;  2PBX A;  5J1U A;  3WHB A;  2ZCX A;  3QPS A;  5K7Z A;  2OER A;  3ON2 A;  3LHQ A;  2QIB A;  3ZQH A;  3IUV A;  5GP9 A;  4UDS A;  5J1Y A;  4I6Z A;  2PZ9 A;  5D18 A;  3BQY A;  3O60 A;  5IOZ A;  5FKO A;  2ID6 A;  3GEU A;  3F0C A;  2IU5 A;  3MVP A;  4GCL A;  5EYR A;  5EZG A;  5D19 A;  5IP6 A;  3EUP A;  1ZK8 A;  3S5R A;  4NN1 A;  3HTJ A;  5IOY A;  3DPJ A;  3NNR A;  3LSR A;  3FRQ A;  4M3F A;  3O8G A;  1VI0 A;  2V57 A;  2REK A;  3VW2 A;  4GCK A;  3G1M A;  3JSJ A;  5F0C A;  1RKT A;  5IPA A;  3LSP A;  5K7H A;  4ICH A;  1JUP A;  3LWJ A;  2O7O A;  3IH3 A;  3VIB A;  3NI7 A;  2UXI A;  4V2G A;  3B81 A;  2GFN A;  5FKN A;  1RPW A;  3Q0W A;  3PAS A;  4JNN A;  2G7G A;  5FKM A;  2X9D A;  4W97 A;  3FK6 A;  3BNI A;  3G1L A;  2RHA A;  4X1E A;  2RAE A;  3VOX A;  2XGE A;  3VOK A;  2DTZ A;  3BR0 A;  3PM1 A;  2NS7 A;  2EH3 A;  5FKL A;  2XB5 A;  3V78 A;  2JJ7 A;  2IBD A;  2X6O A;  2XRL A;  3SFI A;  4D5C A;  4PXI A;  3AQT A;  4MO7 A;  5D1R A;  2ZOY A;  5J1R A;  3KZ9 A;  2QKO A;  2DG8 A;  2FJ1 A;  3DEW A;  2NP5 A;  3COL A;  5J3L A;  3BTC A;  2GUH A;  5F0H A;  3BTL A;  5AQC A;  2VKE A;  2TRT A;  3G56 A;  3SDG A;  3TP3 A;  2HXI A;  3FIW A;  2HKU A;  2OI8 A;  3VW1 A;  5CXI A;  5K58 A;  4M3E A;  3TP0 A;  4AUX A;  3HTI A;  5F08 A;  2OF7 A;  2XGD A;  2UXO A;  3P9T A;  3EGQ A;  1ZKG A;  3ON4 A;  5FKK A;  2XGC A;  3C07 A;  3VVY A;  3VPR A;  1JUM A;  4GFK A;  3Q0U A;  3HTH A;  4NEL A;  4ACI A;  2GBY A;  2Y30 A;  5HBU A;  2Y2Z A;  3BR5 A;  3ZQL A;  3G7R A;  3KKC A;  5HSZ A;  4W1U A;  3Q0V A;  5F0F A;  2VPR A;  1JTY A;  5CXG A;  3NPI A;  2VKV A;  3B6A A;  5FMP A;  5H9T A;  1JT0 A;  3BCG A;  3T6N A;  3O8H A;  3HIM A;  3VVX A;  2YVH A;  4B1R A;  1ORK A;  2DG7 A;  2FX0 A;  3BR6 A;  1RKW A;  5F04 A;  2G0E A;  3VW0 A;  2G7S A;  3RH2 A;  2HYJ A;  2IAI A;  3VP5 A;  3ZQI A;  1Z77 A;  2JK3 A;  3BR3 A;  4MXM A;  3HTA A;  5CW8 A;  3G1O A;  2XPW A;  3IH2 A;  4AC0 A;  2D6Y A;  3C2B A;  5GPA A;  1JTX A;  2QOP A;  4I76 A;  3GZI A;  2ID3 A;  3KKD A;  3QBM A;  3HGY A;  2UXP A;  3LSJ A;  2ZCM A;  2I10 A;  3LOC A;  5K7F A;  3QQA A;  2NS8 A; 
#chains in the Genus database with same CATH topology
 1QPI A;  3NRG A;  4D7M A;  5FHP A;  4DW6 A;  1QVT A;  2HYT A;  3MNL A;  1U9O A;  4GCT A;  1T33 A;  2NP3 A;  2RAS A;  3QPL A;  2R7V A;  2W53 A;  2A2F X;  2G3B A;  2OPT A;  1JT6 A;  3V6G A;  3ZQG A;  3NXC A;  3E7Q A;  4ABZ A;  4JKZ A;  3FK7 A;  2O7T A;  4KWA A;  4MK6 A;  3CDL A;  4CGR A;  3PPB A;  3BQZ A;  4YZE A;  3BR1 A;  3VVZ A;  4ME9 A;  3BRU A;  3BR2 A;  1T56 A;  1Z0X A;  3HE0 A;  3KNW A;  2R7X A;  2B1E A;  1SGM A;  2TCT A;  2FBQ A;  5FGL A;  5C4Y A;  2G7L A;  2WGB A;  3F1B A;  3VUQ A;  5GPC A;  1UI6 A;  2UXH A;  3QKX A;  4B3A A;  3KYL A;  1U9N A;  3BHQ A;  2Y31 A;  5HAW A;  1BJZ A;  1JUS A;  3RD3 A;  2XDN A;  1QVU A;  3BTJ A;  5DAJ A;  3CJD A;  4IRV A;  2HQ5 A;  2NX4 A;  3ANG A;  2Q24 A;  2R7T A;  5F1J A;  4L62 A;  4XK4 A;  3ANP A;  4AC6 A;  1UI5 A;  2ZOZ A;  3LJL A;  4M3D A;  4GFL A;  2F07 A;  2XPU A;  2FD5 A;  2UXU A;  5F27 A;  4M3B A;  2IEK A;  4AF5 A;  4D5F A;  3WHC A;  1A6I A;  4V2F A;  3CWR A;  3BJB A;  4JYK A;  3AQS A;  3FHN A;  3HGG A;  2FQ4 A;  3DCF A;  2HXO A;  2XPV A;  2GEN A;  3CRJ A;  5EZH A;  4D7N A;  2QTQ A;  4HKU A;  2WUI A;  3BTI A;  3B6C A;  2WV1 A;  2ZCN A;  3CCY A;  2ZB9 A;  3BT9 A;  2YVE A;  3Q3S A;  2QCO A;  2QWT A;  3IH4 A;  5EFY A;  4G12 A;  3DU5 A;  5CQG A;  4JL3 A;  3ZQF A;  4M3G A;  2PBX A;  5J1U A;  3WHB A;  2ZCX A;  3QPS A;  5K7Z A;  2OER A;  3ON2 A;  3LHQ A;  2QIB A;  3ZQH A;  3IUV A;  5GP9 A;  4UDS A;  5J1Y A;  2R7S A;  4I6Z A;  2PZ9 A;  4C2M A;  5D18 A;  3BQY A;  3O60 A;  5IOZ A;  5FKO A;  2ID6 A;  4DVY P;  3GEU A;  3F0C A;  2R7Q A;  2IU5 A;  3MVP A;  4GCL A;  5EYR A;  5EZG A;  5D19 A;  5IP6 A;  3EUP A;  1ZK8 A;  3S5R A;  4NN1 A;  3HTJ A;  5IOY A;  3DPJ A;  3NNR A;  3LSR A;  3FRQ A;  4M3F A;  2FJI 1;  3O8G A;  1VI0 A;  2V57 A;  4OD4 A;  2REK A;  3VW2 A;  4GCK A;  3G1M A;  3JSJ A;  5F0C A;  1RKT A;  5IPA A;  3LSP A;  5K7H A;  4ICH A;  1JUP A;  3LWJ A;  2O7O A;  3IH3 A;  3VIB A;  3NI7 A;  2UXI A;  4V2G A;  3B81 A;  2GFN A;  5FKN A;  1RPW A;  3Q0W A;  3PAS A;  4JNN A;  2G7G A;  5FKM A;  2X9D A;  4W97 A;  3FK6 A;  3BNI A;  3G1L A;  2RHA A;  4WIB A;  4X1E A;  3K8P C;  2YVX A;  2RAE A;  3VOX A;  2XGE A;  3VOK A;  2DTZ A;  3BR0 A;  3PM1 A;  2NS7 A;  2EH3 A;  5FKL A;  4OD5 A;  2XB5 A;  3V78 A;  2JJ7 A;  2IBD A;  2X6O A;  2XRL A;  2ZY9 A;  3SFI A;  4D5C A;  4PXI A;  3AQT A;  4MO7 A;  5D1R A;  2ZOY A;  5J1R A;  4U9N A;  3KZ9 A;  2QKO A;  2DG8 A;  2FJ1 A;  3DEW A;  3NS4 A;  2NP5 A;  3COL A;  5J3L A;  3BTC A;  2GUH A;  5F0H A;  3BTL A;  5AQC A;  2VKE A;  2TRT A;  3G56 A;  3SDG A;  3TP3 A;  2HXI A;  3FIW A;  2R7O A;  2HKU A;  2OI8 A;  3VW1 A;  5CXI A;  5K58 A;  4M3E A;  3TP0 A;  4AUX A;  3HTI A;  5F08 A;  2OF7 A;  2PFV A;  2XGD A;  2UXO A;  3P9T A;  3SWH A;  3EGQ A;  1ZKG A;  3ON4 A;  5FKK A;  2XGC A;  3C07 A;  3VVY A;  3VPR A;  1JUM A;  4GFK A;  3Q0U A;  3HTH A;  4NEL A;  4U9L A;  4ACI A;  2GBY A;  2Y30 A;  5HBU A;  2Y2Z A;  3BR5 A;  3ZQL A;  3G7R A;  3KKC A;  5HSZ A;  4W1U A;  2R7R A;  3Q0V A;  5F0F A;  2VPR A;  1JTY A;  2R7U A;  2B3W A;  5CXG A;  3NPI A;  2VKV A;  3B6A A;  5FMP A;  5H9T A;  1JT0 A;  3BCG A;  3T6N A;  3O8H A;  3HIM A;  3VVX A;  2R7W A;  2YVH A;  4B1R A;  1ORK A;  2DG7 A;  2FX0 A;  3BR6 A;  1RKW A;  5F04 A;  2G0E A;  3VW0 A;  2G7S A;  3RH2 A;  2HYJ A;  2IAI A;  3DU6 A;  3VP5 A;  3ZQI A;  1Z77 A;  2JK3 A;  3BR3 A;  4MXM A;  3HTA A;  5CW8 A;  3G1O A;  2XPW A;  3IH2 A;  4AC0 A;  2D6Y A;  3C2B A;  5GPA A;  1JTX A;  2QOP A;  4I76 A;  3GZI A;  2ID3 A;  3KKD A;  3QBM A;  3VTI A;  3HGY A;  2UXP A;  3LSJ A;  2ZCM A;  2I10 A;  3LOC A;  5K7F A;  3QQA A;  2NS8 A; 
#chains in the Genus database with same CATH homology
 1QPI A;  3NRG A;  4D7M A;  5FHP A;  4DW6 A;  1QVT A;  2HYT A;  3MNL A;  1U9O A;  4GCT A;  1T33 A;  2NP3 A;  2RAS A;  3QPL A;  2W53 A;  2G3B A;  2OPT A;  1JT6 A;  3V6G A;  3ZQG A;  3NXC A;  3E7Q A;  4ABZ A;  4JKZ A;  3FK7 A;  2O7T A;  4KWA A;  4MK6 A;  3CDL A;  4CGR A;  3PPB A;  3BQZ A;  4YZE A;  3BR1 A;  3VVZ A;  4ME9 A;  3BRU A;  3BR2 A;  1T56 A;  1Z0X A;  3HE0 A;  3KNW A;  1SGM A;  2TCT A;  2FBQ A;  5FGL A;  5C4Y A;  2G7L A;  2WGB A;  3F1B A;  3VUQ A;  5GPC A;  1UI6 A;  2UXH A;  3QKX A;  4B3A A;  1U9N A;  3BHQ A;  2Y31 A;  5HAW A;  1BJZ A;  1JUS A;  3RD3 A;  2XDN A;  1QVU A;  3BTJ A;  5DAJ A;  3CJD A;  2HQ5 A;  2NX4 A;  3ANG A;  2Q24 A;  5F1J A;  4L62 A;  4XK4 A;  3ANP A;  4AC6 A;  1UI5 A;  2ZOZ A;  3LJL A;  4M3D A;  4GFL A;  2F07 A;  2XPU A;  2FD5 A;  2UXU A;  5F27 A;  4M3B A;  2IEK A;  4AF5 A;  4D5F A;  3WHC A;  1A6I A;  4V2F A;  3CWR A;  3BJB A;  4JYK A;  3AQS A;  3HGG A;  2FQ4 A;  3DCF A;  2HXO A;  2XPV A;  2GEN A;  3CRJ A;  5EZH A;  4D7N A;  2QTQ A;  4HKU A;  2WUI A;  3BTI A;  3B6C A;  2WV1 A;  2ZCN A;  3CCY A;  2ZB9 A;  3BT9 A;  2YVE A;  3Q3S A;  2QCO A;  2QWT A;  3IH4 A;  5EFY A;  4G12 A;  4JL3 A;  3ZQF A;  4M3G A;  2PBX A;  5J1U A;  3WHB A;  2ZCX A;  3QPS A;  5K7Z A;  2OER A;  3ON2 A;  3LHQ A;  2QIB A;  3ZQH A;  3IUV A;  5GP9 A;  4UDS A;  5J1Y A;  4I6Z A;  2PZ9 A;  5D18 A;  3BQY A;  3O60 A;  5IOZ A;  5FKO A;  2ID6 A;  3GEU A;  3F0C A;  2IU5 A;  3MVP A;  4GCL A;  5EYR A;  5EZG A;  5D19 A;  5IP6 A;  3EUP A;  1ZK8 A;  3S5R A;  4NN1 A;  3HTJ A;  5IOY A;  3DPJ A;  3NNR A;  3LSR A;  3FRQ A;  4M3F A;  3O8G A;  1VI0 A;  2V57 A;  2REK A;  3VW2 A;  4GCK A;  3G1M A;  3JSJ A;  5F0C A;  1RKT A;  5IPA A;  3LSP A;  5K7H A;  4ICH A;  1JUP A;  3LWJ A;  2O7O A;  3IH3 A;  3VIB A;  3NI7 A;  2UXI A;  4V2G A;  3B81 A;  2GFN A;  5FKN A;  1RPW A;  3Q0W A;  3PAS A;  4JNN A;  2G7G A;  5FKM A;  2X9D A;  4W97 A;  3FK6 A;  3BNI A;  3G1L A;  2RHA A;  4X1E A;  2RAE A;  3VOX A;  2XGE A;  3VOK A;  2DTZ A;  3BR0 A;  3PM1 A;  2NS7 A;  2EH3 A;  5FKL A;  2XB5 A;  3V78 A;  2JJ7 A;  2IBD A;  2X6O A;  2XRL A;  3SFI A;  4D5C A;  4PXI A;  3AQT A;  4MO7 A;  5D1R A;  2ZOY A;  5J1R A;  3KZ9 A;  2QKO A;  2DG8 A;  2FJ1 A;  3DEW A;  2NP5 A;  3COL A;  5J3L A;  3BTC A;  2GUH A;  5F0H A;  3BTL A;  5AQC A;  2VKE A;  2TRT A;  3G56 A;  3SDG A;  3TP3 A;  2HXI A;  3FIW A;  2HKU A;  2OI8 A;  3VW1 A;  5CXI A;  5K58 A;  4M3E A;  3TP0 A;  4AUX A;  3HTI A;  5F08 A;  2OF7 A;  2XGD A;  2UXO A;  3P9T A;  3EGQ A;  1ZKG A;  3ON4 A;  5FKK A;  2XGC A;  3C07 A;  3VVY A;  3VPR A;  1JUM A;  4GFK A;  3Q0U A;  3HTH A;  4NEL A;  4ACI A;  2GBY A;  2Y30 A;  5HBU A;  2Y2Z A;  3BR5 A;  3ZQL A;  3G7R A;  3KKC A;  5HSZ A;  4W1U A;  3Q0V A;  5F0F A;  2VPR A;  1JTY A;  5CXG A;  3NPI A;  2VKV A;  3B6A A;  5FMP A;  5H9T A;  1JT0 A;  3BCG A;  3T6N A;  3O8H A;  3HIM A;  3VVX A;  2YVH A;  4B1R A;  1ORK A;  2DG7 A;  2FX0 A;  3BR6 A;  1RKW A;  5F04 A;  2G0E A;  3VW0 A;  2G7S A;  3RH2 A;  2HYJ A;  2IAI A;  3VP5 A;  3ZQI A;  1Z77 A;  2JK3 A;  3BR3 A;  4MXM A;  3HTA A;  5CW8 A;  3G1O A;  2XPW A;  3IH2 A;  4AC0 A;  2D6Y A;  3C2B A;  5GPA A;  1JTX A;  2QOP A;  4I76 A;  3GZI A;  2ID3 A;  3KKD A;  3QBM A;  3HGY A;  2UXP A;  3LSJ A;  2ZCM A;  2I10 A;  3LOC A;  5K7F A;  3QQA A;  2NS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...