2DG9A

Fk506-binding protein mutant wl59 complexed with rapamycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGLEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg9A00
3KAFA 2ZQTA 2M08A 4DRQA 1C9HA 5J6EA 1FKDA 4DRJA 2Y78A 2OFNA 3FAPA 3KAGA 3O5MA 1NMVA 3O5FA 4GIVA 4JFLA 1Q6UA 5HT1A 3CGMA 5DIVA 2PPNA 1J4HA 3O5RA 1KT0A 4LAXA 3UI6A 3VAWA 5BXJA 2MNTA 2RUCA 4DRIA 1FKFA 2AWGA 3O5DA 4U84A 2DG9A 1Q6HA 4U86A 2K8IA 1ROUA 1QPLA 2RSEA 2XP7A 3IK8A 4DZ2A 3IHZA 1FD9A 2Q5AA 4W9OA 4IPXA 4TX0A 1M5YA 2KR7A 3LUOA 4JFMA 4DROA 5B8IC 1FKGA 3O5PA 1ZCNA 2XP5A 1QPFA 2ZR6A 3O5QA 3JYJA 4TW7A 1U79A 5HWBA 1ZK6A 1PBKA 1F8AB 3CGNA 4JFKA 4JFIA 4TW8A 1JNSA 3PA7A 2DG3A 2XP6A 2L2SA 2F4EA 5HKGA 1T11A 3JXVA 3KACA 4ODOA 1W26A 2UZ5A 3MDYB 1D7IA 1J4RA 2PV2A 2ZQSA 2ZQVA 3TDBA 1FKBA 3GPKA 2XP9A 2XP8A 3KZ7A 1D6OA 1FAPA 2JZVA 5HTGA 3UQBA 1FKKA 4DH0A 1P5QA 3OOBA 1F40A 4JFJA 3O5KA 1EYMA 1PINA 5HW6A 4QT2A 5HW8A 3NRKA 3IKGA 4IQ2A 1Q1CA 2LJ4A 2MPHA 4LAYA 4QT3A 1D7HA 1L1PA 3PRBA 4TW6A 1FKSA 2LGOA 2ZQUA 2FKEA 3NI6A 4FAPA 2ZR5A 5DITA 4DRNA 1NSGA 3H9RB 4G50A 3TCZA 1HXVA 3UQAA 4MSPA 4TYOA 2IF4A 3KAHA 2PPPA 1BL4A 2KE0A 3KCEA 4ODRA 2KGJA 2F2DA 3TC5A 1R9HA 1FJDA 2XPAA 4O2TA 2RQSA 4W9PA 1B6CA 4GGQA 4DRMA 2M1IA 2MF9A 3UF8A 3JYMA 4LAVA 3O5GA 2XP3A 1A7XA 2MLZA 4C02B 2D9FA 3PRDA 5HWCA 1TCOC 3B7XA 2PPOA 1Q6IA 1JVWA 1YW5A 2KO7A 3O5EA 4FN2A 5D75A 4J4OA 1FKLA 4ODPA 4DZ3A 4U85A 2ITKA 2VN1A 3RGCA 4ODMA 4DRKA 4N19A 1Y0OA 1N1AA 3IKDA 4DRHA 2XPBA 5DIUA 3RFWA 4DIPA 2FAPA 2N87A 3UQIA 4ITZA 4LAWA 2RUQA 2PV1A 5HW7A 1FKTA 1NMWA 1ROTA 2F21A 4ODQA 4ODNA 3ODKA 3WH0A 3KAIA 4G2PA 2MLXA 4ODKA 1YATA 4NNRA 2XP4A 3NTPA 1QZ2A 4R0XA 2PBCA 5I98A 4J4NA 1FKJA 2LKNA 4ODLA 5HUAA 3O5IA 4IQCA 2KFWA 3I6CA 4BF8A 3UI5A 1BKFA 4DRPA 1D7JA 5GPGA 2DG4A 2ZR4A 2M2AA 3EY6A 4JYSA 2RURA 4MGVA 2KI3A 3O5JA 1EQ3A 3UI4A 2VCDA 1FKHA 3O5LA 4QIBA 1J4IA 1FKRA 2RUDA 4TNSA 1J6YA 1JNTA 1FKIA 2MLYA 2PV3A 2LPVA 3KABA 3KADA 3O5OA 4DT4A 1KT1A 4W9QA
chains in the Genus database with same CATH superfamily
3ARZA 1E15A 4PTMA 2ZQTA 1VF8A 2A3BA 4DRJA 2Y78A 2DSZA 5HT1A 1KT0A 3VAWA 2RUCA 4WJXA 2AWGA 1E6PA 4U84A 2YBUA 4W9OA 4IPXA 1ZCNA 1QPFA 4TW7A 3RM9A 1F8AB 3AS2A 3PA7A 5HKGA 1LL4A 1GRJA 2PV2A 2O92A 2XP8A 3WL1A 1FKKA 4DH0A 4Z2JA 1P5QA 1EIBA 4JFJA 1PINA 3CHFA 4QT3A 1D7HA 1FKSA 1LG2A 3OA5A 4DRNA 1NSGA 4MAVA 3KCEA 2P4VA 2KGJA 2XPAA 3WD2A 2RQSA 3ARSA 4DWSC 1EHNA 3G6LA 3BXWA 1A7XA 5HWCA 3PRDA 4KQZA 1JVWA 1HKJA 4DWSB 3ARWA 4J4OA 1FKLA 4DZ3A 2ITKA 2YBTA 3AQUA 4DRKA 4ML4A 4N19A 1Y0OA 1N1AA 1E6RA 5DIUA 2PV1A 1NMWA 1ROTA 2F21A 4ODQA 3KAIA 2MLXA 3ARTA 2ESCA 3NTPA 2PBCA 4Z2HA 4J4NA 1FKJA 4ODLA 1TFVA 4BF8A 1W9UA 2DG4A 1ZBCA 1IX5A 1W9PA 1WAWA 1HJVA 1ITXA 1W1PA 4QIBA 1JNSA 2RUDA 1FKIA 3KADA 1KT1A 4W9QA 1CTNA 3RM4A 1C9HA 5J6EA 1FKDA 3KAGA 1ZBKA 2MNTA 3O5DA 1RD6A 2DG9A 1Q6HA 1ZB5A 2RSEA 1W1VA 4DZ2A 4Z2LA 4XAKA 2Q5AA 4TX0A 4JFMA 4Q22A 4IT6A 3O5QA 2A3CA 3JYJA 1U79A 3CGNA 1JNDA 2F4EA 1T11A 2DT2A 2G8ZA 4ODOA 2UZ5A 1J4RA 4Z2GA 1SR0A 2ZQVA 3GU0A 3ALFA 4UDMA 1D6OA 1HKKA 5HTGA 1F40A 1OGBA 3WD0A 2DT0A 4QT2A 1Q1CA 2LJ4A 5GQBA 3PRBA 4TW6A 2ZQUA 1ZBVA 3NI6A 5DITA 3H9RB 1E6NA 4MSPA 4TYOA 2IF4A 2KE0A 2DSVA 1SYTA 2PI6A 3TC5A 1R9HA 1FJDA 1JCHB 1LQ0A 4GGQA 4DRMA 1XRVA 2M1IA 2MF9A 2IUZA 3O5GA 2D9FA 1Q6IA 1YW5A 2KO7A 1HKIA 1OGGA 2VN1A 1E9LA 2DPEA 4ODMA 2DSUA 4W5UA 4LAWA 5HW7A 3ODKA 3CHCA 4G2PA 4NZCA 1EDQA 2XP4A 5DF0A 1QZ2A 5I98A 4L3NA 2B5UB 2LKNA 1FFQA 2WLZA 3I6CA 3QOKA 1BKFA 4MNJA 2ZR4A 1LL6A 4P8WA 4ZPVR 1K9TA 4WK9A 3WD4A 1GOIA 3CZ8A 1FKHA 3O5LA 3KABA 4DT4A 2EULA 2LPVA 2PV3A 3O5OA 4JFKA 3WL0A 4AY1A 2M08A 3WQWA 4DRQA 3FAPA 2OFNA 4GIVA 3O5MA 3O5FA 1Q6UA 4DWSA 2O9OA 3O5RA 1X6NA 4LAXA 3UI6A 1FKFA 3RM8A 4ZPTR 2K8IA 1ROUA 3B9AA 1QPLA 2XP7A 3IHZA 2WK2A 1M5YA 3LUOA 1LL7A 1D2KA 4DROA 2XP5A 1JNEA 2ZR6A 1ZK6A 1PBKA 4TW8A 3PRAA 4DWSD 2DG3A 4Z2IA 3JXVA 3KACA 3MDYB 2PN0A 4P8VA 2ZQSA 3FY1A 3KZ7A 1FAPA 1NWTA 2G41A 1HJXA 3OOBA 3O5KA 5HW6A 5HW8A 1NH6A 3NRKA 1NWSA 4HBEA 4IQ2A 3ARXA 1L1PA 2LGOA 2FKEA 4ZS6A 4HBOA 1OWQA 2ZR5A 1HXVA 3CHEA 3BMBA 3KAHA 2PPPA 1BL4A 3ARRA 4MPKA 4O2TA 1B6CA 1NWRA 2AOSA 3ALGA 4C02B 2MLZA 3ARUA 3B7XA 5JH8A 4FN2A 3WKZA 1UR8A 4ODPA 3WIJA 5HBFA 3IKDA 4Q7NA 4DRHA 3RFWA 4S3KA 4DIPA 4ITZA 2DSWA 4KR0B 4ODNA 1WNOA 1YATA 1H0GA 4R0XA 1WB0A 4MNLA 1E6ZA 4IQCA 3ARYA 3AS1A 3PR9A 4MNKA 4ZPWR 2M2AA 3ARVA 3WD3A 4WKAA 1W1TA 2RURA 4WIWA 1NWUA 1E44A 1GPFA 1FKRA 1JNTA 2MLYA 4R5EA 3GTYX 3AS0A 2WLYA 3KAFA 1HKMA 1O6IA 3B9DA 4L72B 1ZU8A 4JFLA 1NMVA 3CGMA 5DIVA 2PPNA 1J4HA 5BXJA 4DRIA 2FDMA 4WKHA 4U86A 3IK8A 4Z2KA 1FD9A 1W9VA 2KR7A 5B8IC 1FKGA 3O5PA 5HWBA 1W1YA 1KFWA 3B9EA 4JFIA 2XP6A 2L2SA 4P8XA 1H0IA 1W26A 1D7IA 3WD1A 4NSBA 3TDBA 2A3AA 1FKBA 3GPKA 2XP9A 3CH9A 2F23A 2JZVA 3UQBA 1EYMA 1HJWA 3IKGA 2MPHA 4LAYA 2A3EA 3AROA 3WQVA 3RMEA 4MTVA 4FAPA 1X6LA 4IT4A 1ZBWA 4G50A 3TCZA 3UQAA 2ETNA 2DT3A 2QF8A 4ODRA 2F2DA 4W9PA 4QZVB 2DT1A 3UF8A 4WKFA 2WM0A 3JYMA 4LAVA 1LG1A 2XP3A 4P8UA 1TCOC 2PPOA 5D75A 3O5EA 2OLHA 3CHDA 4U85A 3RGCA 5GPRA 2FAPA 2N87A 3UQIA 2RUQA 4LGXA 5DO2A 4URIA 1FKTA 4HARA 1GUVA 3WH0A 5DEZA 3G6MA 4ODKA 3FXYA 4NNRA 3ARPA 4S3JA 3EIPA 4MNMA 5HUAA 2B31A 1ZL1A 3O5IA 2KFWA 3W4RA 3UI5A 1LJYA 1UR9A 4DRPA 1D7JA 3B8SA 5GPGA 1FFRA 3EY6A 4JYSA 4MGVA 2KI3A 3O5JA 1EQ3A 3AS3A 3ARQA 2VCDA 3UI4A 1J4IA 4TNSA 1J6YA 2XPBA 1XHGA
chains in the Genus database with same CATH topology
3ARZA 1E15A 4PTMA 2ZQTA 1VF8A 2A3BA 4DRJA 2Y78A 2DSZA 5HT1A 1KT0A 3VAWA 2RUCA 4WJXA 2AWGA 1E6PA 4U84A 2YBUA 4W9OA 4IPXA 1ZCNA 1QPFA 4TW7A 3RM9A 1F8AB 3AS2A 3PA7A 5HKGA 1LL4A 2PV2A 2O92A 2XP8A 3WL1A 1FKKA 4DH0A 4Z2JA 1P5QA 1EIBA 4JFJA 1PINA 3CHFA 4QT3A 1D7HA 1FKSA 1LG2A 3OA5A 4DRNA 1NSGA 4MAVA 3KCEA 2KGJA 2XPAA 3WD2A 2RQSA 3ARSA 4DWSC 1EHNA 3G6LA 3BXWA 1A7XA 5HWCA 3PRDA 4KQZA 1JVWA 1HKJA 4DWSB 3ARWA 4J4OA 1FKLA 4DZ3A 2ITKA 2YBTA 3AQUA 4DRKA 4ML4A 4N19A 1Y0OA 1N1AA 1E6RA 5DIUA 2PV1A 1NMWA 1ROTA 2F21A 4ODQA 3KAIA 2MLXA 3ARTA 2ESCA 3NTPA 2PBCA 4Z2HA 4J4NA 1FKJA 4ODLA 1TFVA 4BF8A 1W9UA 2DG4A 1ZBCA 1IX5A 1W9PA 1WAWA 1HJVA 1ITXA 1W1PA 4QIBA 1JNSA 2RUDA 1FKIA 3KADA 1KT1A 4W9QA 1CTNA 3RM4A 1C9HA 5J6EA 1FKDA 3KAGA 1ZBKA 2MNTA 3O5DA 1RD6A 2DG9A 1Q6HA 1ZB5A 2RSEA 1W1VA 4DZ2A 4Z2LA 4XAKA 2Q5AA 4TX0A 4JFMA 4Q22A 4IT6A 3O5QA 2A3CA 3JYJA 1U79A 3CGNA 1JNDA 2F4EA 1T11A 2DT2A 2G8ZA 4ODOA 2UZ5A 1J4RA 4Z2GA 1SR0A 2ZQVA 3ALFA 1D6OA 1HKKA 5HTGA 1F40A 1OGBA 3WD0A 2DT0A 4QT2A 1Q1CA 2LJ4A 5GQBA 3PRBA 4TW6A 2ZQUA 1ZBVA 3NI6A 5DITA 3H9RB 1E6NA 4MSPA 4TYOA 2IF4A 2KE0A 2DSVA 1SYTA 2PI6A 3TC5A 1R9HA 1FJDA 1LQ0A 4GGQA 4DRMA 1XRVA 2M1IA 2MF9A 2IUZA 3O5GA 2D9FA 1Q6IA 1YW5A 2KO7A 1HKIA 1OGGA 2VN1A 1E9LA 2DPEA 4ODMA 2DSUA 4W5UA 4LAWA 5HW7A 3ODKA 3CHCA 4G2PA 4NZCA 1EDQA 2XP4A 5DF0A 1QZ2A 5I98A 4L3NA 2LKNA 1FFQA 2WLZA 3I6CA 3QOKA 1BKFA 4MNJA 2ZR4A 1LL6A 4P8WA 4ZPVR 1K9TA 4WK9A 3WD4A 1GOIA 3CZ8A 1FKHA 3O5LA 3KABA 4DT4A 2PV3A 2LPVA 3O5OA 4JFKA 3WL0A 4AY1A 2M08A 3WQWA 4DRQA 3FAPA 2OFNA 4GIVA 3O5MA 3O5FA 1Q6UA 4DWSA 2O9OA 3O5RA 1X6NA 4LAXA 3UI6A 1FKFA 3RM8A 4ZPTR 2K8IA 1ROUA 3B9AA 1QPLA 2XP7A 3IHZA 2WK2A 1M5YA 3LUOA 1LL7A 1D2KA 4DROA 2XP5A 1JNEA 2ZR6A 1ZK6A 1PBKA 4TW8A 3PRAA 4DWSD 2DG3A 4Z2IA 3JXVA 3KACA 3MDYB 4P8VA 2ZQSA 3FY1A 3KZ7A 1FAPA 1NWTA 2G41A 1HJXA 3OOBA 3O5KA 5HW6A 5HW8A 1NH6A 3NRKA 1NWSA 4HBEA 4IQ2A 3ARXA 1L1PA 2LGOA 2FKEA 4ZS6A 4HBOA 1OWQA 2ZR5A 1HXVA 3CHEA 3KAHA 2PPPA 1BL4A 3ARRA 4MPKA 4O2TA 1B6CA 1NWRA 2AOSA 3ALGA 4C02B 2MLZA 3ARUA 3B7XA 5JH8A 4FN2A 3WKZA 1UR8A 4ODPA 3WIJA 5HBFA 3IKDA 4Q7NA 4DRHA 3RFWA 4S3KA 4DIPA 4ITZA 2DSWA 4KR0B 4ODNA 1WNOA 1YATA 1H0GA 4R0XA 1WB0A 4MNLA 1E6ZA 4IQCA 3ARYA 3AS1A 3PR9A 4MNKA 4ZPWR 2M2AA 3ARVA 3WD3A 4WKAA 1W1TA 2RURA 4WIWA 1NWUA 1GPFA 1FKRA 1JNTA 2MLYA 4R5EA 3AS0A 2WLYA 3KAFA 1HKMA 1O6IA 3B9DA 4L72B 1ZU8A 4JFLA 1NMVA 3CGMA 5DIVA 2PPNA 1J4HA 5BXJA 4DRIA 2FDMA 4WKHA 4U86A 3IK8A 4Z2KA 1FD9A 1W9VA 2KR7A 5B8IC 1FKGA 3O5PA 5HWBA 1W1YA 1KFWA 3B9EA 4JFIA 2XP6A 2L2SA 4P8XA 1H0IA 1W26A 1D7IA 3WD1A 4NSBA 3TDBA 2A3AA 1FKBA 3GPKA 2XP9A 3CH9A 2JZVA 3UQBA 1EYMA 1HJWA 3IKGA 2MPHA 4LAYA 2A3EA 3AROA 3WQVA 3RMEA 4MTVA 4FAPA 1X6LA 4IT4A 1ZBWA 4G50A 3TCZA 3UQAA 2DT3A 2QF8A 4ODRA 2F2DA 4W9PA 4QZVB 2DT1A 3UF8A 4WKFA 2WM0A 3JYMA 4LAVA 1LG1A 2XP3A 4P8UA 1TCOC 2PPOA 5D75A 3O5EA 2OLHA 3CHDA 4U85A 3RGCA 5GPRA 2FAPA 2N87A 3UQIA 2RUQA 4LGXA 5DO2A 4URIA 1FKTA 4HARA 1GUVA 3WH0A 5DEZA 3G6MA 4ODKA 3FXYA 4NNRA 3ARPA 4S3JA 4MNMA 5HUAA 2B31A 1ZL1A 3O5IA 2KFWA 3W4RA 3UI5A 1LJYA 1UR9A 4DRPA 1D7JA 3B8SA 5GPGA 1FFRA 3EY6A 4JYSA 4MGVA 2KI3A 3O5JA 1EQ3A 3AS3A 3ARQA 2VCDA 3UI4A 1J4IA 4TNSA 1J6YA 2XPBA 1XHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAF A;  2ZQT A;  2M08 A;  4DRQ A;  1C9H A;  5J6E A;  1FKD A;  4DRJ A;  2Y78 A;  2OFN A;  3FAP A;  3KAG A;  3O5M A;  1NMV A;  3O5F A;  4GIV A;  4JFL A;  1Q6U A;  5HT1 A;  3CGM A;  5DIV A;  2PPN A;  1J4H A;  3O5R A;  1KT0 A;  4LAX A;  3UI6 A;  3VAW A;  5BXJ A;  2MNT A;  2RUC A;  4DRI A;  1FKF A;  2AWG A;  3O5D A;  4U84 A;  2DG9 A;  1Q6H A;  4U86 A;  2K8I A;  1ROU A;  1QPL A;  2RSE A;  2XP7 A;  3IK8 A;  4DZ2 A;  3IHZ A;  1FD9 A;  2Q5A A;  4W9O A;  4IPX A;  4TX0 A;  1M5Y A;  2KR7 A;  3LUO A;  4JFM A;  4DRO A;  5B8I C;  1FKG A;  3O5P A;  1ZCN A;  2XP5 A;  1QPF A;  2ZR6 A;  3O5Q A;  3JYJ A;  4TW7 A;  1U79 A;  5HWB A;  1ZK6 A;  1PBK A;  1F8A B;  3CGN A;  4JFK A;  4JFI A;  4TW8 A;  1JNS A;  3PA7 A;  2DG3 A;  2XP6 A;  2L2S A;  2F4E A;  5HKG A;  1T11 A;  3JXV A;  3KAC A;  4ODO A;  1W26 A;  2UZ5 A;  3MDY B;  1D7I A;  1J4R A;  2PV2 A;  2ZQS A;  2ZQV A;  3TDB A;  1FKB A;  3GPK A;  2XP9 A;  2XP8 A;  3KZ7 A;  1D6O A;  1FAP A;  2JZV A;  5HTG A;  3UQB A;  1FKK A;  4DH0 A;  1P5Q A;  3OOB A;  1F40 A;  4JFJ A;  3O5K A;  1EYM A;  1PIN A;  5HW6 A;  4QT2 A;  5HW8 A;  3NRK A;  3IKG A;  4IQ2 A;  1Q1C A;  2LJ4 A;  2MPH A;  4LAY A;  4QT3 A;  1D7H A;  1L1P A;  3PRB A;  4TW6 A;  1FKS A;  2LGO A;  2ZQU A;  2FKE A;  3NI6 A;  4FAP A;  2ZR5 A;  5DIT A;  4DRN A;  1NSG A;  3H9R B;  4G50 A;  3TCZ A;  1HXV A;  3UQA A;  4MSP A;  4TYO A;  2IF4 A;  3KAH A;  2PPP A;  1BL4 A;  2KE0 A;  3KCE A;  4ODR A;  2KGJ A;  2F2D A;  3TC5 A;  1R9H A;  1FJD A;  2XPA A;  4O2T A;  2RQS A;  4W9P A;  1B6C A;  4GGQ A;  4DRM A;  2M1I A;  2MF9 A;  3UF8 A;  3JYM A;  4LAV A;  3O5G A;  2XP3 A;  1A7X A;  2MLZ A;  4C02 B;  2D9F A;  3PRD A;  5HWC A;  1TCO C;  3B7X A;  2PPO A;  1Q6I A;  1JVW A;  1YW5 A;  2KO7 A;  3O5E A;  4FN2 A;  5D75 A;  4J4O A;  1FKL A;  4ODP A;  4DZ3 A;  4U85 A;  2ITK A;  2VN1 A;  3RGC A;  4ODM A;  4DRK A;  4N19 A;  1Y0O A;  1N1A A;  3IKD A;  4DRH A;  2XPB A;  5DIU A;  3RFW A;  4DIP A;  2FAP A;  2N87 A;  3UQI A;  4ITZ A;  4LAW A;  2RUQ A;  2PV1 A;  5HW7 A;  1FKT A;  1NMW A;  1ROT A;  2F21 A;  4ODQ A;  4ODN A;  3ODK A;  3WH0 A;  3KAI A;  4G2P A;  2MLX A;  4ODK A;  1YAT A;  4NNR A;  2XP4 A;  3NTP A;  1QZ2 A;  4R0X A;  2PBC A;  5I98 A;  4J4N A;  1FKJ A;  2LKN A;  4ODL A;  5HUA A;  3O5I A;  4IQC A;  2KFW A;  3I6C A;  4BF8 A;  3UI5 A;  1BKF A;  4DRP A;  1D7J A;  5GPG A;  2DG4 A;  2ZR4 A;  2M2A A;  3EY6 A;  4JYS A;  2RUR A;  4MGV A;  2KI3 A;  3O5J A;  1EQ3 A;  3UI4 A;  2VCD A;  1FKH A;  3O5L A;  4QIB A;  1J4I A;  1FKR A;  2RUD A;  4TNS A;  1J6Y A;  1JNT A;  1FKI A;  2MLY A;  2PV3 A;  2LPV A;  3KAB A;  3KAD A;  3O5O A;  4DT4 A;  1KT1 A;  4W9Q A; 
#chains in the Genus database with same CATH topology
 3ARZ A;  1E15 A;  4PTM A;  2ZQT A;  1VF8 A;  2A3B A;  4DRJ A;  2Y78 A;  2DSZ A;  5HT1 A;  1KT0 A;  3VAW A;  2RUC A;  4WJX A;  2AWG A;  1E6P A;  4U84 A;  2YBU A;  4W9O A;  4IPX A;  1ZCN A;  1QPF A;  4TW7 A;  3RM9 A;  1F8A B;  3AS2 A;  3PA7 A;  5HKG A;  1LL4 A;  1GRJ A;  2PV2 A;  2O92 A;  2XP8 A;  3WL1 A;  1FKK A;  4DH0 A;  4Z2J A;  1P5Q A;  1EIB A;  4JFJ A;  1PIN A;  3CHF A;  4QT3 A;  1D7H A;  1FKS A;  1LG2 A;  3OA5 A;  4DRN A;  1NSG A;  4MAV A;  3KCE A;  2P4V A;  2KGJ A;  2XPA A;  3WD2 A;  2RQS A;  3ARS A;  4DWS C;  1EHN A;  3G6L A;  3BXW A;  1A7X A;  5HWC A;  3PRD A;  4KQZ A;  1JVW A;  1HKJ A;  4DWS B;  3ARW A;  4J4O A;  1FKL A;  4DZ3 A;  2ITK A;  2YBT A;  3AQU A;  4DRK A;  4ML4 A;  4N19 A;  1Y0O A;  1N1A A;  1E6R A;  5DIU A;  2PV1 A;  1NMW A;  1ROT A;  2F21 A;  4ODQ A;  3KAI A;  2MLX A;  3ART A;  2ESC A;  3NTP A;  2PBC A;  4Z2H A;  4J4N A;  1FKJ A;  4ODL A;  1TFV A;  4BF8 A;  1W9U A;  2DG4 A;  1ZBC A;  1IX5 A;  1W9P A;  1WAW A;  1HJV A;  1ITX A;  1W1P A;  4QIB A;  1JNS A;  2RUD A;  1FKI A;  3KAD A;  1KT1 A;  4W9Q A;  1CTN A;  3RM4 A;  1C9H A;  5J6E A;  1FKD A;  3KAG A;  1ZBK A;  2MNT A;  3O5D A;  1RD6 A;  2DG9 A;  1Q6H A;  1ZB5 A;  2RSE A;  1W1V A;  4DZ2 A;  4Z2L A;  4XAK A;  2Q5A A;  4TX0 A;  4JFM A;  4Q22 A;  4IT6 A;  3O5Q A;  2A3C A;  3JYJ A;  1U79 A;  3CGN A;  1JND A;  2F4E A;  1T11 A;  2DT2 A;  2G8Z A;  4ODO A;  2UZ5 A;  1J4R A;  4Z2G A;  1SR0 A;  2ZQV A;  3GU0 A;  3ALF A;  4UDM A;  1D6O A;  1HKK A;  5HTG A;  1F40 A;  1OGB A;  3WD0 A;  2DT0 A;  4QT2 A;  1Q1C A;  2LJ4 A;  5GQB A;  3PRB A;  4TW6 A;  2ZQU A;  1ZBV A;  3NI6 A;  5DIT A;  3H9R B;  1E6N A;  4MSP A;  4TYO A;  2IF4 A;  2KE0 A;  2DSV A;  1SYT A;  2PI6 A;  3TC5 A;  1R9H A;  1FJD A;  1JCH B;  1LQ0 A;  4GGQ A;  4DRM A;  1XRV A;  2M1I A;  2MF9 A;  2IUZ A;  3O5G A;  2D9F A;  1Q6I A;  1YW5 A;  2KO7 A;  1HKI A;  1OGG A;  2VN1 A;  1E9L A;  2DPE A;  4ODM A;  2DSU A;  4W5U A;  4LAW A;  5HW7 A;  3ODK A;  3CHC A;  4G2P A;  4NZC A;  1EDQ A;  2XP4 A;  5DF0 A;  1QZ2 A;  5I98 A;  4L3N A;  2B5U B;  2LKN A;  1FFQ A;  2WLZ A;  3I6C A;  3QOK A;  1BKF A;  4MNJ A;  2ZR4 A;  1LL6 A;  4P8W A;  4ZPV R;  1K9T A;  4WK9 A;  3WD4 A;  1GOI A;  3CZ8 A;  1FKH A;  3O5L A;  3KAB A;  4DT4 A;  2EUL A;  2LPV A;  2PV3 A;  3O5O A;  4JFK A;  3WL0 A;  4AY1 A;  2M08 A;  3WQW A;  4DRQ A;  3FAP A;  2OFN A;  4GIV A;  3O5M A;  3O5F A;  1Q6U A;  4DWS A;  2O9O A;  3O5R A;  1X6N A;  4LAX A;  3UI6 A;  1FKF A;  3RM8 A;  4ZPT R;  2K8I A;  1ROU A;  3B9A A;  1QPL A;  2XP7 A;  3IHZ A;  2WK2 A;  1M5Y A;  3LUO A;  1LL7 A;  1D2K A;  4DRO A;  2XP5 A;  1JNE A;  2ZR6 A;  1ZK6 A;  1PBK A;  4TW8 A;  3PRA A;  4DWS D;  2DG3 A;  4Z2I A;  3JXV A;  3KAC A;  3MDY B;  2PN0 A;  4P8V A;  2ZQS A;  3FY1 A;  3KZ7 A;  1FAP A;  1NWT A;  2G41 A;  1HJX A;  3OOB A;  3O5K A;  5HW6 A;  5HW8 A;  1NH6 A;  3NRK A;  1NWS A;  4HBE A;  4IQ2 A;  3ARX A;  1L1P A;  2LGO A;  2FKE A;  4ZS6 A;  4HBO A;  1OWQ A;  2ZR5 A;  1HXV A;  3CHE A;  3BMB A;  3KAH A;  2PPP A;  1BL4 A;  3ARR A;  4MPK A;  4O2T A;  1B6C A;  1NWR A;  2AOS A;  3ALG A;  4C02 B;  2MLZ A;  3ARU A;  3B7X A;  5JH8 A;  4FN2 A;  3WKZ A;  1UR8 A;  4ODP A;  3WIJ A;  5HBF A;  3IKD A;  4Q7N A;  4DRH A;  3RFW A;  4S3K A;  4DIP A;  4ITZ A;  2DSW A;  4KR0 B;  4ODN A;  1WNO A;  1YAT A;  1H0G A;  4R0X A;  1WB0 A;  4MNL A;  1E6Z A;  4IQC A;  3ARY A;  3AS1 A;  3PR9 A;  4MNK A;  4ZPW R;  2M2A A;  3ARV A;  3WD3 A;  4WKA A;  1W1T A;  2RUR A;  4WIW A;  1NWU A;  1E44 A;  1GPF A;  1FKR A;  1JNT A;  2MLY A;  4R5E A;  3GTY X;  3AS0 A;  2WLY A;  3KAF A;  1HKM A;  1O6I A;  3B9D A;  4L72 B;  1ZU8 A;  4JFL A;  1NMV A;  3CGM A;  5DIV A;  2PPN A;  1J4H A;  5BXJ A;  4DRI A;  2FDM A;  4WKH A;  4U86 A;  3IK8 A;  4Z2K A;  1FD9 A;  1W9V A;  2KR7 A;  5B8I C;  1FKG A;  3O5P A;  5HWB A;  1W1Y A;  1KFW A;  3B9E A;  4JFI A;  2XP6 A;  2L2S A;  4P8X A;  1H0I A;  1W26 A;  1D7I A;  3WD1 A;  4NSB A;  3TDB A;  2A3A A;  1FKB A;  3GPK A;  2XP9 A;  3CH9 A;  2F23 A;  2JZV A;  3UQB A;  1EYM A;  1HJW A;  3IKG A;  2MPH A;  4LAY A;  2A3E A;  3ARO A;  3WQV A;  3RME A;  4MTV A;  4FAP A;  1X6L A;  4IT4 A;  1ZBW A;  4G50 A;  3TCZ A;  3UQA A;  2ETN A;  2DT3 A;  2QF8 A;  4ODR A;  2F2D A;  4W9P A;  4QZV B;  2DT1 A;  3UF8 A;  4WKF A;  2WM0 A;  3JYM A;  4LAV A;  1LG1 A;  2XP3 A;  4P8U A;  1TCO C;  2PPO A;  5D75 A;  3O5E A;  2OLH A;  3CHD A;  4U85 A;  3RGC A;  5GPR A;  2FAP A;  2N87 A;  3UQI A;  2RUQ A;  4LGX A;  5DO2 A;  4URI A;  1FKT A;  4HAR A;  1GUV A;  3WH0 A;  5DEZ A;  3G6M A;  4ODK A;  3FXY A;  4NNR A;  3ARP A;  4S3J A;  3EIP A;  4MNM A;  5HUA A;  2B31 A;  1ZL1 A;  3O5I A;  2KFW A;  3W4R A;  3UI5 A;  1LJY A;  1UR9 A;  4DRP A;  1D7J A;  3B8S A;  5GPG A;  1FFR A;  3EY6 A;  4JYS A;  4MGV A;  2KI3 A;  3O5J A;  1EQ3 A;  3AS3 A;  3ARQ A;  2VCD A;  3UI4 A;  1J4I A;  4TNS A;  1J6Y A;  2XPB A;  1XHG A; 
#chains in the Genus database with same CATH homology
 3ARZ A;  1E15 A;  4PTM A;  2ZQT A;  1VF8 A;  2A3B A;  4DRJ A;  2Y78 A;  2DSZ A;  5HT1 A;  1KT0 A;  3VAW A;  2RUC A;  4WJX A;  2AWG A;  1E6P A;  4U84 A;  2YBU A;  4W9O A;  4IPX A;  1ZCN A;  1QPF A;  4TW7 A;  3RM9 A;  1F8A B;  3AS2 A;  3PA7 A;  5HKG A;  1LL4 A;  2PV2 A;  2O92 A;  2XP8 A;  3WL1 A;  1FKK A;  4DH0 A;  4Z2J A;  1P5Q A;  1EIB A;  4JFJ A;  1PIN A;  3CHF A;  4QT3 A;  1D7H A;  1FKS A;  1LG2 A;  3OA5 A;  4DRN A;  1NSG A;  4MAV A;  3KCE A;  2KGJ A;  2XPA A;  3WD2 A;  2RQS A;  3ARS A;  4DWS C;  1EHN A;  3G6L A;  3BXW A;  1A7X A;  5HWC A;  3PRD A;  4KQZ A;  1JVW A;  1HKJ A;  4DWS B;  3ARW A;  4J4O A;  1FKL A;  4DZ3 A;  2ITK A;  2YBT A;  3AQU A;  4DRK A;  4ML4 A;  4N19 A;  1Y0O A;  1N1A A;  1E6R A;  5DIU A;  2PV1 A;  1NMW A;  1ROT A;  2F21 A;  4ODQ A;  3KAI A;  2MLX A;  3ART A;  2ESC A;  3NTP A;  2PBC A;  4Z2H A;  4J4N A;  1FKJ A;  4ODL A;  1TFV A;  4BF8 A;  1W9U A;  2DG4 A;  1ZBC A;  1IX5 A;  1W9P A;  1WAW A;  1HJV A;  1ITX A;  1W1P A;  4QIB A;  1JNS A;  2RUD A;  1FKI A;  3KAD A;  1KT1 A;  4W9Q A;  1CTN A;  3RM4 A;  1C9H A;  5J6E A;  1FKD A;  3KAG A;  1ZBK A;  2MNT A;  3O5D A;  1RD6 A;  2DG9 A;  1Q6H A;  1ZB5 A;  2RSE A;  1W1V A;  4DZ2 A;  4Z2L A;  4XAK A;  2Q5A A;  4TX0 A;  4JFM A;  4Q22 A;  4IT6 A;  3O5Q A;  2A3C A;  3JYJ A;  1U79 A;  3CGN A;  1JND A;  2F4E A;  1T11 A;  2DT2 A;  2G8Z A;  4ODO A;  2UZ5 A;  1J4R A;  4Z2G A;  1SR0 A;  2ZQV A;  3ALF A;  1D6O A;  1HKK A;  5HTG A;  1F40 A;  1OGB A;  3WD0 A;  2DT0 A;  4QT2 A;  1Q1C A;  2LJ4 A;  5GQB A;  3PRB A;  4TW6 A;  2ZQU A;  1ZBV A;  3NI6 A;  5DIT A;  3H9R B;  1E6N A;  4MSP A;  4TYO A;  2IF4 A;  2KE0 A;  2DSV A;  1SYT A;  2PI6 A;  3TC5 A;  1R9H A;  1FJD A;  1LQ0 A;  4GGQ A;  4DRM A;  1XRV A;  2M1I A;  2MF9 A;  2IUZ A;  3O5G A;  2D9F A;  1Q6I A;  1YW5 A;  2KO7 A;  1HKI A;  1OGG A;  2VN1 A;  1E9L A;  2DPE A;  4ODM A;  2DSU A;  4W5U A;  4LAW A;  5HW7 A;  3ODK A;  3CHC A;  4G2P A;  4NZC A;  1EDQ A;  2XP4 A;  5DF0 A;  1QZ2 A;  5I98 A;  4L3N A;  2LKN A;  1FFQ A;  2WLZ A;  3I6C A;  3QOK A;  1BKF A;  4MNJ A;  2ZR4 A;  1LL6 A;  4P8W A;  4ZPV R;  1K9T A;  4WK9 A;  3WD4 A;  1GOI A;  3CZ8 A;  1FKH A;  3O5L A;  3KAB A;  4DT4 A;  2PV3 A;  2LPV A;  3O5O A;  4JFK A;  3WL0 A;  4AY1 A;  2M08 A;  3WQW A;  4DRQ A;  3FAP A;  2OFN A;  4GIV A;  3O5M A;  3O5F A;  1Q6U A;  4DWS A;  2O9O A;  3O5R A;  1X6N A;  4LAX A;  3UI6 A;  1FKF A;  3RM8 A;  4ZPT R;  2K8I A;  1ROU A;  3B9A A;  1QPL A;  2XP7 A;  3IHZ A;  2WK2 A;  1M5Y A;  3LUO A;  1LL7 A;  1D2K A;  4DRO A;  2XP5 A;  1JNE A;  2ZR6 A;  1ZK6 A;  1PBK A;  4TW8 A;  3PRA A;  4DWS D;  2DG3 A;  4Z2I A;  3JXV A;  3KAC A;  3MDY B;  4P8V A;  2ZQS A;  3FY1 A;  3KZ7 A;  1FAP A;  1NWT A;  2G41 A;  1HJX A;  3OOB A;  3O5K A;  5HW6 A;  5HW8 A;  1NH6 A;  3NRK A;  1NWS A;  4HBE A;  4IQ2 A;  3ARX A;  1L1P A;  2LGO A;  2FKE A;  4ZS6 A;  4HBO A;  1OWQ A;  2ZR5 A;  1HXV A;  3CHE A;  3KAH A;  2PPP A;  1BL4 A;  3ARR A;  4MPK A;  4O2T A;  1B6C A;  1NWR A;  2AOS A;  3ALG A;  4C02 B;  2MLZ A;  3ARU A;  3B7X A;  5JH8 A;  4FN2 A;  3WKZ A;  1UR8 A;  4ODP A;  3WIJ A;  5HBF A;  3IKD A;  4Q7N A;  4DRH A;  3RFW A;  4S3K A;  4DIP A;  4ITZ A;  2DSW A;  4KR0 B;  4ODN A;  1WNO A;  1YAT A;  1H0G A;  4R0X A;  1WB0 A;  4MNL A;  1E6Z A;  4IQC A;  3ARY A;  3AS1 A;  3PR9 A;  4MNK A;  4ZPW R;  2M2A A;  3ARV A;  3WD3 A;  4WKA A;  1W1T A;  2RUR A;  4WIW A;  1NWU A;  1GPF A;  1FKR A;  1JNT A;  2MLY A;  4R5E A;  3AS0 A;  2WLY A;  3KAF A;  1HKM A;  1O6I A;  3B9D A;  4L72 B;  1ZU8 A;  4JFL A;  1NMV A;  3CGM A;  5DIV A;  2PPN A;  1J4H A;  5BXJ A;  4DRI A;  2FDM A;  4WKH A;  4U86 A;  3IK8 A;  4Z2K A;  1FD9 A;  1W9V A;  2KR7 A;  5B8I C;  1FKG A;  3O5P A;  5HWB A;  1W1Y A;  1KFW A;  3B9E A;  4JFI A;  2XP6 A;  2L2S A;  4P8X A;  1H0I A;  1W26 A;  1D7I A;  3WD1 A;  4NSB A;  3TDB A;  2A3A A;  1FKB A;  3GPK A;  2XP9 A;  3CH9 A;  2JZV A;  3UQB A;  1EYM A;  1HJW A;  3IKG A;  2MPH A;  4LAY A;  2A3E A;  3ARO A;  3WQV A;  3RME A;  4MTV A;  4FAP A;  1X6L A;  4IT4 A;  1ZBW A;  4G50 A;  3TCZ A;  3UQA A;  2DT3 A;  2QF8 A;  4ODR A;  2F2D A;  4W9P A;  4QZV B;  2DT1 A;  3UF8 A;  4WKF A;  2WM0 A;  3JYM A;  4LAV A;  1LG1 A;  2XP3 A;  4P8U A;  1TCO C;  2PPO A;  5D75 A;  3O5E A;  2OLH A;  3CHD A;  4U85 A;  3RGC A;  5GPR A;  2FAP A;  2N87 A;  3UQI A;  2RUQ A;  4LGX A;  5DO2 A;  4URI A;  1FKT A;  4HAR A;  1GUV A;  3WH0 A;  5DEZ A;  3G6M A;  4ODK A;  3FXY A;  4NNR A;  3ARP A;  4S3J A;  4MNM A;  5HUA A;  2B31 A;  1ZL1 A;  3O5I A;  2KFW A;  3W4R A;  3UI5 A;  1LJY A;  1UR9 A;  4DRP A;  1D7J A;  3B8S A;  5GPG A;  1FFR A;  3EY6 A;  4JYS A;  4MGV A;  2KI3 A;  3O5J A;  1EQ3 A;  3AS3 A;  3ARQ A;  2VCD A;  3UI4 A;  1J4I A;  4TNS A;  1J6Y A;  2XPB A;  1XHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...