2DG9A

Fk506-binding protein mutant wl59 complexed with rapamycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGLEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg9A00
5HWCA 5GPGA 4JFIA 2PV3A 4DRKA 1N1AA 1B6CA 2RUCA 4DH0A 4J4OA 2XP5A 1FKRA 4ITZA 2D9FA 1PBKA 4JFMA 1QZ2A 3O5PA 1F40A 4TX0A 3EY6A 4GIVA 1P5QA 1Q6HA 3NI6A 3O5MA 2XP3A 1J4HA 5DIUA 2XP4A 5HW7A 1NMWA 2N87A 2XP7A 2F4EA 3UQBA 1HXVA 1FKDA 3O5JA 1FKIA 5BXJA 2KE0A 2ZQTA 2PV2A 1FKSA 3O5QA 3NRKA 3PRDA 4U84A 3KAFA 1FKLA 2Y78A 1JVWA 3MDYB 1D7HA 3FAPA 1QPFA 1QPLA 1W26A 2LPVA 3RFWA 5HWBA 1ZK6A 3JXVA 3KACA 3UQAA 2MNTA 3O5FA 5HTGA 3WH0A 1J4RA 2AWGA 3VAWA 3B7XA 1ROTA 4TNSA 1D6OA 4FAPA 3KCEA 1EYMA 1PINA 4JFKA 1Q6UA 2PBCA 4DRHA 4DRNA 1ROUA 3O5RA 3LUOA 1FKHA 3PA7A 3O5EA 4W9PA 4J4NA 3OOBA 4R0XA 1C9HA 3H9RB 4U86A 4ODPA 2ZQSA 1FKKA 2Q5AA 4QT2A 1JNTA 2RQSA 2M1IA 3UI4A 4LAYA 4IQ2A 2JZVA 1FKJA 1Q1CA 3IKDA 1FKTA 5I98A 1L1PA 1T11A 1Q6IA 1TCOC 2F21A 1M5YA 5HKGA 2RUDA 2OFNA 3ODKA 2FKEA 3KAIA 1D7JA 3JYMA 4U85A 1FD9A 1FKBA 4DRMA 4DT4A 3TCZA 2VCDA 2MPHA 2K8IA 1EQ3A 2DG3A 2ZQUA 1U79A 1NSGA 4FN2A 2DG4A 4DIPA 4DROA 2RUQA 1FKFA 2XP8A 2ZR4A 3KADA 4DRJA 2ITKA 2PV1A 3O5IA 4QIBA 3PRBA 4GGQA 2MLYA 2XPBA 4IPXA 4LAXA 4ODQA 2ZR5A 4TW6A 4W9QA 2M2AA 2PPPA 4DRIA 5B8IC 2KO7A 4C02B 1FAPA 3GPKA 2KI3A 1FKGA 2IF4A 2LGOA 3KAHA 1R9HA 1Y0OA 2VN1A 2PPNA 4JYSA 4BF8A 3RGCA 1YATA 2ZQVA 4JFLA 2XPAA 2PPOA 2UZ5A 3IHZA 3O5DA 2MLXA 2FAPA 5DITA 5HUAA 4MGVA 4QT3A 2KR7A 3JYJA 3O5OA 3TDBA 4DRQA 4DZ2A 1J4IA 2XP9A 3KAGA 2L2SA 3IK8A 3O5GA 2F2DA 3O5LA 2DG9A 4JFJA 1D7IA 3NTPA 3IKGA 5HW8A 4TYOA 5HT1A 5HW6A 1F8AB 1KT1A 2LKNA 1YW5A 4N19A 3UQIA 4ODKA 3O5KA 4O2TA 4ODNA 1ZCNA 4MSPA 2LJ4A 3TC5A 5J6EA 2RSEA 1JNSA 4G2PA 2KFWA 3UI5A 3UF8A 4G50A 4ODOA 2M08A 4ODLA 2XP6A 4LAWA 4DZ3A 4TW7A 2ZR6A 4LAVA 2RURA 3CGMA 5D75A 4TW8A 2MF9A 1BL4A 3UI6A 1NMVA 1FJDA 4NNRA 1BKFA 2KGJA 2MLZA 3KABA 4DRPA 5DIVA 1A7XA 4ODMA 3I6CA 3CGNA 3KZ7A 4IQCA 4ODRA 4W9OA 1J6YA 1KT0A
chains in the Genus database with same CATH superfamily
3RM4A 3QOKA 2PV3A 2EULA 2XP5A 1FKRA 4WIWA 2QF8A 1PBKA 4TX0A 3EY6A 1HKMA 3AROA 2P4VA 5HW7A 1NMWA 2N87A 5GQBA 3WD3A 3UQBA 2PN0A 3O5JA 2DSVA 4ZPVR 1JVWA 1QPFA 1QPLA 3EIPA 2G8ZA 4DWSC 1J4RA 2AWGA 4NZCA 4MPKA 4DRNA 1Q6UA 2OLHA 1ROUA 3O5RA 3O5EA 4J4NA 1C9HA 3ARVA 3H9RB 2WM0A 3AS2A 4QT2A 4MNKA 3UI4A 1GOIA 1FKJA 1L1PA 1T11A 1TCOC 1W9VA 2RUDA 3ODKA 3GTYX 4MNMA 1CTNA 3JYMA 4U85A 4Z2HA 1FD9A 2G41A 1JNDA 1HJXA 2DG3A 2O9OA 2RUQA 2XP8A 2ZR4A 4DRJA 4ML4A 2ITKA 3O5IA 4ODQA 4W9QA 3WD2A 2PPPA 5B8IC 1FKGA 1Y0OA 4JYSA 1NWSA 4BF8A 2ESCA 1YATA 4KQZA 2ZQVA 4JFLA 4L72B 2UZ5A 5DITA 1IX5A 4MGVA 3O5OA 1NWUA 3IK8A 3O5LA 2DG9A 2A3BA 3NTPA 3FY1A 4P8VA 1E6ZA 1KT1A 4N19A 3UQIA 3O5KA 4ODNA 1ZCNA 5J6EA 1RD6A 4W9OA 1SYTA 1WAWA 1W1TA 4DZ3A 3B9EA 3ALFA 2ETNA 2ZR6A 4LAVA 4TW8A 3WQWA 1BL4A 3UI6A 1NMVA 4DRPA 3WD1A 1A7XA 1W1YA 4LGXA 1E9LA 1WNOA 3FXYA 1FFQA 5HWCA 5GPGA 1KFWA 1N1AA 1LL4A 1QZ2A 2DSWA 3O5PA 2AOSA 1P5QA 3WL0A 4UDMA 5DIUA 3ARYA 1HXVA 2ZQTA 1ZL1A 4U84A 1FKLA 2Y78A 3MDYB 1W26A 3JXVA 3WKZA 3O5FA 1E15A 3WH0A 4HBEA 1ROTA 3ARRA 1EYMA 4IT6A 2PBCA 1JCHB 4R5EA 1FKHA 4NSBA 1W1VA 3AS3A 4U86A 2ZQSA 3B9AA 1FKKA 2DPEA 1LL7A 4IQ2A 1Q1CA 5I98A 3CH9A 2YBUA 3ARPA 3KAIA 1D7JA 1FKBA 1EQ3A 1E6NA 4FN2A 1SR0A 4QIBA 3PRBA 4GGQA 5DO2A 2XPBA 4LAXA 3WD0A 4DRIA 2M2AA 4C02B 2IF4A 3KAHA 3B9DA 1K9TA 3BXWA 3RGCA 2XPAA 2PPOA 3IHZA 1E44A 4L3NA 2KR7A 3JYJA 4P8XA 4QT3A 2XP9A 1H0IA 1LQ0A 1D7IA 3IKGA 5HW6A 1F8AB 4ODKA 1UR9A 4HBOA 2LJ4A 2RSEA 1JNSA 2DSUA 3UF8A 2DT1A 2RURA 3WIJA 4Q22A 3RMEA 3I6CA 1ZU8A 3KZ7A 4IQCA 4ODRA 3OA5A 1J6YA 1KT0A 3PRAA 4JFIA 4DRKA 1GUVA 4DH0A 4J4OA 3PR9A 3ARUA 4XAKA 4GIVA 1Q6HA 3WL1A 3O5MA 2XP3A 1UR8A 2XP4A 2XP7A 4DWSB 1FKIA 3NRKA 1HKJA 5DEZA 1D7HA 5HWBA 1ZK6A 3KACA 3UQAA 2WLZA 2MNTA 5HTGA 3VAWA 3B7XA 1EDQA 3CHDA 4FAPA 3KCEA 4DRHA 3LUOA 3CHCA 4W9PA 2PI6A 3ARXA 1OGGA 4Q7NA 5GPRA 4ODPA 2RQSA 2M1IA 4ZPWR 3IKDA 1FKTA 1O6IA 1Q6IA 1TFVA 2F23A 1M5YA 1OGBA 2OFNA 2FKEA 3CZ8A 1ITXA 3ALGA 4MAVA 1X6NA 2VCDA 2K8IA 2DT0A 1NH6A 1NSGA 3CHFA 2DG4A 4DIPA 4WKAA 4DROA 5HKGA 1XHGA 2A3CA 3CHEA 4P8WA 4IPXA 2MLYA 4MTVA 2ZR5A 4HARA 2DT3A 2KO7A 1FAPA 2KI3A 1HJWA 1JNEA 2LGOA 1D2KA 1R9HA 1NWRA 2PPNA 4WK9A 1HKKA 1LG1A 1ZB5A 4ZS6A 2FAPA 2YBTA 3TDBA 1J4IA 3ARSA 4JFJA 3O5GA 2F2DA 5HW8A 1FFRA 1ZBVA 4URIA 3G6LA 2LKNA 1YW5A 1EHNA 4MSPA 4S3JA 4WKHA 2KFWA 1X6LA 4G50A 2M08A 4TW7A 3RM8A 4P8UA 2MF9A 4NNRA 1BKFA 2KGJA 2O92A 4PTMA 1GPFA 2FDMA 1ZBWA 1LL6A 4ODMA 3CGNA 5JH8A 1B6CA 2RUCA 1WB0A 4ITZA 2D9FA 4JFMA 1F40A 3AS0A 3NI6A 1VF8A 1J4HA 1E6RA 3ARWA 2F4EA 1FKDA 5BXJA 2KE0A 4WKFA 2PV2A 1FKSA 3O5QA 3PRDA 2A3EA 4Z2IA 3KAFA 4ZPTR 3FAPA 1LG2A 1HKIA 2LPVA 4Z2KA 2DSZA 1LJYA 2WK2A 4QZVB 4TNSA 1D6OA 1H0GA 4JFKA 1PINA 1E6PA 4Z2JA 3PA7A 3OOBA 4R0XA 3B8SA 1W9PA 2Q5AA 2B5UB 3WQVA 1JNTA 4LAYA 2JZVA 3BMBA 1ZBKA 2F21A 1EIBA 4MNLA 4S3KA 3ARTA 2IUZA 4W5UA 5HBFA 4DRMA 4DT4A 3TCZA 2MPHA 4DWSA 4AY1A 2ZQUA 1U79A 3GU0A 1FKFA 3KADA 4IT4A 2B31A 2PV1A 1W9UA 4TW6A 5DF0A 2DT2A 3GPKA 4Z2LA 2VN1A 4Z2GA 3WD4A 1HJVA 3O5DA 5HUAA 2MLXA 2A3AA 4WJXA 4DZ2A 4DRQA 3KAGA 2L2SA 3W4RA 1GRJA 4TYOA 5HT1A 3AS1A 4O2TA 3AQUA 3TC5A 4G2PA 1NWTA 3UI5A 4ODOA 3RM9A 4KR0B 4ODLA 2XP6A 4LAWA 4DWSD 3CGMA 5D75A 1XRVA 2WLYA 1ZBCA 1FJDA 1W1PA 2MLZA 3KABA 3ARQA 3ARZA 3G6MA 4MNJA 5DIVA 1OWQA 3RFWA
chains in the Genus database with same CATH topology
3RM4A 3QOKA 2PV3A 2XP5A 1FKRA 4WIWA 2QF8A 1PBKA 4TX0A 3EY6A 1HKMA 3AROA 5HW7A 1NMWA 2N87A 5GQBA 3WD3A 3UQBA 3O5JA 2DSVA 4ZPVR 1JVWA 1QPFA 1QPLA 2G8ZA 4DWSC 1J4RA 2AWGA 4NZCA 4MPKA 4DRNA 1Q6UA 2OLHA 1ROUA 3O5RA 3O5EA 4J4NA 1C9HA 3ARVA 3H9RB 2WM0A 3AS2A 4QT2A 4MNKA 3UI4A 1GOIA 1FKJA 1L1PA 1T11A 1TCOC 1W9VA 2RUDA 3ODKA 4MNMA 1CTNA 3JYMA 4U85A 4Z2HA 1FD9A 2G41A 1JNDA 1HJXA 2DG3A 2O9OA 2RUQA 2XP8A 2ZR4A 4DRJA 4ML4A 2ITKA 3O5IA 4ODQA 4W9QA 3WD2A 2PPPA 5B8IC 1FKGA 1Y0OA 4JYSA 1NWSA 4BF8A 2ESCA 1YATA 4KQZA 2ZQVA 4JFLA 4L72B 2UZ5A 5DITA 1IX5A 4MGVA 3O5OA 1NWUA 3IK8A 3O5LA 2DG9A 2A3BA 3NTPA 3FY1A 4P8VA 1E6ZA 1KT1A 4N19A 3UQIA 3O5KA 4ODNA 1ZCNA 5J6EA 1RD6A 4W9OA 1SYTA 1WAWA 1W1TA 4DZ3A 3B9EA 3ALFA 2ZR6A 4LAVA 4TW8A 3WQWA 1BL4A 3UI6A 1NMVA 4DRPA 3WD1A 1A7XA 1W1YA 4LGXA 1E9LA 1WNOA 3FXYA 1FFQA 5HWCA 5GPGA 1KFWA 1N1AA 1LL4A 1QZ2A 2DSWA 3O5PA 2AOSA 1P5QA 3WL0A 5DIUA 3ARYA 1HXVA 2ZQTA 1ZL1A 4U84A 1FKLA 2Y78A 3MDYB 1W26A 3JXVA 3WKZA 3O5FA 1E15A 3WH0A 4HBEA 1ROTA 3ARRA 1EYMA 4IT6A 2PBCA 4R5EA 1FKHA 4NSBA 1W1VA 3AS3A 4U86A 2ZQSA 3B9AA 1FKKA 2DPEA 1LL7A 4IQ2A 1Q1CA 5I98A 3CH9A 2YBUA 3ARPA 3KAIA 1D7JA 1FKBA 1EQ3A 1E6NA 4FN2A 1SR0A 4QIBA 3PRBA 4GGQA 5DO2A 2XPBA 4LAXA 3WD0A 4DRIA 2M2AA 4C02B 2IF4A 3KAHA 3B9DA 1K9TA 3BXWA 3RGCA 2XPAA 2PPOA 3IHZA 4L3NA 2KR7A 3JYJA 4P8XA 4QT3A 2XP9A 1H0IA 1LQ0A 1D7IA 3IKGA 5HW6A 1F8AB 4ODKA 1UR9A 4HBOA 2LJ4A 2RSEA 1JNSA 2DSUA 3UF8A 2DT1A 2RURA 3WIJA 4Q22A 3RMEA 3I6CA 1ZU8A 3KZ7A 4IQCA 4ODRA 3OA5A 1J6YA 1KT0A 3PRAA 4JFIA 4DRKA 1GUVA 4DH0A 4J4OA 3PR9A 3ARUA 4XAKA 4GIVA 1Q6HA 3WL1A 3O5MA 2XP3A 1UR8A 2XP4A 2XP7A 4DWSB 1FKIA 3NRKA 1HKJA 5DEZA 1D7HA 5HWBA 1ZK6A 3KACA 3UQAA 2WLZA 2MNTA 5HTGA 3VAWA 3B7XA 1EDQA 3CHDA 4FAPA 3KCEA 4DRHA 3LUOA 3CHCA 4W9PA 2PI6A 3ARXA 1OGGA 4Q7NA 5GPRA 4ODPA 2RQSA 2M1IA 4ZPWR 3IKDA 1FKTA 1O6IA 1Q6IA 1TFVA 1M5YA 1OGBA 2OFNA 2FKEA 3CZ8A 1ITXA 3ALGA 4MAVA 1X6NA 2VCDA 2K8IA 2DT0A 1NH6A 1NSGA 3CHFA 2DG4A 4DIPA 4WKAA 4DROA 5HKGA 1XHGA 2A3CA 3CHEA 4P8WA 4IPXA 2MLYA 4MTVA 2ZR5A 4HARA 2DT3A 2KO7A 1FAPA 2KI3A 1HJWA 1JNEA 2LGOA 1D2KA 1R9HA 1NWRA 2PPNA 4WK9A 1HKKA 1LG1A 1ZB5A 4ZS6A 2FAPA 2YBTA 3TDBA 1J4IA 3ARSA 4JFJA 3O5GA 2F2DA 5HW8A 1FFRA 1ZBVA 4URIA 3G6LA 2LKNA 1YW5A 1EHNA 4MSPA 4S3JA 4WKHA 2KFWA 1X6LA 4G50A 2M08A 4TW7A 3RM8A 4P8UA 2MF9A 4NNRA 1BKFA 2KGJA 2O92A 4PTMA 1GPFA 2FDMA 1ZBWA 1LL6A 4ODMA 3CGNA 5JH8A 1B6CA 2RUCA 1WB0A 4ITZA 2D9FA 4JFMA 1F40A 3AS0A 3NI6A 1VF8A 1J4HA 1E6RA 3ARWA 2F4EA 1FKDA 5BXJA 2KE0A 4WKFA 2PV2A 1FKSA 3O5QA 3PRDA 2A3EA 4Z2IA 3KAFA 4ZPTR 3FAPA 1LG2A 1HKIA 2LPVA 4Z2KA 2DSZA 1LJYA 2WK2A 4QZVB 4TNSA 1D6OA 1H0GA 4JFKA 1PINA 1E6PA 4Z2JA 3PA7A 3OOBA 4R0XA 3B8SA 1W9PA 2Q5AA 3WQVA 1JNTA 4LAYA 2JZVA 1ZBKA 2F21A 1EIBA 4MNLA 4S3KA 3ARTA 2IUZA 4W5UA 5HBFA 4DRMA 4DT4A 3TCZA 2MPHA 4DWSA 4AY1A 2ZQUA 1U79A 1FKFA 3KADA 4IT4A 2B31A 2PV1A 1W9UA 4TW6A 5DF0A 2DT2A 3GPKA 4Z2LA 2VN1A 4Z2GA 3WD4A 1HJVA 3O5DA 5HUAA 2MLXA 2A3AA 4WJXA 4DZ2A 4DRQA 3KAGA 2L2SA 3W4RA 4TYOA 5HT1A 3AS1A 4O2TA 3AQUA 3TC5A 4G2PA 1NWTA 3UI5A 4ODOA 3RM9A 4KR0B 4ODLA 2XP6A 4LAWA 4DWSD 3CGMA 5D75A 1XRVA 2WLYA 1ZBCA 1FJDA 1W1PA 2MLZA 3KABA 3ARQA 3ARZA 3G6MA 4MNJA 5DIVA 1OWQA 3RFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWC A;  5GPG A;  4JFI A;  2PV3 A;  4DRK A;  1N1A A;  1B6C A;  2RUC A;  4DH0 A;  4J4O A;  2XP5 A;  1FKR A;  4ITZ A;  2D9F A;  1PBK A;  4JFM A;  1QZ2 A;  3O5P A;  1F40 A;  4TX0 A;  3EY6 A;  4GIV A;  1P5Q A;  1Q6H A;  3NI6 A;  3O5M A;  2XP3 A;  1J4H A;  5DIU A;  2XP4 A;  5HW7 A;  1NMW A;  2N87 A;  2XP7 A;  2F4E A;  3UQB A;  1HXV A;  1FKD A;  3O5J A;  1FKI A;  5BXJ A;  2KE0 A;  2ZQT A;  2PV2 A;  1FKS A;  3O5Q A;  3NRK A;  3PRD A;  4U84 A;  3KAF A;  1FKL A;  2Y78 A;  1JVW A;  3MDY B;  1D7H A;  3FAP A;  1QPF A;  1QPL A;  1W26 A;  2LPV A;  3RFW A;  5HWB A;  1ZK6 A;  3JXV A;  3KAC A;  3UQA A;  2MNT A;  3O5F A;  5HTG A;  3WH0 A;  1J4R A;  2AWG A;  3VAW A;  3B7X A;  1ROT A;  4TNS A;  1D6O A;  4FAP A;  3KCE A;  1EYM A;  1PIN A;  4JFK A;  1Q6U A;  2PBC A;  4DRH A;  4DRN A;  1ROU A;  3O5R A;  3LUO A;  1FKH A;  3PA7 A;  3O5E A;  4W9P A;  4J4N A;  3OOB A;  4R0X A;  1C9H A;  3H9R B;  4U86 A;  4ODP A;  2ZQS A;  1FKK A;  2Q5A A;  4QT2 A;  1JNT A;  2RQS A;  2M1I A;  3UI4 A;  4LAY A;  4IQ2 A;  2JZV A;  1FKJ A;  1Q1C A;  3IKD A;  1FKT A;  5I98 A;  1L1P A;  1T11 A;  1Q6I A;  1TCO C;  2F21 A;  1M5Y A;  5HKG A;  2RUD A;  2OFN A;  3ODK A;  2FKE A;  3KAI A;  1D7J A;  3JYM A;  4U85 A;  1FD9 A;  1FKB A;  4DRM A;  4DT4 A;  3TCZ A;  2VCD A;  2MPH A;  2K8I A;  1EQ3 A;  2DG3 A;  2ZQU A;  1U79 A;  1NSG A;  4FN2 A;  2DG4 A;  4DIP A;  4DRO A;  2RUQ A;  1FKF A;  2XP8 A;  2ZR4 A;  3KAD A;  4DRJ A;  2ITK A;  2PV1 A;  3O5I A;  4QIB A;  3PRB A;  4GGQ A;  2MLY A;  2XPB A;  4IPX A;  4LAX A;  4ODQ A;  2ZR5 A;  4TW6 A;  4W9Q A;  2M2A A;  2PPP A;  4DRI A;  5B8I C;  2KO7 A;  4C02 B;  1FAP A;  3GPK A;  2KI3 A;  1FKG A;  2IF4 A;  2LGO A;  3KAH A;  1R9H A;  1Y0O A;  2VN1 A;  2PPN A;  4JYS A;  4BF8 A;  3RGC A;  1YAT A;  2ZQV A;  4JFL A;  2XPA A;  2PPO A;  2UZ5 A;  3IHZ A;  3O5D A;  2MLX A;  2FAP A;  5DIT A;  5HUA A;  4MGV A;  4QT3 A;  2KR7 A;  3JYJ A;  3O5O A;  3TDB A;  4DRQ A;  4DZ2 A;  1J4I A;  2XP9 A;  3KAG A;  2L2S A;  3IK8 A;  3O5G A;  2F2D A;  3O5L A;  2DG9 A;  4JFJ A;  1D7I A;  3NTP A;  3IKG A;  5HW8 A;  4TYO A;  5HT1 A;  5HW6 A;  1F8A B;  1KT1 A;  2LKN A;  1YW5 A;  4N19 A;  3UQI A;  4ODK A;  3O5K A;  4O2T A;  4ODN A;  1ZCN A;  4MSP A;  2LJ4 A;  3TC5 A;  5J6E A;  2RSE A;  1JNS A;  4G2P A;  2KFW A;  3UI5 A;  3UF8 A;  4G50 A;  4ODO A;  2M08 A;  4ODL A;  2XP6 A;  4LAW A;  4DZ3 A;  4TW7 A;  2ZR6 A;  4LAV A;  2RUR A;  3CGM A;  5D75 A;  4TW8 A;  2MF9 A;  1BL4 A;  3UI6 A;  1NMV A;  1FJD A;  4NNR A;  1BKF A;  2KGJ A;  2MLZ A;  3KAB A;  4DRP A;  5DIV A;  1A7X A;  4ODM A;  3I6C A;  3CGN A;  3KZ7 A;  4IQC A;  4ODR A;  4W9O A;  1J6Y A;  1KT0 A; 
#chains in the Genus database with same CATH topology
 3RM4 A;  3QOK A;  2PV3 A;  2EUL A;  2XP5 A;  1FKR A;  4WIW A;  2QF8 A;  1PBK A;  4TX0 A;  3EY6 A;  1HKM A;  3ARO A;  2P4V A;  5HW7 A;  1NMW A;  2N87 A;  5GQB A;  3WD3 A;  3UQB A;  2PN0 A;  3O5J A;  2DSV A;  4ZPV R;  1JVW A;  1QPF A;  1QPL A;  3EIP A;  2G8Z A;  4DWS C;  1J4R A;  2AWG A;  4NZC A;  4MPK A;  4DRN A;  1Q6U A;  2OLH A;  1ROU A;  3O5R A;  3O5E A;  4J4N A;  1C9H A;  3ARV A;  3H9R B;  2WM0 A;  3AS2 A;  4QT2 A;  4MNK A;  3UI4 A;  1GOI A;  1FKJ A;  1L1P A;  1T11 A;  1TCO C;  1W9V A;  2RUD A;  3ODK A;  3GTY X;  4MNM A;  1CTN A;  3JYM A;  4U85 A;  4Z2H A;  1FD9 A;  2G41 A;  1JND A;  1HJX A;  2DG3 A;  2O9O A;  2RUQ A;  2XP8 A;  2ZR4 A;  4DRJ A;  4ML4 A;  2ITK A;  3O5I A;  4ODQ A;  4W9Q A;  3WD2 A;  2PPP A;  5B8I C;  1FKG A;  1Y0O A;  4JYS A;  1NWS A;  4BF8 A;  2ESC A;  1YAT A;  4KQZ A;  2ZQV A;  4JFL A;  4L72 B;  2UZ5 A;  5DIT A;  1IX5 A;  4MGV A;  3O5O A;  1NWU A;  3IK8 A;  3O5L A;  2DG9 A;  2A3B A;  3NTP A;  3FY1 A;  4P8V A;  1E6Z A;  1KT1 A;  4N19 A;  3UQI A;  3O5K A;  4ODN A;  1ZCN A;  5J6E A;  1RD6 A;  4W9O A;  1SYT A;  1WAW A;  1W1T A;  4DZ3 A;  3B9E A;  3ALF A;  2ETN A;  2ZR6 A;  4LAV A;  4TW8 A;  3WQW A;  1BL4 A;  3UI6 A;  1NMV A;  4DRP A;  3WD1 A;  1A7X A;  1W1Y A;  4LGX A;  1E9L A;  1WNO A;  3FXY A;  1FFQ A;  5HWC A;  5GPG A;  1KFW A;  1N1A A;  1LL4 A;  1QZ2 A;  2DSW A;  3O5P A;  2AOS A;  1P5Q A;  3WL0 A;  4UDM A;  5DIU A;  3ARY A;  1HXV A;  2ZQT A;  1ZL1 A;  4U84 A;  1FKL A;  2Y78 A;  3MDY B;  1W26 A;  3JXV A;  3WKZ A;  3O5F A;  1E15 A;  3WH0 A;  4HBE A;  1ROT A;  3ARR A;  1EYM A;  4IT6 A;  2PBC A;  1JCH B;  4R5E A;  1FKH A;  4NSB A;  1W1V A;  3AS3 A;  4U86 A;  2ZQS A;  3B9A A;  1FKK A;  2DPE A;  1LL7 A;  4IQ2 A;  1Q1C A;  5I98 A;  3CH9 A;  2YBU A;  3ARP A;  3KAI A;  1D7J A;  1FKB A;  1EQ3 A;  1E6N A;  4FN2 A;  1SR0 A;  4QIB A;  3PRB A;  4GGQ A;  5DO2 A;  2XPB A;  4LAX A;  3WD0 A;  4DRI A;  2M2A A;  4C02 B;  2IF4 A;  3KAH A;  3B9D A;  1K9T A;  3BXW A;  3RGC A;  2XPA A;  2PPO A;  3IHZ A;  1E44 A;  4L3N A;  2KR7 A;  3JYJ A;  4P8X A;  4QT3 A;  2XP9 A;  1H0I A;  1LQ0 A;  1D7I A;  3IKG A;  5HW6 A;  1F8A B;  4ODK A;  1UR9 A;  4HBO A;  2LJ4 A;  2RSE A;  1JNS A;  2DSU A;  3UF8 A;  2DT1 A;  2RUR A;  3WIJ A;  4Q22 A;  3RME A;  3I6C A;  1ZU8 A;  3KZ7 A;  4IQC A;  4ODR A;  3OA5 A;  1J6Y A;  1KT0 A;  3PRA A;  4JFI A;  4DRK A;  1GUV A;  4DH0 A;  4J4O A;  3PR9 A;  3ARU A;  4XAK A;  4GIV A;  1Q6H A;  3WL1 A;  3O5M A;  2XP3 A;  1UR8 A;  2XP4 A;  2XP7 A;  4DWS B;  1FKI A;  3NRK A;  1HKJ A;  5DEZ A;  1D7H A;  5HWB A;  1ZK6 A;  3KAC A;  3UQA A;  2WLZ A;  2MNT A;  5HTG A;  3VAW A;  3B7X A;  1EDQ A;  3CHD A;  4FAP A;  3KCE A;  4DRH A;  3LUO A;  3CHC A;  4W9P A;  2PI6 A;  3ARX A;  1OGG A;  4Q7N A;  5GPR A;  4ODP A;  2RQS A;  2M1I A;  4ZPW R;  3IKD A;  1FKT A;  1O6I A;  1Q6I A;  1TFV A;  2F23 A;  1M5Y A;  1OGB A;  2OFN A;  2FKE A;  3CZ8 A;  1ITX A;  3ALG A;  4MAV A;  1X6N A;  2VCD A;  2K8I A;  2DT0 A;  1NH6 A;  1NSG A;  3CHF A;  2DG4 A;  4DIP A;  4WKA A;  4DRO A;  5HKG A;  1XHG A;  2A3C A;  3CHE A;  4P8W A;  4IPX A;  2MLY A;  4MTV A;  2ZR5 A;  4HAR A;  2DT3 A;  2KO7 A;  1FAP A;  2KI3 A;  1HJW A;  1JNE A;  2LGO A;  1D2K A;  1R9H A;  1NWR A;  2PPN A;  4WK9 A;  1HKK A;  1LG1 A;  1ZB5 A;  4ZS6 A;  2FAP A;  2YBT A;  3TDB A;  1J4I A;  3ARS A;  4JFJ A;  3O5G A;  2F2D A;  5HW8 A;  1FFR A;  1ZBV A;  4URI A;  3G6L A;  2LKN A;  1YW5 A;  1EHN A;  4MSP A;  4S3J A;  4WKH A;  2KFW A;  1X6L A;  4G50 A;  2M08 A;  4TW7 A;  3RM8 A;  4P8U A;  2MF9 A;  4NNR A;  1BKF A;  2KGJ A;  2O92 A;  4PTM A;  1GPF A;  2FDM A;  1ZBW A;  1LL6 A;  4ODM A;  3CGN A;  5JH8 A;  1B6C A;  2RUC A;  1WB0 A;  4ITZ A;  2D9F A;  4JFM A;  1F40 A;  3AS0 A;  3NI6 A;  1VF8 A;  1J4H A;  1E6R A;  3ARW A;  2F4E A;  1FKD A;  5BXJ A;  2KE0 A;  4WKF A;  2PV2 A;  1FKS A;  3O5Q A;  3PRD A;  2A3E A;  4Z2I A;  3KAF A;  4ZPT R;  3FAP A;  1LG2 A;  1HKI A;  2LPV A;  4Z2K A;  2DSZ A;  1LJY A;  2WK2 A;  4QZV B;  4TNS A;  1D6O A;  1H0G A;  4JFK A;  1PIN A;  1E6P A;  4Z2J A;  3PA7 A;  3OOB A;  4R0X A;  3B8S A;  1W9P A;  2Q5A A;  2B5U B;  3WQV A;  1JNT A;  4LAY A;  2JZV A;  3BMB A;  1ZBK A;  2F21 A;  1EIB A;  4MNL A;  4S3K A;  3ART A;  2IUZ A;  4W5U A;  5HBF A;  4DRM A;  4DT4 A;  3TCZ A;  2MPH A;  4DWS A;  4AY1 A;  2ZQU A;  1U79 A;  3GU0 A;  1FKF A;  3KAD A;  4IT4 A;  2B31 A;  2PV1 A;  1W9U A;  4TW6 A;  5DF0 A;  2DT2 A;  3GPK A;  4Z2L A;  2VN1 A;  4Z2G A;  3WD4 A;  1HJV A;  3O5D A;  5HUA A;  2MLX A;  2A3A A;  4WJX A;  4DZ2 A;  4DRQ A;  3KAG A;  2L2S A;  3W4R A;  1GRJ A;  4TYO A;  5HT1 A;  3AS1 A;  4O2T A;  3AQU A;  3TC5 A;  4G2P A;  1NWT A;  3UI5 A;  4ODO A;  3RM9 A;  4KR0 B;  4ODL A;  2XP6 A;  4LAW A;  4DWS D;  3CGM A;  5D75 A;  1XRV A;  2WLY A;  1ZBC A;  1FJD A;  1W1P A;  2MLZ A;  3KAB A;  3ARQ A;  3ARZ A;  3G6M A;  4MNJ A;  5DIV A;  1OWQ A;  3RFW A; 
#chains in the Genus database with same CATH homology
 3RM4 A;  3QOK A;  2PV3 A;  2XP5 A;  1FKR A;  4WIW A;  2QF8 A;  1PBK A;  4TX0 A;  3EY6 A;  1HKM A;  3ARO A;  5HW7 A;  1NMW A;  2N87 A;  5GQB A;  3WD3 A;  3UQB A;  3O5J A;  2DSV A;  4ZPV R;  1JVW A;  1QPF A;  1QPL A;  2G8Z A;  4DWS C;  1J4R A;  2AWG A;  4NZC A;  4MPK A;  4DRN A;  1Q6U A;  2OLH A;  1ROU A;  3O5R A;  3O5E A;  4J4N A;  1C9H A;  3ARV A;  3H9R B;  2WM0 A;  3AS2 A;  4QT2 A;  4MNK A;  3UI4 A;  1GOI A;  1FKJ A;  1L1P A;  1T11 A;  1TCO C;  1W9V A;  2RUD A;  3ODK A;  4MNM A;  1CTN A;  3JYM A;  4U85 A;  4Z2H A;  1FD9 A;  2G41 A;  1JND A;  1HJX A;  2DG3 A;  2O9O A;  2RUQ A;  2XP8 A;  2ZR4 A;  4DRJ A;  4ML4 A;  2ITK A;  3O5I A;  4ODQ A;  4W9Q A;  3WD2 A;  2PPP A;  5B8I C;  1FKG A;  1Y0O A;  4JYS A;  1NWS A;  4BF8 A;  2ESC A;  1YAT A;  4KQZ A;  2ZQV A;  4JFL A;  4L72 B;  2UZ5 A;  5DIT A;  1IX5 A;  4MGV A;  3O5O A;  1NWU A;  3IK8 A;  3O5L A;  2DG9 A;  2A3B A;  3NTP A;  3FY1 A;  4P8V A;  1E6Z A;  1KT1 A;  4N19 A;  3UQI A;  3O5K A;  4ODN A;  1ZCN A;  5J6E A;  1RD6 A;  4W9O A;  1SYT A;  1WAW A;  1W1T A;  4DZ3 A;  3B9E A;  3ALF A;  2ZR6 A;  4LAV A;  4TW8 A;  3WQW A;  1BL4 A;  3UI6 A;  1NMV A;  4DRP A;  3WD1 A;  1A7X A;  1W1Y A;  4LGX A;  1E9L A;  1WNO A;  3FXY A;  1FFQ A;  5HWC A;  5GPG A;  1KFW A;  1N1A A;  1LL4 A;  1QZ2 A;  2DSW A;  3O5P A;  2AOS A;  1P5Q A;  3WL0 A;  5DIU A;  3ARY A;  1HXV A;  2ZQT A;  1ZL1 A;  4U84 A;  1FKL A;  2Y78 A;  3MDY B;  1W26 A;  3JXV A;  3WKZ A;  3O5F A;  1E15 A;  3WH0 A;  4HBE A;  1ROT A;  3ARR A;  1EYM A;  4IT6 A;  2PBC A;  4R5E A;  1FKH A;  4NSB A;  1W1V A;  3AS3 A;  4U86 A;  2ZQS A;  3B9A A;  1FKK A;  2DPE A;  1LL7 A;  4IQ2 A;  1Q1C A;  5I98 A;  3CH9 A;  2YBU A;  3ARP A;  3KAI A;  1D7J A;  1FKB A;  1EQ3 A;  1E6N A;  4FN2 A;  1SR0 A;  4QIB A;  3PRB A;  4GGQ A;  5DO2 A;  2XPB A;  4LAX A;  3WD0 A;  4DRI A;  2M2A A;  4C02 B;  2IF4 A;  3KAH A;  3B9D A;  1K9T A;  3BXW A;  3RGC A;  2XPA A;  2PPO A;  3IHZ A;  4L3N A;  2KR7 A;  3JYJ A;  4P8X A;  4QT3 A;  2XP9 A;  1H0I A;  1LQ0 A;  1D7I A;  3IKG A;  5HW6 A;  1F8A B;  4ODK A;  1UR9 A;  4HBO A;  2LJ4 A;  2RSE A;  1JNS A;  2DSU A;  3UF8 A;  2DT1 A;  2RUR A;  3WIJ A;  4Q22 A;  3RME A;  3I6C A;  1ZU8 A;  3KZ7 A;  4IQC A;  4ODR A;  3OA5 A;  1J6Y A;  1KT0 A;  3PRA A;  4JFI A;  4DRK A;  1GUV A;  4DH0 A;  4J4O A;  3PR9 A;  3ARU A;  4XAK A;  4GIV A;  1Q6H A;  3WL1 A;  3O5M A;  2XP3 A;  1UR8 A;  2XP4 A;  2XP7 A;  4DWS B;  1FKI A;  3NRK A;  1HKJ A;  5DEZ A;  1D7H A;  5HWB A;  1ZK6 A;  3KAC A;  3UQA A;  2WLZ A;  2MNT A;  5HTG A;  3VAW A;  3B7X A;  1EDQ A;  3CHD A;  4FAP A;  3KCE A;  4DRH A;  3LUO A;  3CHC A;  4W9P A;  2PI6 A;  3ARX A;  1OGG A;  4Q7N A;  5GPR A;  4ODP A;  2RQS A;  2M1I A;  4ZPW R;  3IKD A;  1FKT A;  1O6I A;  1Q6I A;  1TFV A;  1M5Y A;  1OGB A;  2OFN A;  2FKE A;  3CZ8 A;  1ITX A;  3ALG A;  4MAV A;  1X6N A;  2VCD A;  2K8I A;  2DT0 A;  1NH6 A;  1NSG A;  3CHF A;  2DG4 A;  4DIP A;  4WKA A;  4DRO A;  5HKG A;  1XHG A;  2A3C A;  3CHE A;  4P8W A;  4IPX A;  2MLY A;  4MTV A;  2ZR5 A;  4HAR A;  2DT3 A;  2KO7 A;  1FAP A;  2KI3 A;  1HJW A;  1JNE A;  2LGO A;  1D2K A;  1R9H A;  1NWR A;  2PPN A;  4WK9 A;  1HKK A;  1LG1 A;  1ZB5 A;  4ZS6 A;  2FAP A;  2YBT A;  3TDB A;  1J4I A;  3ARS A;  4JFJ A;  3O5G A;  2F2D A;  5HW8 A;  1FFR A;  1ZBV A;  4URI A;  3G6L A;  2LKN A;  1YW5 A;  1EHN A;  4MSP A;  4S3J A;  4WKH A;  2KFW A;  1X6L A;  4G50 A;  2M08 A;  4TW7 A;  3RM8 A;  4P8U A;  2MF9 A;  4NNR A;  1BKF A;  2KGJ A;  2O92 A;  4PTM A;  1GPF A;  2FDM A;  1ZBW A;  1LL6 A;  4ODM A;  3CGN A;  5JH8 A;  1B6C A;  2RUC A;  1WB0 A;  4ITZ A;  2D9F A;  4JFM A;  1F40 A;  3AS0 A;  3NI6 A;  1VF8 A;  1J4H A;  1E6R A;  3ARW A;  2F4E A;  1FKD A;  5BXJ A;  2KE0 A;  4WKF A;  2PV2 A;  1FKS A;  3O5Q A;  3PRD A;  2A3E A;  4Z2I A;  3KAF A;  4ZPT R;  3FAP A;  1LG2 A;  1HKI A;  2LPV A;  4Z2K A;  2DSZ A;  1LJY A;  2WK2 A;  4QZV B;  4TNS A;  1D6O A;  1H0G A;  4JFK A;  1PIN A;  1E6P A;  4Z2J A;  3PA7 A;  3OOB A;  4R0X A;  3B8S A;  1W9P A;  2Q5A A;  3WQV A;  1JNT A;  4LAY A;  2JZV A;  1ZBK A;  2F21 A;  1EIB A;  4MNL A;  4S3K A;  3ART A;  2IUZ A;  4W5U A;  5HBF A;  4DRM A;  4DT4 A;  3TCZ A;  2MPH A;  4DWS A;  4AY1 A;  2ZQU A;  1U79 A;  1FKF A;  3KAD A;  4IT4 A;  2B31 A;  2PV1 A;  1W9U A;  4TW6 A;  5DF0 A;  2DT2 A;  3GPK A;  4Z2L A;  2VN1 A;  4Z2G A;  3WD4 A;  1HJV A;  3O5D A;  5HUA A;  2MLX A;  2A3A A;  4WJX A;  4DZ2 A;  4DRQ A;  3KAG A;  2L2S A;  3W4R A;  4TYO A;  5HT1 A;  3AS1 A;  4O2T A;  3AQU A;  3TC5 A;  4G2P A;  1NWT A;  3UI5 A;  4ODO A;  3RM9 A;  4KR0 B;  4ODL A;  2XP6 A;  4LAW A;  4DWS D;  3CGM A;  5D75 A;  1XRV A;  2WLY A;  1ZBC A;  1FJD A;  1W1P A;  2MLZ A;  3KAB A;  3ARQ A;  3ARZ A;  3G6M A;  4MNJ A;  5DIV A;  1OWQ A;  3RFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...