2DG9A

Fk506-binding protein mutant wl59 complexed with rapamycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGLEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Energetic and structural analysis of the role of tryptophan 59 in FKBP12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2dg9A00
2DG4A 2PPPA 2Q5AA 4IQ2A 2RUDA 2ZR4A 4DRHA 3UQBA 3I6CA 4GGQA 4C02B 3KCEA 5HWCA 5HUAA 2IF4A 3IK8A 3JXVA 2KE0A 1W26A 3B7XA 3NTPA 3O5JA 4W9QA 4ODOA 3UQIA 4QT3A 4R0XA 1QPFA 3KACA 1EYMA 1QPLA 1PBKA 2M08A 1FKIA 1FKTA 1JVWA 3IKGA 4N19A 2FAPA 3KAGA 1JNTA 4ODKA 2LKNA 5J6EA 1P5QA 1F40A 1B6CA 4JFKA 5HW7A 3RFWA 4JFIA 1A7XA 1QZ2A 3KAHA 4FAPA 2XP6A 2XPAA 2JZVA 3LUOA 1EQ3A 4TYOA 1J4RA 5HW8A 2RUQA 3GPKA 1C9HA 4LAWA 1KT1A 1FKKA 1J4IA 2RUCA 4U84A 1ZK6A 1R9HA 4FN2A 1FKGA 5HT1A 2UZ5A 2LGOA 2PV2A 5DIVA 2XP3A 1Q6HA 1NMVA 3OOBA 1PINA 3IKDA 4TX0A 4DRPA 1L1PA 4TW6A 3UI6A 2OFNA 1HXVA 4LAVA 4ODQA 3IHZA 2MF9A 3VAWA 2MLZA 1ZCNA 4ODRA 2AWGA 5HKGA 4MGVA 1NMWA 1T11A 2PPOA 2KFWA 4DRIA 4W9OA 5GPGA 4DRMA 1FKRA 1Y0OA 4DROA 2MPHA 1U79A 3UI5A 4DRJA 1D6OA 2XP8A 3O5IA 4U85A 3ODKA 2VCDA 5HTGA 2ZQUA 1Q6UA 2ZQTA 3O5LA 3UQAA 5DITA 4BF8A 1FKJA 3TCZA 3O5GA 1BKFA 3JYMA 2D9FA 1FJDA 1NSGA 2ZR5A 1FKDA 5DIUA 3WH0A 4DH0A 3O5FA 2KGJA 2PPNA 2XP4A 3O5DA 4DRNA 4J4NA 3TC5A 3UI4A 4TNSA 4DIPA 4DRQA 3KZ7A 4GIVA 1M5YA 3O5EA 4LAYA 4JFMA 2KR7A 4TW7A 1FKHA 3KAFA 3EY6A 3PRDA 1D7IA 1Q6IA 2XP5A 3CGMA 4DRKA 1JNSA 1KT0A 3NRKA 1N1AA 2PV1A 2DG3A 2K8IA 2XPBA 1FKSA 1D7JA 4JFJA 1FKFA 3TDBA 5HWBA 4G2PA 2LJ4A 1ROTA 5BXJA 3UF8A 3O5MA 2RQSA 3O5PA 4QIBA 4TW8A 3RGCA 2FKEA 3PRBA 4G50A 4DT4A 4DZ3A 4JYSA 2N87A 1YATA 1FKBA 4O2TA 4ODPA 3H9RB 3O5RA 1BL4A 3KABA 4DZ2A 2Y78A 1FAPA 3NI6A 4JFLA 2ITKA 1ROUA 4NNRA 2LPVA 1J6YA 2XP9A 2F2DA 2KO7A 2XP7A 2MLXA 2ZQSA 5HW6A 1Q1CA 5D75A 4ODNA 4IQCA 2VN1A 4W9PA 2DG9A 3O5KA 2M2AA 2RSEA 4MSPA 3JYJA 4ITZA 2ZR6A 4IPXA 2RURA 2F21A 2KI3A 2ZQVA 3CGNA 3O5OA 2PBCA 2MLYA 1TCOC 4LAXA 3FAPA 4U86A 5I98A 1FKLA 2PV3A 4ODMA 1F8AB 1YW5A 3PA7A 3MDYB 3KADA 2L2SA 3O5QA 2MNTA 1D7HA 1J4HA 5B8IC 4J4OA 4QT2A 2F4EA 1FD9A 3KAIA 4ODLA 2M1IA
chains in the Genus database with same CATH superfamily
1NWRA 1E6NA 4GGQA 4C02B 3KCEA 3B7XA 4ODOA 4R0XA 4HARA 1ZBWA 2WLYA 1FKIA 1FKTA 4N19A 3KAGA 1JNTA 5J6EA 1XRVA 5HW7A 1A7XA 3CHCA 2XP6A 1GRJA 4MNLA 2A3BA 1C9HA 1KT1A 4U84A 1ZK6A 4FN2A 5HT1A 1H0IA 4P8XA 4DWSD 4TX0A 1W1VA 1HXVA 4LAVA 4URIA 3VAWA 5HKGA 4WK9A 1LL4A 1T11A 2KFWA 3RM9A 4DRMA 1FKRA 1ZU8A 4DRJA 1D6OA 1EHNA 2B5UB 1NWTA 4U85A 3ODKA 4MNJA 5HTGA 3UQAA 4P8WA 1LL7A 1BKFA 3WH0A 4Z2IA 1RD6A 3O5DA 5GQBA 4J4NA 4DRQA 1M5YA 1X6NA 4LAYA 4ZPWR 3AQUA 3PRDA 3WL1A 1Q6IA 3CGMA 1JNSA 2ESCA 3WD1A 2O9OA 1WAWA 3ALGA 1D7JA 2WM0A 4G2PA 3OA5A 3PRBA 2OLHA 3O5RA 1BL4A 1FAPA 2ITKA 2LPVA 2F2DA 3WQWA 4IQCA 2VN1A 2DG9A 3O5KA 4ITZA 4KR0B 2KI3A 3CHEA 3W4RA 2PBCA 2MLYA 4LAXA 4U86A 1FFQA 1F8AB 4AY1A 3EIPA 3KADA 1W9PA 3ARVA 3G6LA 1E9LA 2A3CA 2F4EA 2EULA 1W1TA 2WLZA 4ML4A 4Z2GA 2RUDA 2ZR4A 3CHFA 4Z2LA 3I6CA 3UQBA 4NSBA 1W26A 4W9QA 4QT3A 1HJXA 4ZPVR 1EYMA 3ARSA 2DSZA 3IKGA 4HBOA 2LKNA 3QOKA 1B6CA 3RFWA 1O6IA 3KAHA 4FAPA 1NWUA 1ZB5A 2JZVA 1J4RA 1WB0A 4LAWA 3ARRA 1FKKA 4MAVA 1R9HA 1FKGA 1OGBA 4Q22A 2PV2A 3OOBA 3IKDA 3UI6A 3IHZA 1NH6A 2MLZA 2PN0A 5GPGA 1LG2A 1U79A 3PR9A 2B31A 1Q6UA 2ZQTA 1VF8A 1NWSA 5DO2A 3TCZA 3O5GA 3JYMA 2D9FA 3WQVA 1FJDA 1NSGA 4DH0A 3O5FA 2KGJA 2PPNA 5HBFA 4TNSA 4P8UA 3FXYA 2DPEA 3B8SA 3GTYX 1EDQA 4P8VA 1FKHA 5DF0A 2XP5A 1SYTA 1KT0A 3NRKA 3ARQA 1N1AA 1UR9A 2PV1A 2K8IA 3WIJA 3TDBA 3GU0A 4QIBA 3AS3A 3RGCA 4G50A 4DT4A 3CHDA 3WL0A 4L72B 4DWSA 4ODPA 1JNDA 1ROUA 1GPFA 2KO7A 1Q1CA 5D75A 1GUVA 2M2AA 2RURA 3CGNA 3O5OA 3FAPA 1FKLA 2PV3A 1YW5A 3MDYB 1TFVA 2DT1A 2MNTA 5B8IC 4MSPA 2M1IA 1FD9A 3KAIA 2PPPA 4IQ2A 5HWCA 5HUAA 3JXVA 3B9DA 1IX5A 3ALFA 1QPFA 2FDMA 3KACA 1FFRA 1ZBCA 1LJYA 3FY1A 2M08A 1JVWA 5GPRA 2FAPA 4L3NA 1F40A 4JFKA 1QZ2A 4W5UA 3ARUA 5HW8A 2RUQA 3GPKA 1ITXA 1J4IA 3BMBA 1E6PA 2F23A 2LGOA 3WKZA 1H0GA 4MNKA 1PINA 1L1PA 4DRPA 1X6LA 4TW6A 5DEZA 4ODQA 2AWGA 4MGVA 3ARXA 2PPOA 4DRIA 2A3EA 1JCHB 4DROA 3WD2A 1LQ0A 4R5EA 2XP8A 4S3JA 3O5IA 1ZL1A 2VCDA 2ZQUA 5DITA 3RM8A 4MPKA 3RMEA 2YBUA 1FKDA 4UDMA 3AROA 4DRNA 1KFWA 3TC5A 3UI4A 3CZ8A 4DIPA 3BXWA 4JFMA 3AS2A 4TW7A 3KAFA 4WIWA 3EY6A 4DRKA 2ETNA 2XPBA 1FKSA 1FKFA 5HWBA 4XAKA 2AOSA 1K9TA 2FKEA 3WD4A 1ZBKA 1YATA 2N87A 4HBEA 1FKBA 4O2TA 3H9RB 3KABA 3AS1A 2Y78A 3B9AA 1J6YA 4IT6A 4NNRA 2QF8A 1HJWA 1XHGA 2XP7A 2DT2A 4DWSC 3JYJA 2F21A 1OWQA 1TCOC 2DSWA 5I98A 4Q7NA 1E44A 3ARYA 4NZCA 3O5QA 1J4HA 4QT2A 3B9EA 1Y0OA 1E6ZA 2DG4A 2Q5AA 1WNOA 4DRHA 2IF4A 3IK8A 2KE0A 3UQIA 3NTPA 3O5JA 2PI6A 3ARZA 1QPLA 2DT3A 1SR0A 1PBKA 4Z2JA 4ODKA 1W1YA 4Z2HA 1P5QA 1LG1A 4JFIA 4ZS6A 2XPAA 2DSVA 2YBTA 3LUOA 4TYOA 1EQ3A 2O92A 1E15A 1HKMA 2RUCA 4ZPTR 1GOIA 4WKHA 2IUZA 4DWSB 2UZ5A 3ARPA 2DSUA 5DIVA 2XP3A 1Q6HA 1NMVA 1LL6A 2OFNA 2MF9A 1ZCNA 4ODRA 3RM4A 1D2KA 3WD3A 1EIBA 1NMWA 4W9OA 3PRAA 2MPHA 3UI5A 1HKIA 1UR8A 1OGGA 1HJVA 3O5LA 5JH8A 2G8ZA 4BF8A 1FKJA 4WJXA 4MTVA 4QZVB 2ZR5A 5DIUA 4IT4A 1W1PA 4LGXA 2XP4A 1CTNA 3ARWA 1HKKA 3KZ7A 4MNMA 4GIVA 3O5EA 2KR7A 2P4VA 4KQZA 2A3AA 1D7IA 2G41A 3ARTA 1JNEA 2DG3A 3AS0A 4JFJA 2DT0A 2LJ4A 1ROTA 4WKFA 3UF8A 5BXJA 3O5MA 2RQSA 3O5PA 1HKJA 4TW8A 1ZBVA 3CH9A 4DZ3A 4JYSA 3G6MA 2WK2A 4PTMA 4JFLA 3NI6A 4DZ2A 2XP9A 1E6RA 2ZQSA 2MLXA 5HW6A 4ODNA 4W9PA 2RSEA 2ZR6A 4IPXA 2ZQVA 4Z2KA 4ODMA 3PA7A 4WKAA 1W9UA 3WD0A 2L2SA 1D7HA 4S3KA 4J4OA 1W9VA 4ODLA
chains in the Genus database with same CATH topology
1NWRA 1E6NA 4GGQA 4C02B 3KCEA 3B7XA 4ODOA 4R0XA 4HARA 1ZBWA 2WLYA 1FKIA 1FKTA 4N19A 3KAGA 1JNTA 5J6EA 1XRVA 5HW7A 1A7XA 3CHCA 2XP6A 4MNLA 2A3BA 1C9HA 1KT1A 4U84A 1ZK6A 4FN2A 5HT1A 1H0IA 4P8XA 4DWSD 4TX0A 1W1VA 1HXVA 4LAVA 4URIA 3VAWA 5HKGA 4WK9A 1LL4A 1T11A 2KFWA 3RM9A 4DRMA 1FKRA 1ZU8A 4DRJA 1D6OA 1EHNA 1NWTA 4U85A 3ODKA 4MNJA 5HTGA 3UQAA 4P8WA 1LL7A 1BKFA 3WH0A 4Z2IA 1RD6A 3O5DA 5GQBA 4J4NA 4DRQA 1M5YA 1X6NA 4LAYA 4ZPWR 3AQUA 3PRDA 3WL1A 1Q6IA 3CGMA 1JNSA 2ESCA 3WD1A 2O9OA 1WAWA 3ALGA 1D7JA 2WM0A 4G2PA 3OA5A 3PRBA 2OLHA 3O5RA 1BL4A 1FAPA 2ITKA 2LPVA 2F2DA 3WQWA 4IQCA 2VN1A 2DG9A 3O5KA 4ITZA 4KR0B 2KI3A 3CHEA 3W4RA 2PBCA 2MLYA 4LAXA 4U86A 1FFQA 1F8AB 4AY1A 3KADA 1W9PA 3ARVA 3G6LA 1E9LA 2A3CA 2F4EA 1W1TA 2WLZA 4ML4A 4Z2GA 2RUDA 2ZR4A 3CHFA 4Z2LA 3I6CA 3UQBA 4NSBA 1W26A 4W9QA 4QT3A 1HJXA 4ZPVR 1EYMA 3ARSA 2DSZA 3IKGA 4HBOA 2LKNA 3QOKA 1B6CA 3RFWA 1O6IA 3KAHA 4FAPA 1NWUA 1ZB5A 2JZVA 1J4RA 1WB0A 4LAWA 3ARRA 1FKKA 4MAVA 1R9HA 1FKGA 1OGBA 4Q22A 2PV2A 3OOBA 3IKDA 3UI6A 3IHZA 1NH6A 2MLZA 5GPGA 1LG2A 1U79A 3PR9A 2B31A 1Q6UA 2ZQTA 1VF8A 1NWSA 5DO2A 3TCZA 3O5GA 3JYMA 2D9FA 3WQVA 1FJDA 1NSGA 4DH0A 3O5FA 2KGJA 2PPNA 5HBFA 4TNSA 4P8UA 3FXYA 2DPEA 3B8SA 1EDQA 4P8VA 1FKHA 5DF0A 2XP5A 1SYTA 1KT0A 3NRKA 3ARQA 1N1AA 1UR9A 2PV1A 2K8IA 3WIJA 3TDBA 4QIBA 3AS3A 3RGCA 4G50A 4DT4A 3CHDA 3WL0A 4L72B 4DWSA 4ODPA 1JNDA 1ROUA 1GPFA 2KO7A 1Q1CA 5D75A 1GUVA 2M2AA 2RURA 3CGNA 3O5OA 3FAPA 1FKLA 2PV3A 1YW5A 3MDYB 1TFVA 2DT1A 2MNTA 5B8IC 4MSPA 2M1IA 1FD9A 3KAIA 2PPPA 4IQ2A 5HWCA 5HUAA 3JXVA 3B9DA 1IX5A 3ALFA 1QPFA 2FDMA 3KACA 1FFRA 1ZBCA 1LJYA 3FY1A 2M08A 1JVWA 5GPRA 2FAPA 4L3NA 1F40A 4JFKA 1QZ2A 4W5UA 3ARUA 5HW8A 2RUQA 3GPKA 1ITXA 1J4IA 1E6PA 2LGOA 3WKZA 1H0GA 4MNKA 1PINA 1L1PA 4DRPA 1X6LA 4TW6A 5DEZA 4ODQA 2AWGA 4MGVA 3ARXA 2PPOA 4DRIA 2A3EA 4DROA 3WD2A 1LQ0A 4R5EA 2XP8A 4S3JA 3O5IA 1ZL1A 2VCDA 2ZQUA 5DITA 3RM8A 4MPKA 3RMEA 2YBUA 1FKDA 3AROA 4DRNA 1KFWA 3TC5A 3UI4A 3CZ8A 4DIPA 3BXWA 4JFMA 3AS2A 4TW7A 3KAFA 4WIWA 3EY6A 4DRKA 2XPBA 1FKSA 1FKFA 5HWBA 4XAKA 2AOSA 1K9TA 2FKEA 3WD4A 1ZBKA 1YATA 2N87A 4HBEA 1FKBA 4O2TA 3H9RB 3KABA 3AS1A 2Y78A 3B9AA 1J6YA 4IT6A 4NNRA 2QF8A 1HJWA 1XHGA 2XP7A 2DT2A 4DWSC 3JYJA 2F21A 1OWQA 1TCOC 2DSWA 5I98A 4Q7NA 3ARYA 4NZCA 3O5QA 1J4HA 4QT2A 3B9EA 1Y0OA 1E6ZA 2DG4A 2Q5AA 1WNOA 4DRHA 2IF4A 3IK8A 2KE0A 3UQIA 3NTPA 3O5JA 2PI6A 3ARZA 1QPLA 2DT3A 1SR0A 1PBKA 4Z2JA 4ODKA 1W1YA 4Z2HA 1P5QA 1LG1A 4JFIA 4ZS6A 2XPAA 2DSVA 2YBTA 3LUOA 4TYOA 1EQ3A 2O92A 1E15A 1HKMA 2RUCA 4ZPTR 1GOIA 4WKHA 2IUZA 4DWSB 2UZ5A 3ARPA 2DSUA 5DIVA 2XP3A 1Q6HA 1NMVA 1LL6A 2OFNA 2MF9A 1ZCNA 4ODRA 3RM4A 1D2KA 3WD3A 1EIBA 1NMWA 4W9OA 3PRAA 2MPHA 3UI5A 1HKIA 1UR8A 1OGGA 1HJVA 3O5LA 5JH8A 2G8ZA 4BF8A 1FKJA 4WJXA 4MTVA 4QZVB 2ZR5A 5DIUA 4IT4A 1W1PA 4LGXA 2XP4A 1CTNA 3ARWA 1HKKA 3KZ7A 4MNMA 4GIVA 3O5EA 2KR7A 4KQZA 2A3AA 1D7IA 2G41A 3ARTA 1JNEA 2DG3A 3AS0A 4JFJA 2DT0A 2LJ4A 1ROTA 4WKFA 3UF8A 5BXJA 3O5MA 2RQSA 3O5PA 1HKJA 4TW8A 1ZBVA 3CH9A 4DZ3A 4JYSA 3G6MA 2WK2A 4PTMA 4JFLA 3NI6A 4DZ2A 2XP9A 1E6RA 2ZQSA 2MLXA 5HW6A 4ODNA 4W9PA 2RSEA 2ZR6A 4IPXA 2ZQVA 4Z2KA 4ODMA 3PA7A 4WKAA 1W9UA 3WD0A 2L2SA 1D7HA 4S3KA 4J4OA 1W9VA 4ODLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG4 A;  2PPP A;  2Q5A A;  4IQ2 A;  2RUD A;  2ZR4 A;  4DRH A;  3UQB A;  3I6C A;  4GGQ A;  4C02 B;  3KCE A;  5HWC A;  5HUA A;  2IF4 A;  3IK8 A;  3JXV A;  2KE0 A;  1W26 A;  3B7X A;  3NTP A;  3O5J A;  4W9Q A;  4ODO A;  3UQI A;  4QT3 A;  4R0X A;  1QPF A;  3KAC A;  1EYM A;  1QPL A;  1PBK A;  2M08 A;  1FKI A;  1FKT A;  1JVW A;  3IKG A;  4N19 A;  2FAP A;  3KAG A;  1JNT A;  4ODK A;  2LKN A;  5J6E A;  1P5Q A;  1F40 A;  1B6C A;  4JFK A;  5HW7 A;  3RFW A;  4JFI A;  1A7X A;  1QZ2 A;  3KAH A;  4FAP A;  2XP6 A;  2XPA A;  2JZV A;  3LUO A;  1EQ3 A;  4TYO A;  1J4R A;  5HW8 A;  2RUQ A;  3GPK A;  1C9H A;  4LAW A;  1KT1 A;  1FKK A;  1J4I A;  2RUC A;  4U84 A;  1ZK6 A;  1R9H A;  4FN2 A;  1FKG A;  5HT1 A;  2UZ5 A;  2LGO A;  2PV2 A;  5DIV A;  2XP3 A;  1Q6H A;  1NMV A;  3OOB A;  1PIN A;  3IKD A;  4TX0 A;  4DRP A;  1L1P A;  4TW6 A;  3UI6 A;  2OFN A;  1HXV A;  4LAV A;  4ODQ A;  3IHZ A;  2MF9 A;  3VAW A;  2MLZ A;  1ZCN A;  4ODR A;  2AWG A;  5HKG A;  4MGV A;  1NMW A;  1T11 A;  2PPO A;  2KFW A;  4DRI A;  4W9O A;  5GPG A;  4DRM A;  1FKR A;  1Y0O A;  4DRO A;  2MPH A;  1U79 A;  3UI5 A;  4DRJ A;  1D6O A;  2XP8 A;  3O5I A;  4U85 A;  3ODK A;  2VCD A;  5HTG A;  2ZQU A;  1Q6U A;  2ZQT A;  3O5L A;  3UQA A;  5DIT A;  4BF8 A;  1FKJ A;  3TCZ A;  3O5G A;  1BKF A;  3JYM A;  2D9F A;  1FJD A;  1NSG A;  2ZR5 A;  1FKD A;  5DIU A;  3WH0 A;  4DH0 A;  3O5F A;  2KGJ A;  2PPN A;  2XP4 A;  3O5D A;  4DRN A;  4J4N A;  3TC5 A;  3UI4 A;  4TNS A;  4DIP A;  4DRQ A;  3KZ7 A;  4GIV A;  1M5Y A;  3O5E A;  4LAY A;  4JFM A;  2KR7 A;  4TW7 A;  1FKH A;  3KAF A;  3EY6 A;  3PRD A;  1D7I A;  1Q6I A;  2XP5 A;  3CGM A;  4DRK A;  1JNS A;  1KT0 A;  3NRK A;  1N1A A;  2PV1 A;  2DG3 A;  2K8I A;  2XPB A;  1FKS A;  1D7J A;  4JFJ A;  1FKF A;  3TDB A;  5HWB A;  4G2P A;  2LJ4 A;  1ROT A;  5BXJ A;  3UF8 A;  3O5M A;  2RQS A;  3O5P A;  4QIB A;  4TW8 A;  3RGC A;  2FKE A;  3PRB A;  4G50 A;  4DT4 A;  4DZ3 A;  4JYS A;  2N87 A;  1YAT A;  1FKB A;  4O2T A;  4ODP A;  3H9R B;  3O5R A;  1BL4 A;  3KAB A;  4DZ2 A;  2Y78 A;  1FAP A;  3NI6 A;  4JFL A;  2ITK A;  1ROU A;  4NNR A;  2LPV A;  1J6Y A;  2XP9 A;  2F2D A;  2KO7 A;  2XP7 A;  2MLX A;  2ZQS A;  5HW6 A;  1Q1C A;  5D75 A;  4ODN A;  4IQC A;  2VN1 A;  4W9P A;  2DG9 A;  3O5K A;  2M2A A;  2RSE A;  4MSP A;  3JYJ A;  4ITZ A;  2ZR6 A;  4IPX A;  2RUR A;  2F21 A;  2KI3 A;  2ZQV A;  3CGN A;  3O5O A;  2PBC A;  2MLY A;  1TCO C;  4LAX A;  3FAP A;  4U86 A;  5I98 A;  1FKL A;  2PV3 A;  4ODM A;  1F8A B;  1YW5 A;  3PA7 A;  3MDY B;  3KAD A;  2L2S A;  3O5Q A;  2MNT A;  1D7H A;  1J4H A;  5B8I C;  4J4O A;  4QT2 A;  2F4E A;  1FD9 A;  3KAI A;  4ODL A;  2M1I A; 
#chains in the Genus database with same CATH topology
 1NWR A;  1E6N A;  4GGQ A;  4C02 B;  3KCE A;  3B7X A;  4ODO A;  4R0X A;  4HAR A;  1ZBW A;  2WLY A;  1FKI A;  1FKT A;  4N19 A;  3KAG A;  1JNT A;  5J6E A;  1XRV A;  5HW7 A;  1A7X A;  3CHC A;  2XP6 A;  1GRJ A;  4MNL A;  2A3B A;  1C9H A;  1KT1 A;  4U84 A;  1ZK6 A;  4FN2 A;  5HT1 A;  1H0I A;  4P8X A;  4DWS D;  4TX0 A;  1W1V A;  1HXV A;  4LAV A;  4URI A;  3VAW A;  5HKG A;  4WK9 A;  1LL4 A;  1T11 A;  2KFW A;  3RM9 A;  4DRM A;  1FKR A;  1ZU8 A;  4DRJ A;  1D6O A;  1EHN A;  2B5U B;  1NWT A;  4U85 A;  3ODK A;  4MNJ A;  5HTG A;  3UQA A;  4P8W A;  1LL7 A;  1BKF A;  3WH0 A;  4Z2I A;  1RD6 A;  3O5D A;  5GQB A;  4J4N A;  4DRQ A;  1M5Y A;  1X6N A;  4LAY A;  4ZPW R;  3AQU A;  3PRD A;  3WL1 A;  1Q6I A;  3CGM A;  1JNS A;  2ESC A;  3WD1 A;  2O9O A;  1WAW A;  3ALG A;  1D7J A;  2WM0 A;  4G2P A;  3OA5 A;  3PRB A;  2OLH A;  3O5R A;  1BL4 A;  1FAP A;  2ITK A;  2LPV A;  2F2D A;  3WQW A;  4IQC A;  2VN1 A;  2DG9 A;  3O5K A;  4ITZ A;  4KR0 B;  2KI3 A;  3CHE A;  3W4R A;  2PBC A;  2MLY A;  4LAX A;  4U86 A;  1FFQ A;  1F8A B;  4AY1 A;  3EIP A;  3KAD A;  1W9P A;  3ARV A;  3G6L A;  1E9L A;  2A3C A;  2F4E A;  2EUL A;  1W1T A;  2WLZ A;  4ML4 A;  4Z2G A;  2RUD A;  2ZR4 A;  3CHF A;  4Z2L A;  3I6C A;  3UQB A;  4NSB A;  1W26 A;  4W9Q A;  4QT3 A;  1HJX A;  4ZPV R;  1EYM A;  3ARS A;  2DSZ A;  3IKG A;  4HBO A;  2LKN A;  3QOK A;  1B6C A;  3RFW A;  1O6I A;  3KAH A;  4FAP A;  1NWU A;  1ZB5 A;  2JZV A;  1J4R A;  1WB0 A;  4LAW A;  3ARR A;  1FKK A;  4MAV A;  1R9H A;  1FKG A;  1OGB A;  4Q22 A;  2PV2 A;  3OOB A;  3IKD A;  3UI6 A;  3IHZ A;  1NH6 A;  2MLZ A;  2PN0 A;  5GPG A;  1LG2 A;  1U79 A;  3PR9 A;  2B31 A;  1Q6U A;  2ZQT A;  1VF8 A;  1NWS A;  5DO2 A;  3TCZ A;  3O5G A;  3JYM A;  2D9F A;  3WQV A;  1FJD A;  1NSG A;  4DH0 A;  3O5F A;  2KGJ A;  2PPN A;  5HBF A;  4TNS A;  4P8U A;  3FXY A;  2DPE A;  3B8S A;  3GTY X;  1EDQ A;  4P8V A;  1FKH A;  5DF0 A;  2XP5 A;  1SYT A;  1KT0 A;  3NRK A;  3ARQ A;  1N1A A;  1UR9 A;  2PV1 A;  2K8I A;  3WIJ A;  3TDB A;  3GU0 A;  4QIB A;  3AS3 A;  3RGC A;  4G50 A;  4DT4 A;  3CHD A;  3WL0 A;  4L72 B;  4DWS A;  4ODP A;  1JND A;  1ROU A;  1GPF A;  2KO7 A;  1Q1C A;  5D75 A;  1GUV A;  2M2A A;  2RUR A;  3CGN A;  3O5O A;  3FAP A;  1FKL A;  2PV3 A;  1YW5 A;  3MDY B;  1TFV A;  2DT1 A;  2MNT A;  5B8I C;  4MSP A;  2M1I A;  1FD9 A;  3KAI A;  2PPP A;  4IQ2 A;  5HWC A;  5HUA A;  3JXV A;  3B9D A;  1IX5 A;  3ALF A;  1QPF A;  2FDM A;  3KAC A;  1FFR A;  1ZBC A;  1LJY A;  3FY1 A;  2M08 A;  1JVW A;  5GPR A;  2FAP A;  4L3N A;  1F40 A;  4JFK A;  1QZ2 A;  4W5U A;  3ARU A;  5HW8 A;  2RUQ A;  3GPK A;  1ITX A;  1J4I A;  3BMB A;  1E6P A;  2F23 A;  2LGO A;  3WKZ A;  1H0G A;  4MNK A;  1PIN A;  1L1P A;  4DRP A;  1X6L A;  4TW6 A;  5DEZ A;  4ODQ A;  2AWG A;  4MGV A;  3ARX A;  2PPO A;  4DRI A;  2A3E A;  1JCH B;  4DRO A;  3WD2 A;  1LQ0 A;  4R5E A;  2XP8 A;  4S3J A;  3O5I A;  1ZL1 A;  2VCD A;  2ZQU A;  5DIT A;  3RM8 A;  4MPK A;  3RME A;  2YBU A;  1FKD A;  4UDM A;  3ARO A;  4DRN A;  1KFW A;  3TC5 A;  3UI4 A;  3CZ8 A;  4DIP A;  3BXW A;  4JFM A;  3AS2 A;  4TW7 A;  3KAF A;  4WIW A;  3EY6 A;  4DRK A;  2ETN A;  2XPB A;  1FKS A;  1FKF A;  5HWB A;  4XAK A;  2AOS A;  1K9T A;  2FKE A;  3WD4 A;  1ZBK A;  1YAT A;  2N87 A;  4HBE A;  1FKB A;  4O2T A;  3H9R B;  3KAB A;  3AS1 A;  2Y78 A;  3B9A A;  1J6Y A;  4IT6 A;  4NNR A;  2QF8 A;  1HJW A;  1XHG A;  2XP7 A;  2DT2 A;  4DWS C;  3JYJ A;  2F21 A;  1OWQ A;  1TCO C;  2DSW A;  5I98 A;  4Q7N A;  1E44 A;  3ARY A;  4NZC A;  3O5Q A;  1J4H A;  4QT2 A;  3B9E A;  1Y0O A;  1E6Z A;  2DG4 A;  2Q5A A;  1WNO A;  4DRH A;  2IF4 A;  3IK8 A;  2KE0 A;  3UQI A;  3NTP A;  3O5J A;  2PI6 A;  3ARZ A;  1QPL A;  2DT3 A;  1SR0 A;  1PBK A;  4Z2J A;  4ODK A;  1W1Y A;  4Z2H A;  1P5Q A;  1LG1 A;  4JFI A;  4ZS6 A;  2XPA A;  2DSV A;  2YBT A;  3LUO A;  4TYO A;  1EQ3 A;  2O92 A;  1E15 A;  1HKM A;  2RUC A;  4ZPT R;  1GOI A;  4WKH A;  2IUZ A;  4DWS B;  2UZ5 A;  3ARP A;  2DSU A;  5DIV A;  2XP3 A;  1Q6H A;  1NMV A;  1LL6 A;  2OFN A;  2MF9 A;  1ZCN A;  4ODR A;  3RM4 A;  1D2K A;  3WD3 A;  1EIB A;  1NMW A;  4W9O A;  3PRA A;  2MPH A;  3UI5 A;  1HKI A;  1UR8 A;  1OGG A;  1HJV A;  3O5L A;  5JH8 A;  2G8Z A;  4BF8 A;  1FKJ A;  4WJX A;  4MTV A;  4QZV B;  2ZR5 A;  5DIU A;  4IT4 A;  1W1P A;  4LGX A;  2XP4 A;  1CTN A;  3ARW A;  1HKK A;  3KZ7 A;  4MNM A;  4GIV A;  3O5E A;  2KR7 A;  2P4V A;  4KQZ A;  2A3A A;  1D7I A;  2G41 A;  3ART A;  1JNE A;  2DG3 A;  3AS0 A;  4JFJ A;  2DT0 A;  2LJ4 A;  1ROT A;  4WKF A;  3UF8 A;  5BXJ A;  3O5M A;  2RQS A;  3O5P A;  1HKJ A;  4TW8 A;  1ZBV A;  3CH9 A;  4DZ3 A;  4JYS A;  3G6M A;  2WK2 A;  4PTM A;  4JFL A;  3NI6 A;  4DZ2 A;  2XP9 A;  1E6R A;  2ZQS A;  2MLX A;  5HW6 A;  4ODN A;  4W9P A;  2RSE A;  2ZR6 A;  4IPX A;  2ZQV A;  4Z2K A;  4ODM A;  3PA7 A;  4WKA A;  1W9U A;  3WD0 A;  2L2S A;  1D7H A;  4S3K A;  4J4O A;  1W9V A;  4ODL A; 
#chains in the Genus database with same CATH homology
 1NWR A;  1E6N A;  4GGQ A;  4C02 B;  3KCE A;  3B7X A;  4ODO A;  4R0X A;  4HAR A;  1ZBW A;  2WLY A;  1FKI A;  1FKT A;  4N19 A;  3KAG A;  1JNT A;  5J6E A;  1XRV A;  5HW7 A;  1A7X A;  3CHC A;  2XP6 A;  4MNL A;  2A3B A;  1C9H A;  1KT1 A;  4U84 A;  1ZK6 A;  4FN2 A;  5HT1 A;  1H0I A;  4P8X A;  4DWS D;  4TX0 A;  1W1V A;  1HXV A;  4LAV A;  4URI A;  3VAW A;  5HKG A;  4WK9 A;  1LL4 A;  1T11 A;  2KFW A;  3RM9 A;  4DRM A;  1FKR A;  1ZU8 A;  4DRJ A;  1D6O A;  1EHN A;  1NWT A;  4U85 A;  3ODK A;  4MNJ A;  5HTG A;  3UQA A;  4P8W A;  1LL7 A;  1BKF A;  3WH0 A;  4Z2I A;  1RD6 A;  3O5D A;  5GQB A;  4J4N A;  4DRQ A;  1M5Y A;  1X6N A;  4LAY A;  4ZPW R;  3AQU A;  3PRD A;  3WL1 A;  1Q6I A;  3CGM A;  1JNS A;  2ESC A;  3WD1 A;  2O9O A;  1WAW A;  3ALG A;  1D7J A;  2WM0 A;  4G2P A;  3OA5 A;  3PRB A;  2OLH A;  3O5R A;  1BL4 A;  1FAP A;  2ITK A;  2LPV A;  2F2D A;  3WQW A;  4IQC A;  2VN1 A;  2DG9 A;  3O5K A;  4ITZ A;  4KR0 B;  2KI3 A;  3CHE A;  3W4R A;  2PBC A;  2MLY A;  4LAX A;  4U86 A;  1FFQ A;  1F8A B;  4AY1 A;  3KAD A;  1W9P A;  3ARV A;  3G6L A;  1E9L A;  2A3C A;  2F4E A;  1W1T A;  2WLZ A;  4ML4 A;  4Z2G A;  2RUD A;  2ZR4 A;  3CHF A;  4Z2L A;  3I6C A;  3UQB A;  4NSB A;  1W26 A;  4W9Q A;  4QT3 A;  1HJX A;  4ZPV R;  1EYM A;  3ARS A;  2DSZ A;  3IKG A;  4HBO A;  2LKN A;  3QOK A;  1B6C A;  3RFW A;  1O6I A;  3KAH A;  4FAP A;  1NWU A;  1ZB5 A;  2JZV A;  1J4R A;  1WB0 A;  4LAW A;  3ARR A;  1FKK A;  4MAV A;  1R9H A;  1FKG A;  1OGB A;  4Q22 A;  2PV2 A;  3OOB A;  3IKD A;  3UI6 A;  3IHZ A;  1NH6 A;  2MLZ A;  5GPG A;  1LG2 A;  1U79 A;  3PR9 A;  2B31 A;  1Q6U A;  2ZQT A;  1VF8 A;  1NWS A;  5DO2 A;  3TCZ A;  3O5G A;  3JYM A;  2D9F A;  3WQV A;  1FJD A;  1NSG A;  4DH0 A;  3O5F A;  2KGJ A;  2PPN A;  5HBF A;  4TNS A;  4P8U A;  3FXY A;  2DPE A;  3B8S A;  1EDQ A;  4P8V A;  1FKH A;  5DF0 A;  2XP5 A;  1SYT A;  1KT0 A;  3NRK A;  3ARQ A;  1N1A A;  1UR9 A;  2PV1 A;  2K8I A;  3WIJ A;  3TDB A;  4QIB A;  3AS3 A;  3RGC A;  4G50 A;  4DT4 A;  3CHD A;  3WL0 A;  4L72 B;  4DWS A;  4ODP A;  1JND A;  1ROU A;  1GPF A;  2KO7 A;  1Q1C A;  5D75 A;  1GUV A;  2M2A A;  2RUR A;  3CGN A;  3O5O A;  3FAP A;  1FKL A;  2PV3 A;  1YW5 A;  3MDY B;  1TFV A;  2DT1 A;  2MNT A;  5B8I C;  4MSP A;  2M1I A;  1FD9 A;  3KAI A;  2PPP A;  4IQ2 A;  5HWC A;  5HUA A;  3JXV A;  3B9D A;  1IX5 A;  3ALF A;  1QPF A;  2FDM A;  3KAC A;  1FFR A;  1ZBC A;  1LJY A;  3FY1 A;  2M08 A;  1JVW A;  5GPR A;  2FAP A;  4L3N A;  1F40 A;  4JFK A;  1QZ2 A;  4W5U A;  3ARU A;  5HW8 A;  2RUQ A;  3GPK A;  1ITX A;  1J4I A;  1E6P A;  2LGO A;  3WKZ A;  1H0G A;  4MNK A;  1PIN A;  1L1P A;  4DRP A;  1X6L A;  4TW6 A;  5DEZ A;  4ODQ A;  2AWG A;  4MGV A;  3ARX A;  2PPO A;  4DRI A;  2A3E A;  4DRO A;  3WD2 A;  1LQ0 A;  4R5E A;  2XP8 A;  4S3J A;  3O5I A;  1ZL1 A;  2VCD A;  2ZQU A;  5DIT A;  3RM8 A;  4MPK A;  3RME A;  2YBU A;  1FKD A;  3ARO A;  4DRN A;  1KFW A;  3TC5 A;  3UI4 A;  3CZ8 A;  4DIP A;  3BXW A;  4JFM A;  3AS2 A;  4TW7 A;  3KAF A;  4WIW A;  3EY6 A;  4DRK A;  2XPB A;  1FKS A;  1FKF A;  5HWB A;  4XAK A;  2AOS A;  1K9T A;  2FKE A;  3WD4 A;  1ZBK A;  1YAT A;  2N87 A;  4HBE A;  1FKB A;  4O2T A;  3H9R B;  3KAB A;  3AS1 A;  2Y78 A;  3B9A A;  1J6Y A;  4IT6 A;  4NNR A;  2QF8 A;  1HJW A;  1XHG A;  2XP7 A;  2DT2 A;  4DWS C;  3JYJ A;  2F21 A;  1OWQ A;  1TCO C;  2DSW A;  5I98 A;  4Q7N A;  3ARY A;  4NZC A;  3O5Q A;  1J4H A;  4QT2 A;  3B9E A;  1Y0O A;  1E6Z A;  2DG4 A;  2Q5A A;  1WNO A;  4DRH A;  2IF4 A;  3IK8 A;  2KE0 A;  3UQI A;  3NTP A;  3O5J A;  2PI6 A;  3ARZ A;  1QPL A;  2DT3 A;  1SR0 A;  1PBK A;  4Z2J A;  4ODK A;  1W1Y A;  4Z2H A;  1P5Q A;  1LG1 A;  4JFI A;  4ZS6 A;  2XPA A;  2DSV A;  2YBT A;  3LUO A;  4TYO A;  1EQ3 A;  2O92 A;  1E15 A;  1HKM A;  2RUC A;  4ZPT R;  1GOI A;  4WKH A;  2IUZ A;  4DWS B;  2UZ5 A;  3ARP A;  2DSU A;  5DIV A;  2XP3 A;  1Q6H A;  1NMV A;  1LL6 A;  2OFN A;  2MF9 A;  1ZCN A;  4ODR A;  3RM4 A;  1D2K A;  3WD3 A;  1EIB A;  1NMW A;  4W9O A;  3PRA A;  2MPH A;  3UI5 A;  1HKI A;  1UR8 A;  1OGG A;  1HJV A;  3O5L A;  5JH8 A;  2G8Z A;  4BF8 A;  1FKJ A;  4WJX A;  4MTV A;  4QZV B;  2ZR5 A;  5DIU A;  4IT4 A;  1W1P A;  4LGX A;  2XP4 A;  1CTN A;  3ARW A;  1HKK A;  3KZ7 A;  4MNM A;  4GIV A;  3O5E A;  2KR7 A;  4KQZ A;  2A3A A;  1D7I A;  2G41 A;  3ART A;  1JNE A;  2DG3 A;  3AS0 A;  4JFJ A;  2DT0 A;  2LJ4 A;  1ROT A;  4WKF A;  3UF8 A;  5BXJ A;  3O5M A;  2RQS A;  3O5P A;  1HKJ A;  4TW8 A;  1ZBV A;  3CH9 A;  4DZ3 A;  4JYS A;  3G6M A;  2WK2 A;  4PTM A;  4JFL A;  3NI6 A;  4DZ2 A;  2XP9 A;  1E6R A;  2ZQS A;  2MLX A;  5HW6 A;  4ODN A;  4W9P A;  2RSE A;  2ZR6 A;  4IPX A;  2ZQV A;  4Z2K A;  4ODM A;  3PA7 A;  4WKA A;  1W9U A;  3WD0 A;  2L2S A;  1D7H A;  4S3K A;  4J4O A;  1W9V A;  4ODL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...