2DGKA

Crystal structure of an n-terminal deletion mutant of escherichia coli gadb in an autoinhibited state (aldamine)
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
438
structure length
438
Chain Sequence
b'SKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate decarboxylase beta
publication title Escherichia coli acid resistance: pH-sensing, activation by chloride and autoinhibition in GadB
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 154
structure length 438
sequence length 438
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.15: Glutamate decarboxylase.
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2dgkA01
3.90.1150.160 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2dgkA02
4TV7A 1RVUA 4I8AA 1SPAA 5BJ3A 1IX6A 2D5YA 2Z67A 1O69A 5G2QA 1TATA 3RCHB 3GBXA 2E7JA 4UQVA 1AHXA 3GZCA 4GEBA 4A72A 4B98A 4ADDA 2ZP7A 2E7UA 3BN1A 2GSAA 3LG0A 3DU4A 1M0OA 4ATQA 3GJUA 4A6RA 2VMVA 3BWOA 5EUNA 2GQNA 7AATA 2VGWA 1AIBA 3ASBA 2BWOA 1AMQA 3NYUA 5EUEA 1B9HA 1CQ8A 2AEVA 2YHKA 3G0TA 3KE3A 4WLJA 4ZM4A 5M4DA 3A8UX 3ZRRA 4WYCA 3MC6A 2W7LA 1YIYA 3ASAA 4MQPA 3B1CA 1ASEA 2GB3A 3A9XA 1GC2A 3NNKA 8AATA 2QB3A 1Z7DA 2YKXA 2EZ2A 1S08A 2AY9A 2DR1A 3EUCA 3E2ZA 4JEVA 4AZJA 2E7IA 1BQDA 1ZODA 2FYFA 1ASLA 5FT5A 1EQBA 1AJRA 4Q76A 1M0PA 2VGUA 1P3WA 3KGXA 3NYTA 3VK2A 2YCPA 4H51A 2CY8A 4L0OA 4XQ2A 3G7QA 3NU8A 3PAAA 4ZSYA 4ZWMA 3P6KA 1OATA 3MC6C 4Y0DA 1W3UA 1I41A 3AEPA 1ASDA 3NYSA 4GE4A 3WY7A 4OT8A 1BKGA 1ARTA 1AHFA 2WKAA 2O1BA 4MKKA 1LC7A 2PB2A 2XH1A 1TASA 3DYDA 3JU7A 4A0FA 1KL2A 1ZOBA 1AIAA 1LS3A 3TQXA 5M46A 4O6ZA 1IX7A 2YKUA 1WYUA 3FKDA 2QA3A 1CQ7A 1GEWA 3PIUA 4W8IA 5EQCA 2CJGA 1YJZA 1Z3ZA 2VGSA 3AELA 4GE9A 3FTBA 2FM1A 4EMYA 2G6WA 3FSLA 3CQ4A 3ELEA 1G7WA 3VP6A 3I4JA 3EI7A 2ZUKA 5HXXA 4ZASA 3ACZA 1D7VA 2Z1YA 3MAFA 1N31A 1ASCA 3JW9A 1PFFA 3PA9A 4GRXA 3W1HA 4IY7A 1IBJA 3DXWA 4PFFA 2VIBA 1GC4A 3AEMA 2DGMA 2VMWA 4CVQA 3AENA 3QI6A 3PGYA 3A9YA 3WLXA 3TFTA 3BCAA 1B4XA 4JEZA 3CAIA 1E5FA 1J32A 1MAQA 3AEOA 1D2FA 3QHXA 1JS3A 1YNUA 2BKWA 4RIZA 1FG7A 3HBXA 4LNLA 4AH3A 3NRAA 4LC3A 1ELQA 4JE5D 3F9TA 4M2KA 4PIWA 2D61A 5G09A 1GD9A 3AEMC 4KYOA 4AZKA 2YRRA 4W5KA 5DB5A 2CANA 2O7CA 4Q31A 2GMUA 4F5JA 2HUIA 3LY1A 1W7NA 4E3QA 1BT4A 1SFFA 1AKAA 4N0BA 3ZRPA 2Z9VA 3LVMA 4MGRA 3H7FA 1AAWA 3AEJA 1CZEA 3N0LA 2D63A 1OXOA 1X29A 1LC8A 4ZM3A 1WYTB 3EIBA 4EB5A 1X0MA 1Y4IA 2BIAA 3PD6B 3R9AA 4CXRA 2VLHA 1JS6A 1CZCA 1AMRA 5TF5A 3GETA 4W1WA 2VMOA 2CH1A 4BHDA 2BI3A 2O0RA 4J8LA 2VYCA 2VIAA 5EIGA 9AATA 1WKGA 2CB1A 1IUGA 1TPLA 1D7RA 3ELPA 1DGEA 2BI1A 1YAAA 1FG3A 3QM2A 3NDNA 1VEFA 1SZSA 1BJ4A 1B8GA 3GWPA 1M6SA 3AV7A 3K40A 1AHEA 4F5FA 4LNJA 1X2AA 2QB2A 3BV0A 4RAEA 4ISYA 2BI2A 2D66A 1OHVA 2HZPA 3ZZJA 5I92A 1GCKA 2XBNA 2X5FA 2VMUA 4ZLVA 2HUUA 4CBRA 4MKJA 4XK1A 1I48A 1ASMA 1S09A 1ARGA 4FL0A 4RKCA 2AY7A 4HVKA 2EPJA 4MSOA 2BI5A 2HP1A 2JJFA 4GDYA 1C0NA 4IXOA 2VGZA 5G4IA 1ARSA 1AKCA 1W7MA 2FN6A 2W7JA 1IVRA 3PDBB 4PVFA 5FT6A 4CBSA 4ZDPA 2DGLA 4F5HA 3EI6A 3PPLA 3EI5A 5FT8A 4ADEA 4RLGA 3B1EA 4JEXA 2BWNA 1AKBA 1GC0A 1ZC9A 3N5MA 5E5IA 4ZWVA 1BJOB 1BW0A 2ZC0A 1EG5A 4PFNA 2D65A 4M2JA 2HORA 2X8UA 1IX8A 1ASGA 2OGAA 3MBBA 2R5CA 1ORDA 2W7DA 4F5MA 3LVKA 3LV2A 4ZAHA 5EUDA 1X28A 2YCTA 2YKYA 3F0HA 1M0QA 4QGRA 2EO5A 1C9CA 3H14A 1FC4A 1UKJA 1DJUA 2Z9WA 4JEYA 4U2HA 2YKVA 1M4NA 4WB0B 1TOGA 2Z1ZA 4RM1A 1W7LA 2R5EA 3ZRQA 1B5PA 1ECXA 1EJIA 4TN4A 4NOGA 3WGBA 5HHYA 5D5SA 2OQXA 3ZZKA 3FDBA 1MLZA 3FVUA 2R0TA 1ASBA 5JAYA 4OTLA 1SZKA 3FZ6A 2VMQA 5G0AA 2JGTA 3HVYA 3TCMA 1RV4A 3BC8A 2VMRA 4R2NA 2AY5A 4RJYA 2HOYA 3PDXA 4E77A 2W7EA 1KKJA 2YOBA 1ELUA 1I29A 1MDZA 1KKPA 4K2IA 4XEWA 4AO9A 2W7KA 4MQQA 3HDOA 2HOZA 3BCXA 4EU1A 2AY6A 2YRIA 4Y0IA 1UU0A 2Z61A 4R5ZA 3WX9A 4IYOA 3QN6A 1YOOA 4WXBA 2V1PA 3VK3A 3VK4A 1RVYA 1AY4A 2W7FA 3LWSA 1AICA 2DKBA 1AHYA 4UHOA 4W1XA 4WBTA 1M32A 4UHNA 3DZZA 3DXVA 2Q7WA 4N0WA 4OMAA 3WCOA 2JJGA 1U08A 4LW4A 4DGTA 2D7ZA 3B1DA 4E1OA 2DKJA 2W8WA 2AY8A 4HF8A 3ECDA 1AJSA 3FVXA 5HDMA 2C7TA 3L8AA 4F5LA 4A6TA 2EZ1A 1PMOA 1G4VA 1TOJA 2BIEA 3KKIA 4P7YA 1GBNA 1OXPA 2PB0A 2YCNA 2VMSA 2FNUA 4Q75A 1BS0A 4W91A 1AY8A 3BS8A 2CJHA 4OYTA 3BWNA 2ZJGA 4WYDA 1ARHA 1H1CA 1AAMA 1IAYA 1ASAA 3FRKA 2VMTA 3L44A 4ITXA 3RCHA 4ATPA 4Y0HA 5G4JA 1J04A 1AX4A 2V0YA 2VGTA 3HL2A 1C7OA 1LKCA 3PJ0A 4R5FA 2QMAA 3FQAA 1E5EA 3EI9A 3JZLA 4F4EA 4JEWA 1ASFA 1CJ0A 2OATA 1WYUB 3JWAA 2AEUA 4J5UA 2VMZA 1M7YA 4MQRA 3E9KA 3TFUA 5E4ZA 3MAUA 1RV3A 3USFA 3WCNA 1S06A 3BWNC 1AY5A 2ZSLA 4OBUA 1PMMA 2TPLA 1T3IA 3FZ7A 4XJLA 4BQ0A 1XI9A 2WK9A 3DR4A 4XJPA 3FFHA 1C7GA 1TARA 2AY3A 4IX8A 4JF1A 1JG8A 3AEJC 3II0A 3MAFB 4K2MA 3UE8A 3MADA 5F9SA 3F6TA 3WZFA 3E2FA 4Q6RA 5DX5A 3EZ1A 5E3KA 2W8JA 3FQ8A 3W1JA 1VP4A 3M5UA 4W1VA 4WLHA 1I43A 3AENB 1OHYA 2AY2A 4CXQA 4P3MA 1PG8A 4JE5A 1BJWA 1GEXA 2FNIA 2F8JA 3GR9A 3VOMA 2VI8A 1CS1A 1AMSA 2AY4A 2DGKA 1CL1A 2WK8A 1DTYA 4RITA 2X5DA 3K28A 3QPGA 4BMKA 4ZDOA 3MEBA 1ARIA 2BYJA 2VGVA 3EZSA 3BB8A 1WYVB 4ITGA 1YJSA 4LNMA 1MLYA 3KGWA 2CTZA 2X3LA 1DFOA 5J8QA 4U1TA 1QGNA 3B8XA 2AY1A 3E6GA 3D6KA 5DJ9A 4B9BA 4OC9A 1YIZA 2CJDA 2Z20A 4WD2A 3E2YA 4FFCA 3I16A 1AHGA 1LK9A 1UU2A 1BJNA 2OGEA 3NTJA 1JF9A 3E77A 3EI8A 1C7NA 4MY5A 3AOVA 4DBCA 3MKJA 3ISLA 3FD0A 2W8TA 4F5GA 2PO3A 5G2PA 2JJHA 1QJ5A 2ZSMA 3CBFA 1N2TA 1DGDA 2CSTA 1GEYA 1SZUA 1TOIA 3IF2A 2HUFA 2BYLA 3LVLB 4WYEA 3FZ8A 5EIGB 1O4SA 3P1TA 2JJEA 1N8PA 1GDEA 1YJYA 3OP7A 2JG2A 3IHJA 3AATA 2Z9XA 2JISA 4RKDA 3R4TA 5DJ1A 3FVSA 1LW5A 3ATHA 5D95A 2W8UA 2EH6A 5LHAA 2C81A 1SVVA 4WYAA 4A6UA 4BA4A 5M4BA 1DJEA 3JTXA 1D7UA 4ADCA 1KMKA 3NX3A 2R2NA 4ADBA 5EFSA 1MGVA 1V2EA 1SF2A 3Q8NA 1BQAA 3T32A 5F8VA 2Z9UA 1TOKA 4OBVA 2W7IA 1QIRA 1G4XA 3QBOA 4R8DA 1IJIA 4IXZA 2EGYA 3EIAA 4LW2A 3CQ5A 1LW4A 1QJ3A 2W7GA 4A00A 1S0AA 5K8BA 3A2BA 1VJOA 1WYTA 4KXKA 3PD6A 4AOAA 3E2ZB 1MAPA 4ZDLA 1G7XA 1B9IA 2C44A 2RFVA 4EB7A 3RI6A 5EAAA 1QISA 1QITA 1W23A 3LVJA 1MDOA 4A0HA 1XEYA 2QBTA 2CFBA 4OCAA 2HP2A 1WKHA 2VMYA 2D64A 1DJ9A 2R5CB 3HMUA 3COGA 5IWQA 1S07A 3VAXA 4A0RA 3G8MA 3FCRA 3UAKA 4WXGA 4JF0A 3W1IA 3JWBA 1V72A 3UWCA 3K7YA 3HLMA 2W7MA 5EAVA 2BHXA 4AO4A 2OKKA 3RUYA 3GSBA 3QGUA 5BJ4A 4M2MA 1QZ9A 3BCBA 3GZDA 1M0NA 3DR7A 2GMSA 1O61A 1KMJA 2ORDA 4WYFA 3RBFA 3FQ7A 4IXSA 1AMAA 4ZSWA 2QLRA 2NMPA 1O62A 3WKSA 4DQ6A 2BI9A 1GC3A 2D7YA 3B46A 4F5KA 1CL2A 1WYVA 4TMRA 5M49A 3PDBA 1CQ6A 1TOEA 2VMPA 2CINA 1OHWA 1D7SA 2BWPA 2W8VA 2AATA 1B5OA 3DODA 2VMNA 3FFRA 1UU1A 4XJMA 4K2BA 3A9ZA 4WXFA 3DC1A 3GZDC 5AX8A 2W7HA 3WGCA 3I5TA 4IYOB 1IAXA 1BJOA 2DOUA 4UOYA 2E54A 3AOWA 1V2FA 2HOXA 4RJ0A 5LH9A 1ASNA 2OKJA 2VLFA 4IW7A 4F5IA 1KL1A 3OKSA 3CQ6A 5C6UA 4EFFA 3N75A 2WK7A 1H0CA 1WSTA 2FQ6A 3TATA 5FT4A 1V2DA 2C0RA 4WB0A 3WKRA 2CH2A 1DKAA 4KAMA 1C4KA 4UHMA 3DRDA 2VI9A 4XJOA 4E3RA 4GE7A 2BIGA 3HQTA 1AJSB 1LC5A 3NUBA 3NU7A 3RBLA 4A0GA 3NUIA 3HT4A 2ZYJA 4BA5A 4XAUA 4WYGA 4GSAA 3RQ1A 4WP0A 1MDXA 2VMXA
chains in the Genus database with same CATH superfamily
4TV7A 1RVUA 4I8AA 1SPAA 5BJ3A 1IX6A 2D5YA 2Z67A 1O69A 5G2QA 1TATA 3RCHB 3GBXA 2E7JA 4UQVA 1AHXA 3GZCA 4GEBA 4A72A 4B98A 4ADDA 2ZP7A 2E7UA 3BN1A 2GSAA 3LG0A 3DU4A 1M0OA 4ATQA 3GJUA 4A6RA 2VMVA 3BWOA 5EUNA 2GQNA 7AATA 2VGWA 1AIBA 3ASBA 2BWOA 1AMQA 3NYUA 5EUEA 1B9HA 1CQ8A 2AEVA 2YHKA 3G0TA 3KE3A 4WLJA 4ZM4A 5M4DA 3A8UX 3ZRRA 4WYCA 3MC6A 2W7LA 1YIYA 3ASAA 4MQPA 3B1CA 1ASEA 2GB3A 3A9XA 1GC2A 3NNKA 8AATA 2QB3A 1Z7DA 2YKXA 2EZ2A 1S08A 2AY9A 2DR1A 3EUCA 3E2ZA 4JEVA 4AZJA 2E7IA 1BQDA 1ZODA 2FYFA 1ASLA 5FT5A 1KAFA 1EQBA 1AJRA 4Q76A 1M0PA 2VGUA 1P3WA 3KGXA 3NYTA 3VK2A 2YCPA 4H51A 2CY8A 4L0OA 4XQ2A 3G7QA 3NU8A 3PAAA 4ZSYA 4ZWMA 3P6KA 2ZY3A 1OATA 3MC6C 4Y0DA 1W3UA 1I41A 3AEPA 1ASDA 3NYSA 4GE4A 3WY7A 2ZY2A 4OT8A 1BKGA 1ARTA 1AHFA 2WKAA 2O1BA 4MKKA 1LC7A 2PB2A 2XH1A 1TASA 3DYDA 3JU7A 4A0FA 1KL2A 1ZOBA 1AIAA 1LS3A 3TQXA 5M46A 4O6ZA 1IX7A 2YKUA 1WYUA 2A1VA 3FKDA 2QA3A 1CQ7A 1GEWA 3PIUA 4W8IA 5EQCA 2CJGA 1YJZA 1Z3ZA 2VGSA 3AELA 4GE9A 3FTBA 2FM1A 4EMYA 2G6WA 3FSLA 3CQ4A 3ELEA 1G7WA 3VP6A 3I4JA 3EI7A 2ZUKA 5HXXA 4ZASA 3ACZA 1D7VA 2Z1YA 3MAFA 1N31A 1ASCA 3JW9A 1PFFA 3PA9A 4GRXA 3W1HA 4IY7A 1IBJA 3DXWA 4PFFA 2VIBA 1GC4A 3AEMA 2DGMA 2VMWA 4CVQA 3AENA 3QI6A 3PGYA 3A9YA 3WLXA 3TFTA 3BCAA 1B4XA 4JEZA 3CAIA 1E5FA 1J32A 1MAQA 3AEOA 1D2FA 3QHXA 1JS3A 1YNUA 2BKWA 4RIZA 1FG7A 3HBXA 4LNLA 4AH3A 3NRAA 4LC3A 1ELQA 4JE5D 3F9TA 4M2KA 4PIWA 2D61A 5G09A 1GD9A 3AEMC 4KYOA 4AZKA 2YRRA 4W5KA 5DB5A 2CANA 2O7CA 4Q31A 2GMUA 4F5JA 2HUIA 3LY1A 1W7NA 4E3QA 1BT4A 1SFFA 1AKAA 4N0BA 3ZRPA 2Z9VA 3LVMA 4MGRA 3H7FA 1AAWA 3AEJA 1CZEA 3N0LA 2D63A 1OXOA 1X29A 1LC8A 4ZM3A 1WYTB 3EIBA 4EB5A 1X0MA 1Y4IA 2BIAA 3PD6B 3R9AA 4CXRA 2VLHA 1JS6A 1CZCA 1AMRA 5TF5A 3GETA 4W1WA 2VMOA 2CH1A 4BHDA 2BI3A 2O0RA 4J8LA 2VYCA 2VIAA 5EIGA 9AATA 1WKGA 2CB1A 1IUGA 1TPLA 1D7RA 3ELPA 1DGEA 2BI1A 1YAAA 1FG3A 3QM2A 3NDNA 1VEFA 1SZSA 1BJ4A 1B8GA 3GWPA 1M6SA 3AV7A 3K40A 1AHEA 4F5FA 4LNJA 1X2AA 2QB2A 3BV0A 4RAEA 4ISYA 2BI2A 2D66A 1OHVA 2HZPA 3ZZJA 5I92A 1GCKA 2XBNA 2X5FA 2VMUA 4ZLVA 2HUUA 4CBRA 4MKJA 4XK1A 1I48A 1ASMA 1S09A 1ARGA 4FL0A 4RKCA 2AY7A 4HVKA 2EPJA 4MSOA 2BI5A 2HP1A 2JJFA 4GDYA 1C0NA 4IXOA 2VGZA 5G4IA 1ARSA 1AKCA 1W7MA 2FN6A 2W7JA 1IVRA 3PDBB 4PVFA 5FT6A 4CBSA 4ZDPA 2DGLA 4F5HA 3EI6A 3PPLA 3EI5A 5FT8A 4ADEA 4RLGA 3B1EA 4JEXA 2BWNA 1AKBA 1GC0A 1ZC9A 3N5MA 5E5IA 4ZWVA 1BJOB 1BW0A 2ZC0A 1EG5A 4PFNA 2D65A 4M2JA 2HORA 2X8UA 1IX8A 1ASGA 2OGAA 3MBBA 2R5CA 1ORDA 2W7DA 4F5MA 3LVKA 3LV2A 4ZAHA 5EUDA 1X28A 2YCTA 2YKYA 3F0HA 1M0QA 4QGRA 2EO5A 1C9CA 3H14A 1FC4A 1UKJA 1DJUA 2Z9WA 4JEYA 4U2HA 2YKVA 1M4NA 4WB0B 1TOGA 2Z1ZA 4RM1A 1W7LA 2R5EA 3ZRQA 1B5PA 1ECXA 1EJIA 4TN4A 4NOGA 3WGBA 5HHYA 5D5SA 2OQXA 3ZZKA 3FDBA 1MLZA 3FVUA 2R0TA 1ASBA 5JAYA 5KTBA 4OTLA 1SZKA 3FZ6A 2VMQA 5G0AA 2JGTA 3HVYA 3TCMA 1RV4A 3BC8A 2VMRA 4R2NA 2AY5A 4RJYA 2HOYA 3PDXA 4E77A 2W7EA 1KKJA 2YOBA 1ELUA 1I29A 1MDZA 1KKPA 4K2IA 4XEWA 4AO9A 2KFPA 2W7KA 4MQQA 3HDOA 2HOZA 3BCXA 4EU1A 2AY6A 2YRIA 4Y0IA 4K05A 1UU0A 2Z61A 4R5ZA 3WX9A 4IYOA 3QN6A 1YOOA 4WXBA 2V1PA 3VK3A 3VK4A 1RVYA 1AY4A 2W7FA 3LWSA 1AICA 2DKBA 1AHYA 4UHOA 4W1XA 4WBTA 1M32A 4UHNA 3DZZA 3DXVA 2Q7WA 4N0WA 4OMAA 3WCOA 2JJGA 1U08A 4LW4A 4DGTA 2D7ZA 3B1DA 4E1OA 2DKJA 2W8WA 2AY8A 4HF8A 3ECDA 1AJSA 3FVXA 5HDMA 2C7TA 3L8AA 4F5LA 2ZY5A 4A6TA 2EZ1A 1PMOA 1G4VA 1TOJA 2BIEA 3KKIA 3N4SA 4P7YA 1GBNA 1OXPA 2PB0A 2YCNA 2VMSA 2FNUA 4Q75A 1BS0A 4W91A 1AY8A 3BS8A 2CJHA 4OYTA 3BWNA 2ZJGA 4WYDA 1ARHA 1H1CA 1AAMA 1IAYA 1ASAA 3FRKA 2VMTA 3L44A 4ITXA 3RCHA 4ATPA 4Y0HA 5G4JA 1J04A 1AX4A 2V0YA 2VGTA 3HL2A 4H63Q 1C7OA 1LKCA 3PJ0A 4R5FA 2QMAA 3FQAA 1E5EA 3EI9A 3JZLA 4F4EA 4JEWA 1ASFA 1CJ0A 2OATA 1WYUB 3JWAA 2AEUA 4J5UA 3N4RA 2VMZA 1M7YA 4MQRA 3E9KA 3TFUA 2G7JA 5E4ZA 3MAUA 1RV3A 3USFA 3WCNA 1S06A 3BWNC 1AY5A 2ZSLA 4OBUA 1PMMA 2TPLA 1T3IA 3FZ7A 4XJLA 4BQ0A 1XI9A 2WK9A 3DR4A 4XJPA 3FFHA 1C7GA 1TARA 2AY3A 4IX8A 4JF1A 1JG8A 3AEJC 3II0A 3MAFB 4K2MA 3UE8A 3MADA 5F9SA 3F6TA 3WZFA 3E2FA 4Q6RA 2QSRA 5DX5A 3EZ1A 5E3KA 2W8JA 3FQ8A 3W1JA 1VP4A 3M5UA 4W1VA 4WLHA 2WB6A 1I43A 3AENB 1OHYA 2AY2A 4CXQA 4P3MA 1PG8A 4JE5A 1BJWA 1GEXA 2FNIA 2F8JA 3GR9A 3VOMA 2VI8A 1CS1A 1AMSA 2AY4A 2DGKA 1CL1A 2WK8A 1DTYA 4RITA 2X5DA 3K28A 3QPGA 4BMKA 4ZDOA 3MEBA 1ARIA 2BYJA 2VGVA 3EZSA 3BB8A 1WYVB 4ITGA 1YJSA 4LNMA 1MLYA 3KGWA 2CTZA 2X3LA 3H9XA 1DFOA 5J8QA 4U1TA 1QGNA 3B8XA 2AY1A 3E6GA 3D6KA 5DJ9A 4B9BA 4OC9A 1YIZA 2CJDA 2Z20A 4WD2A 3E2YA 4FFCA 2ZY4A 3I16A 1AHGA 1LK9A 1UU2A 1BJNA 2OGEA 3NTJA 1JF9A 3E77A 3EI8A 1C7NA 4MY5A 3AOVA 4DBCA 3MKJA 3ISLA 3FD0A 2W8TA 4F5GA 3N4XA 2PO3A 5G2PA 2JJHA 1QJ5A 2ZSMA 3CBFA 1N2TA 1DGDA 2CSTA 1GEYA 1SZUA 1TOIA 3IF2A 2FKIA 2HUFA 2BYLA 3LVLB 4WYEA 3FZ8A 5EIGB 1O4SA 3FDDA 3P1TA 2JJEA 1N8PA 1GDEA 1YJYA 3OP7A 2JG2A 3IHJA 3AATA 2Z9XA 2JISA 4RKDA 3R4TA 5DJ1A 3FVSA 1LW5A 3ATHA 5D95A 2W8UA 2EH6A 5LHAA 2C81A 1SVVA 4WYAA 4A6UA 4BA4A 5M4BA 1DJEA 2EYQA 3JTXA 1D7UA 4ADCA 1KMKA 3NX3A 2R2NA 4ADBA 5EFSA 1MGVA 1V2EA 1SF2A 3Q8NA 1BQAA 3T32A 5F8VA 2Z9UA 1TOKA 4OBVA 2W7IA 1QIRA 1G4XA 3QBOA 4R8DA 1IJIA 4IXZA 2EGYA 3EIAA 4LW2A 3CQ5A 1LW4A 1QJ3A 2W7GA 4A00A 1S0AA 5K8BA 3A2BA 1VJOA 1WYTA 4KXKA 3PD6A 4AOAA 3E2ZB 1MAPA 4ZDLA 1G7XA 1B9IA 2C44A 2RFVA 4EB7A 3N7NA 3RI6A 5EAAA 1QISA 1QITA 1W23A 3LVJA 1MDOA 4A0HA 1XEYA 2QBTA 2CFBA 4OCAA 2HP2A 1WKHA 2VMYA 2D64A 1DJ9A 2R5CB 3HMUA 3COGA 5IWQA 1S07A 3VAXA 4A0RA 3G8MA 3FCRA 3UAKA 4WXGA 4JF0A 3W1IA 3JWBA 1V72A 3UWCA 3K7YA 3HLMA 2W7MA 5EAVA 2BHXA 4AO4A 2OKKA 3RUYA 3GSBA 3QGUA 5BJ4A 4M2MA 1QZ9A 3BCBA 3GZDA 1M0NA 3DR7A 2GMSA 1O61A 1KMJA 2ORDA 4WYFA 3RBFA 3FQ7A 4IXSA 1AMAA 4ZSWA 2QLRA 2NMPA 1O62A 3WKSA 4DQ6A 2BI9A 1GC3A 2D7YA 3B46A 4F5KA 1CL2A 1WYVA 4TMRA 5M49A 3PDBA 1CQ6A 1TOEA 2VMPA 2CINA 1OHWA 1D7SA 2BWPA 2W8VA 2AATA 1B5OA 3DODA 2VMNA 3FFRA 1UU1A 4XJMA 4K2BA 3A9ZA 4WXFA 3DC1A 3GZDC 5AX8A 2W7HA 3WGCA 3I5TA 4IYOB 1IAXA 1BJOA 2DOUA 4UOYA 2E54A 3AOWA 1V2FA 2HOXA 4RJ0A 5LH9A 1ASNA 2OKJA 2VLFA 4IW7A 4F5IA 1KL1A 3OKSA 3CQ6A 5C6UA 4EFFA 3N75A 2WK7A 1H0CA 1WSTA 2FQ6A 3TATA 5FT4A 1V2DA 2C0RA 4WB0A 3WKRA 2CH2A 1DKAA 4KAMA 1C4KA 4UHMA 3DRDA 2VI9A 4XJOA 4E3RA 4GE7A 2BIGA 3HQTA 1AJSB 1LC5A 3NUBA 3NU7A 3RBLA 4A0GA 3NUIA 3HT4A 2ZYJA 4BA5A 4XAUA 4WYGA 4GSAA 3RQ1A 4WP0A 1MDXA 2VMXA
chains in the Genus database with same CATH topology
4TV7A 1RVUA 4I8AA 1SPAA 5BJ3A 1IX6A 2D5YA 2Z67A 1O69A 5G2QA 1TATA 3RCHB 3GBXA 2E7JA 4UQVA 1AHXA 3GZCA 4GEBA 4A72A 4B98A 4ADDA 2ZP7A 2E7UA 3BN1A 2GSAA 3LG0A 3DU4A 1M0OA 4ATQA 3GJUA 4A6RA 2VMVA 3BWOA 5EUNA 2GQNA 7AATA 2VGWA 1AIBA 3ASBA 2BWOA 1AMQA 3NYUA 5EUEA 1B9HA 1CQ8A 2AEVA 2YHKA 3G0TA 3KE3A 4WLJA 4ZM4A 5M4DA 3A8UX 3ZRRA 4WYCA 3MC6A 2W7LA 1YIYA 3ASAA 4MQPA 3B1CA 1ASEA 2GB3A 3A9XA 1GC2A 3NNKA 8AATA 2QB3A 1Z7DA 2YKXA 2EZ2A 1S08A 2AY9A 2DR1A 3EUCA 3E2ZA 4JEVA 4AZJA 2E7IA 1BQDA 1ZODA 2FYFA 1ASLA 5FT5A 1EQBA 1AJRA 4Q76A 1M0PA 2VGUA 1P3WA 3KGXA 3NYTA 3VK2A 2YCPA 4H51A 2CY8A 4L0OA 4XQ2A 3G7QA 3NU8A 3PAAA 4ZSYA 4ZWMA 3P6KA 2ZY3A 1OATA 3MC6C 4Y0DA 1W3UA 1I41A 3AEPA 1ASDA 3NYSA 4GE4A 3WY7A 2ZY2A 4OT8A 1BKGA 1ARTA 1AHFA 2WKAA 2O1BA 4MKKA 1LC7A 2PB2A 2XH1A 1TASA 3DYDA 3JU7A 4A0FA 1KL2A 1ZOBA 1AIAA 1LS3A 3TQXA 5M46A 4O6ZA 1IX7A 2YKUA 1WYUA 2A1VA 3FKDA 2QA3A 1CQ7A 1GEWA 3PIUA 4W8IA 5EQCA 2CJGA 1YJZA 1Z3ZA 2VGSA 3AELA 4GE9A 3FTBA 2FM1A 4EMYA 2G6WA 3FSLA 3CQ4A 3ELEA 1G7WA 3VP6A 3I4JA 3EI7A 2ZUKA 5HXXA 4ZASA 3ACZA 1D7VA 2Z1YA 3MAFA 1N31A 1ASCA 3JW9A 1PFFA 3PA9A 4GRXA 3W1HA 4IY7A 1IBJA 3DXWA 4PFFA 2VIBA 1GC4A 3AEMA 2DGMA 2VMWA 4CVQA 3AENA 3QI6A 3PGYA 3A9YA 3WLXA 3TFTA 3BCAA 1B4XA 4JEZA 3CAIA 1E5FA 1J32A 1MAQA 3AEOA 1D2FA 3QHXA 1JS3A 1YNUA 2BKWA 4RIZA 1FG7A 3HBXA 4LNLA 4AH3A 3NRAA 4LC3A 1ELQA 4JE5D 3F9TA 4M2KA 4PIWA 2D61A 5G09A 1GD9A 3AEMC 4KYOA 4AZKA 2YRRA 4W5KA 5DB5A 2CANA 2O7CA 4Q31A 2GMUA 4F5JA 2HUIA 3LY1A 1W7NA 4E3QA 1BT4A 1SFFA 1AKAA 4N0BA 3ZRPA 2Z9VA 3LVMA 4MGRA 3H7FA 1AAWA 3AEJA 1CZEA 3N0LA 2D63A 1OXOA 1X29A 1LC8A 4ZM3A 1WYTB 3EIBA 4EB5A 1X0MA 1Y4IA 2BIAA 3PD6B 3R9AA 4CXRA 2VLHA 1JS6A 1CZCA 1AMRA 5TF5A 3GETA 4W1WA 2VMOA 2CH1A 4BHDA 2BI3A 2O0RA 4J8LA 2VYCA 2VIAA 5EIGA 9AATA 1WKGA 2CB1A 1IUGA 1TPLA 1D7RA 3ELPA 1DGEA 2BI1A 1YAAA 1FG3A 3QM2A 3NDNA 1VEFA 1SZSA 1BJ4A 1B8GA 3GWPA 1M6SA 3AV7A 3K40A 1AHEA 4F5FA 4LNJA 1X2AA 2QB2A 3BV0A 4RAEA 4ISYA 2BI2A 2D66A 1OHVA 2HZPA 3ZZJA 5I92A 1GCKA 2XBNA 2X5FA 2VMUA 4ZLVA 2HUUA 4CBRA 4MKJA 4XK1A 1I48A 1ASMA 1S09A 1ARGA 4FL0A 4RKCA 2AY7A 4HVKA 2EPJA 4MSOA 2BI5A 2HP1A 2JJFA 4GDYA 1C0NA 4IXOA 2VGZA 5G4IA 1ARSA 1AKCA 1W7MA 2FN6A 2W7JA 1IVRA 3PDBB 4PVFA 5FT6A 4CBSA 4ZDPA 2DGLA 4F5HA 3EI6A 3PPLA 3EI5A 5FT8A 4ADEA 4RLGA 3B1EA 4JEXA 2BWNA 1AKBA 1GC0A 1ZC9A 3N5MA 5E5IA 4ZWVA 1BJOB 1BW0A 2ZC0A 1EG5A 4PFNA 2D65A 4M2JA 2HORA 2X8UA 1IX8A 1ASGA 2OGAA 3MBBA 2R5CA 1ORDA 2W7DA 4F5MA 3LVKA 3LV2A 4ZAHA 5EUDA 1X28A 2YCTA 2YKYA 3F0HA 1M0QA 4QGRA 2EO5A 1C9CA 3H14A 1FC4A 1UKJA 1DJUA 2Z9WA 4JEYA 4U2HA 2YKVA 1M4NA 4WB0B 1TOGA 2Z1ZA 4RM1A 1W7LA 2R5EA 3ZRQA 1B5PA 1ECXA 1EJIA 4TN4A 4NOGA 3WGBA 5HHYA 5D5SA 2OQXA 3ZZKA 3FDBA 1MLZA 3FVUA 2R0TA 1ASBA 5JAYA 5KTBA 4OTLA 1SZKA 3FZ6A 2VMQA 5G0AA 2JGTA 3HVYA 3TCMA 1RV4A 3BC8A 2VMRA 4R2NA 2AY5A 4RJYA 2HOYA 3PDXA 4E77A 2W7EA 1KKJA 2YOBA 1ELUA 1I29A 1MDZA 1KKPA 4K2IA 4XEWA 4AO9A 2KFPA 2W7KA 4MQQA 3HDOA 2HOZA 3BCXA 4EU1A 2AY6A 2YRIA 4Y0IA 4K05A 1UU0A 2Z61A 4R5ZA 3WX9A 4IYOA 3QN6A 1YOOA 4WXBA 2V1PA 3VK3A 3VK4A 1RVYA 1AY4A 2W7FA 3LWSA 1AICA 2DKBA 1AHYA 4UHOA 4W1XA 4WBTA 1M32A 4UHNA 3DZZA 3DXVA 2Q7WA 4N0WA 4OMAA 3WCOA 2JJGA 1U08A 4LW4A 4DGTA 2D7ZA 3B1DA 4E1OA 2DKJA 2W8WA 2AY8A 4HF8A 3ECDA 1AJSA 3FVXA 5HDMA 2C7TA 3L8AA 4F5LA 2ZY5A 4A6TA 2EZ1A 1PMOA 1G4VA 1TOJA 2BIEA 3KKIA 3N4SA 4P7YA 1GBNA 1OXPA 2PB0A 2YCNA 2VMSA 2FNUA 4Q75A 1BS0A 4W91A 1AY8A 3BS8A 2CJHA 4OYTA 3BWNA 2ZJGA 4WYDA 1ARHA 1H1CA 1AAMA 1IAYA 1ASAA 3FRKA 2VMTA 3L44A 4ITXA 3RCHA 4ATPA 4Y0HA 5G4JA 1J04A 1AX4A 2V0YA 2VGTA 3HL2A 4H63Q 1C7OA 1LKCA 3PJ0A 4R5FA 2QMAA 3FQAA 1E5EA 3EI9A 3JZLA 4F4EA 4JEWA 1ASFA 1CJ0A 2OATA 1WYUB 3JWAA 2AEUA 4J5UA 3N4RA 2VMZA 1M7YA 4MQRA 3E9KA 3TFUA 2G7JA 5E4ZA 3MAUA 1RV3A 3USFA 3WCNA 1S06A 3BWNC 1AY5A 2ZSLA 4OBUA 1PMMA 2TPLA 1T3IA 3FZ7A 4XJLA 4BQ0A 1XI9A 2WK9A 3DR4A 4XJPA 3FFHA 1C7GA 1TARA 2AY3A 4IX8A 4JF1A 1JG8A 3AEJC 3II0A 3MAFB 4K2MA 3UE8A 3MADA 5F9SA 3F6TA 3WZFA 3E2FA 4Q6RA 2QSRA 5DX5A 3EZ1A 5E3KA 2W8JA 3FQ8A 3W1JA 1VP4A 3M5UA 4W1VA 4WLHA 2WB6A 1I43A 3AENB 1OHYA 2AY2A 4CXQA 4P3MA 1PG8A 4JE5A 1BJWA 1GEXA 2FNIA 2F8JA 3GR9A 3VOMA 2VI8A 1CS1A 1AMSA 2AY4A 2DGKA 1CL1A 2WK8A 1DTYA 4RITA 2X5DA 3K28A 3QPGA 4BMKA 4ZDOA 3MEBA 1ARIA 2BYJA 2VGVA 3EZSA 3BB8A 1WYVB 4ITGA 1YJSA 4LNMA 1MLYA 3KGWA 2CTZA 2X3LA 3H9XA 1DFOA 5J8QA 4U1TA 1QGNA 3B8XA 2AY1A 3E6GA 3D6KA 5DJ9A 4B9BA 4OC9A 1YIZA 2CJDA 2Z20A 4WD2A 3E2YA 4FFCA 2ZY4A 3I16A 1AHGA 1LK9A 1UU2A 1BJNA 2OGEA 3NTJA 1JF9A 3E77A 3EI8A 1C7NA 4MY5A 3AOVA 4DBCA 3MKJA 3ISLA 3FD0A 2W8TA 4F5GA 3N4XA 2PO3A 5G2PA 2JJHA 1QJ5A 2ZSMA 3CBFA 1N2TA 1DGDA 2CSTA 1GEYA 1SZUA 1TOIA 3IF2A 2FKIA 2HUFA 2BYLA 3LVLB 4WYEA 3FZ8A 5EIGB 1O4SA 3FDDA 3P1TA 2JJEA 1N8PA 1GDEA 1YJYA 3OP7A 2JG2A 3IHJA 3AATA 2Z9XA 2JISA 4RKDA 3R4TA 5DJ1A 3FVSA 1LW5A 3ATHA 5D95A 2W8UA 2EH6A 5LHAA 2C81A 1SVVA 4WYAA 4A6UA 4BA4A 5M4BA 1DJEA 2EYQA 3JTXA 1D7UA 4ADCA 1KMKA 3NX3A 2R2NA 4ADBA 5EFSA 1MGVA 1V2EA 1SF2A 3Q8NA 1BQAA 3T32A 5F8VA 2Z9UA 1TOKA 4OBVA 2W7IA 1QIRA 1G4XA 3QBOA 4R8DA 1IJIA 4IXZA 2EGYA 3EIAA 4LW2A 3CQ5A 1LW4A 1QJ3A 2W7GA 4A00A 1S0AA 5K8BA 3A2BA 1VJOA 1WYTA 4KXKA 3PD6A 4AOAA 3E2ZB 1MAPA 4ZDLA 1G7XA 1B9IA 2C44A 2RFVA 4EB7A 3N7NA 3RI6A 5EAAA 1QISA 1QITA 1W23A 3LVJA 1MDOA 4A0HA 1XEYA 2QBTA 2CFBA 4OCAA 2HP2A 1WKHA 2VMYA 2D64A 1DJ9A 2R5CB 3HMUA 3COGA 5IWQA 1S07A 3VAXA 4A0RA 3G8MA 3FCRA 3UAKA 4WXGA 4JF0A 3W1IA 3JWBA 1V72A 3UWCA 3K7YA 3HLMA 2W7MA 5EAVA 2BHXA 4AO4A 2OKKA 3RUYA 3GSBA 3QGUA 5BJ4A 4M2MA 1QZ9A 3BCBA 3GZDA 1M0NA 3DR7A 2GMSA 1O61A 1KMJA 2ORDA 4WYFA 3RBFA 3FQ7A 4IXSA 1AMAA 4ZSWA 2QLRA 2NMPA 1O62A 3WKSA 4DQ6A 2BI9A 1GC3A 2D7YA 3B46A 4F5KA 1CL2A 1WYVA 4TMRA 5M49A 3PDBA 1CQ6A 1TOEA 2VMPA 2CINA 1OHWA 1D7SA 2BWPA 2W8VA 2AATA 1B5OA 3DODA 2VMNA 3FFRA 1UU1A 4XJMA 4K2BA 3A9ZA 4WXFA 3DC1A 3GZDC 5AX8A 2W7HA 3WGCA 3I5TA 4IYOB 1IAXA 1BJOA 2DOUA 4UOYA 2E54A 3AOWA 1V2FA 2HOXA 4RJ0A 5LH9A 1ASNA 2OKJA 2VLFA 4IW7A 4F5IA 1KL1A 3OKSA 3CQ6A 5C6UA 4EFFA 3N75A 2WK7A 1H0CA 1WSTA 2FQ6A 3TATA 5FT4A 1V2DA 2C0RA 4WB0A 3WKRA 2CH2A 1DKAA 4KAMA 1C4KA 4UHMA 3DRDA 2VI9A 4XJOA 4E3RA 4GE7A 2BIGA 3HQTA 1AJSB 1LC5A 3NUBA 3NU7A 3RBLA 4A0GA 3NUIA 3HT4A 2ZYJA 4BA5A 4XAUA 4WYGA 4GSAA 3RQ1A 4WP0A 1MDXA 2VMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TV7 A;  1RVU A;  4I8A A;  1SPA A;  5BJ3 A;  1IX6 A;  2D5Y A;  2Z67 A;  1O69 A;  5G2Q A;  1TAT A;  3RCH B;  3GBX A;  2E7J A;  4UQV A;  1AHX A;  3GZC A;  4GEB A;  4A72 A;  4B98 A;  4ADD A;  2ZP7 A;  2E7U A;  3BN1 A;  2GSA A;  3LG0 A;  3DU4 A;  1M0O A;  4ATQ A;  3GJU A;  4A6R A;  2VMV A;  3BWO A;  5EUN A;  2GQN A;  7AAT A;  2VGW A;  1AIB A;  3ASB A;  2BWO A;  1AMQ A;  3NYU A;  5EUE A;  1B9H A;  1CQ8 A;  2AEV A;  2YHK A;  3G0T A;  3KE3 A;  4WLJ A;  4ZM4 A;  5M4D A;  3A8U X;  3ZRR A;  4WYC A;  3MC6 A;  2W7L A;  1YIY A;  3ASA A;  4MQP A;  3B1C A;  1ASE A;  2GB3 A;  3A9X A;  1GC2 A;  3NNK A;  8AAT A;  2QB3 A;  1Z7D A;  2YKX A;  2EZ2 A;  1S08 A;  2AY9 A;  2DR1 A;  3EUC A;  3E2Z A;  4JEV A;  4AZJ A;  2E7I A;  1BQD A;  1ZOD A;  2FYF A;  1ASL A;  5FT5 A;  1EQB A;  1AJR A;  4Q76 A;  1M0P A;  2VGU A;  1P3W A;  3KGX A;  3NYT A;  3VK2 A;  2YCP A;  4H51 A;  2CY8 A;  4L0O A;  4XQ2 A;  3G7Q A;  3NU8 A;  3PAA A;  4ZSY A;  4ZWM A;  3P6K A;  1OAT A;  3MC6 C;  4Y0D A;  1W3U A;  1I41 A;  3AEP A;  1ASD A;  3NYS A;  4GE4 A;  3WY7 A;  4OT8 A;  1BKG A;  1ART A;  1AHF A;  2WKA A;  2O1B A;  4MKK A;  1LC7 A;  2PB2 A;  2XH1 A;  1TAS A;  3DYD A;  3JU7 A;  4A0F A;  1KL2 A;  1ZOB A;  1AIA A;  1LS3 A;  3TQX A;  5M46 A;  4O6Z A;  1IX7 A;  2YKU A;  1WYU A;  3FKD A;  2QA3 A;  1CQ7 A;  1GEW A;  3PIU A;  4W8I A;  5EQC A;  2CJG A;  1YJZ A;  1Z3Z A;  2VGS A;  3AEL A;  4GE9 A;  3FTB A;  2FM1 A;  4EMY A;  2G6W A;  3FSL A;  3CQ4 A;  3ELE A;  1G7W A;  3VP6 A;  3I4J A;  3EI7 A;  2ZUK A;  5HXX A;  4ZAS A;  3ACZ A;  1D7V A;  2Z1Y A;  3MAF A;  1N31 A;  1ASC A;  3JW9 A;  1PFF A;  3PA9 A;  4GRX A;  3W1H A;  4IY7 A;  1IBJ A;  3DXW A;  4PFF A;  2VIB A;  1GC4 A;  3AEM A;  2DGM A;  2VMW A;  4CVQ A;  3AEN A;  3QI6 A;  3PGY A;  3A9Y A;  3WLX A;  3TFT A;  3BCA A;  1B4X A;  4JEZ A;  3CAI A;  1E5F A;  1J32 A;  1MAQ A;  3AEO A;  1D2F A;  3QHX A;  1JS3 A;  1YNU A;  2BKW A;  4RIZ A;  1FG7 A;  3HBX A;  4LNL A;  4AH3 A;  3NRA A;  4LC3 A;  1ELQ A;  4JE5 D;  3F9T A;  4M2K A;  4PIW A;  2D61 A;  5G09 A;  1GD9 A;  3AEM C;  4KYO A;  4AZK A;  2YRR A;  4W5K A;  5DB5 A;  2CAN A;  2O7C A;  4Q31 A;  2GMU A;  4F5J A;  2HUI A;  3LY1 A;  1W7N A;  4E3Q A;  1BT4 A;  1SFF A;  1AKA A;  4N0B A;  3ZRP A;  2Z9V A;  3LVM A;  4MGR A;  3H7F A;  1AAW A;  3AEJ A;  1CZE A;  3N0L A;  2D63 A;  1OXO A;  1X29 A;  1LC8 A;  4ZM3 A;  1WYT B;  3EIB A;  4EB5 A;  1X0M A;  1Y4I A;  2BIA A;  3PD6 B;  3R9A A;  4CXR A;  2VLH A;  1JS6 A;  1CZC A;  1AMR A;  5TF5 A;  3GET A;  4W1W A;  2VMO A;  2CH1 A;  4BHD A;  2BI3 A;  2O0R A;  4J8L A;  2VYC A;  2VIA A;  5EIG A;  9AAT A;  1WKG A;  2CB1 A;  1IUG A;  1TPL A;  1D7R A;  3ELP A;  1DGE A;  2BI1 A;  1YAA A;  1FG3 A;  3QM2 A;  3NDN A;  1VEF A;  1SZS A;  1BJ4 A;  1B8G A;  3GWP A;  1M6S A;  3AV7 A;  3K40 A;  1AHE A;  4F5F A;  4LNJ A;  1X2A A;  2QB2 A;  3BV0 A;  4RAE A;  4ISY A;  2BI2 A;  2D66 A;  1OHV A;  2HZP A;  3ZZJ A;  5I92 A;  1GCK A;  2XBN A;  2X5F A;  2VMU A;  4ZLV A;  2HUU A;  4CBR A;  4MKJ A;  4XK1 A;  1I48 A;  1ASM A;  1S09 A;  1ARG A;  4FL0 A;  4RKC A;  2AY7 A;  4HVK A;  2EPJ A;  4MSO A;  2BI5 A;  2HP1 A;  2JJF A;  4GDY A;  1C0N A;  4IXO A;  2VGZ A;  5G4I A;  1ARS A;  1AKC A;  1W7M A;  2FN6 A;  2W7J A;  1IVR A;  3PDB B;  4PVF A;  5FT6 A;  4CBS A;  4ZDP A;  2DGL A;  4F5H A;  3EI6 A;  3PPL A;  3EI5 A;  5FT8 A;  4ADE A;  4RLG A;  3B1E A;  4JEX A;  2BWN A;  1AKB A;  1GC0 A;  1ZC9 A;  3N5M A;  5E5I A;  4ZWV A;  1BJO B;  1BW0 A;  2ZC0 A;  1EG5 A;  4PFN A;  2D65 A;  4M2J A;  2HOR A;  2X8U A;  1IX8 A;  1ASG A;  2OGA A;  3MBB A;  2R5C A;  1ORD A;  2W7D A;  4F5M A;  3LVK A;  3LV2 A;  4ZAH A;  5EUD A;  1X28 A;  2YCT A;  2YKY A;  3F0H A;  1M0Q A;  4QGR A;  2EO5 A;  1C9C A;  3H14 A;  1FC4 A;  1UKJ A;  1DJU A;  2Z9W A;  4JEY A;  4U2H A;  2YKV A;  1M4N A;  4WB0 B;  1TOG A;  2Z1Z A;  4RM1 A;  1W7L A;  2R5E A;  3ZRQ A;  1B5P A;  1ECX A;  1EJI A;  4TN4 A;  4NOG A;  3WGB A;  5HHY A;  5D5S A;  2OQX A;  3ZZK A;  3FDB A;  1MLZ A;  3FVU A;  2R0T A;  1ASB A;  5JAY A;  4OTL A;  1SZK A;  3FZ6 A;  2VMQ A;  5G0A A;  2JGT A;  3HVY A;  3TCM A;  1RV4 A;  3BC8 A;  2VMR A;  4R2N A;  2AY5 A;  4RJY A;  2HOY A;  3PDX A;  4E77 A;  2W7E A;  1KKJ A;  2YOB A;  1ELU A;  1I29 A;  1MDZ A;  1KKP A;  4K2I A;  4XEW A;  4AO9 A;  2W7K A;  4MQQ A;  3HDO A;  2HOZ A;  3BCX A;  4EU1 A;  2AY6 A;  2YRI A;  4Y0I A;  1UU0 A;  2Z61 A;  4R5Z A;  3WX9 A;  4IYO A;  3QN6 A;  1YOO A;  4WXB A;  2V1P A;  3VK3 A;  3VK4 A;  1RVY A;  1AY4 A;  2W7F A;  3LWS A;  1AIC A;  2DKB A;  1AHY A;  4UHO A;  4W1X A;  4WBT A;  1M32 A;  4UHN A;  3DZZ A;  3DXV A;  2Q7W A;  4N0W A;  4OMA A;  3WCO A;  2JJG A;  1U08 A;  4LW4 A;  4DGT A;  2D7Z A;  3B1D A;  4E1O A;  2DKJ A;  2W8W A;  2AY8 A;  4HF8 A;  3ECD A;  1AJS A;  3FVX A;  5HDM A;  2C7T A;  3L8A A;  4F5L A;  4A6T A;  2EZ1 A;  1PMO A;  1G4V A;  1TOJ A;  2BIE A;  3KKI A;  4P7Y A;  1GBN A;  1OXP A;  2PB0 A;  2YCN A;  2VMS A;  2FNU A;  4Q75 A;  1BS0 A;  4W91 A;  1AY8 A;  3BS8 A;  2CJH A;  4OYT A;  3BWN A;  2ZJG A;  4WYD A;  1ARH A;  1H1C A;  1AAM A;  1IAY A;  1ASA A;  3FRK A;  2VMT A;  3L44 A;  4ITX A;  3RCH A;  4ATP A;  4Y0H A;  5G4J A;  1J04 A;  1AX4 A;  2V0Y A;  2VGT A;  3HL2 A;  1C7O A;  1LKC A;  3PJ0 A;  4R5F A;  2QMA A;  3FQA A;  1E5E A;  3EI9 A;  3JZL A;  4F4E A;  4JEW A;  1ASF A;  1CJ0 A;  2OAT A;  1WYU B;  3JWA A;  2AEU A;  4J5U A;  2VMZ A;  1M7Y A;  4MQR A;  3E9K A;  3TFU A;  5E4Z A;  3MAU A;  1RV3 A;  3USF A;  3WCN A;  1S06 A;  3BWN C;  1AY5 A;  2ZSL A;  4OBU A;  1PMM A;  2TPL A;  1T3I A;  3FZ7 A;  4XJL A;  4BQ0 A;  1XI9 A;  2WK9 A;  3DR4 A;  4XJP A;  3FFH A;  1C7G A;  1TAR A;  2AY3 A;  4IX8 A;  4JF1 A;  1JG8 A;  3AEJ C;  3II0 A;  3MAF B;  4K2M A;  3UE8 A;  3MAD A;  5F9S A;  3F6T A;  3WZF A;  3E2F A;  4Q6R A;  5DX5 A;  3EZ1 A;  5E3K A;  2W8J A;  3FQ8 A;  3W1J A;  1VP4 A;  3M5U A;  4W1V A;  4WLH A;  1I43 A;  3AEN B;  1OHY A;  2AY2 A;  4CXQ A;  4P3M A;  1PG8 A;  4JE5 A;  1BJW A;  1GEX A;  2FNI A;  2F8J A;  3GR9 A;  3VOM A;  2VI8 A;  1CS1 A;  1AMS A;  2AY4 A;  2DGK A;  1CL1 A;  2WK8 A;  1DTY A;  4RIT A;  2X5D A;  3K28 A;  3QPG A;  4BMK A;  4ZDO A;  3MEB A;  1ARI A;  2BYJ A;  2VGV A;  3EZS A;  3BB8 A;  1WYV B;  4ITG A;  1YJS A;  4LNM A;  1MLY A;  3KGW A;  2CTZ A;  2X3L A;  1DFO A;  5J8Q A;  4U1T A;  1QGN A;  3B8X A;  2AY1 A;  3E6G A;  3D6K A;  5DJ9 A;  4B9B A;  4OC9 A;  1YIZ A;  2CJD A;  2Z20 A;  4WD2 A;  3E2Y A;  4FFC A;  3I16 A;  1AHG A;  1LK9 A;  1UU2 A;  1BJN A;  2OGE A;  3NTJ A;  1JF9 A;  3E77 A;  3EI8 A;  1C7N A;  4MY5 A;  3AOV A;  4DBC A;  3MKJ A;  3ISL A;  3FD0 A;  2W8T A;  4F5G A;  2PO3 A;  5G2P A;  2JJH A;  1QJ5 A;  2ZSM A;  3CBF A;  1N2T A;  1DGD A;  2CST A;  1GEY A;  1SZU A;  1TOI A;  3IF2 A;  2HUF A;  2BYL A;  3LVL B;  4WYE A;  3FZ8 A;  5EIG B;  1O4S A;  3P1T A;  2JJE A;  1N8P A;  1GDE A;  1YJY A;  3OP7 A;  2JG2 A;  3IHJ A;  3AAT A;  2Z9X A;  2JIS A;  4RKD A;  3R4T A;  5DJ1 A;  3FVS A;  1LW5 A;  3ATH A;  5D95 A;  2W8U A;  2EH6 A;  5LHA A;  2C81 A;  1SVV A;  4WYA A;  4A6U A;  4BA4 A;  5M4B A;  1DJE A;  3JTX A;  1D7U A;  4ADC A;  1KMK A;  3NX3 A;  2R2N A;  4ADB A;  5EFS A;  1MGV A;  1V2E A;  1SF2 A;  3Q8N A;  1BQA A;  3T32 A;  5F8V A;  2Z9U A;  1TOK A;  4OBV A;  2W7I A;  1QIR A;  1G4X A;  3QBO A;  4R8D A;  1IJI A;  4IXZ A;  2EGY A;  3EIA A;  4LW2 A;  3CQ5 A;  1LW4 A;  1QJ3 A;  2W7G A;  4A00 A;  1S0A A;  5K8B A;  3A2B A;  1VJO A;  1WYT A;  4KXK A;  3PD6 A;  4AOA A;  3E2Z B;  1MAP A;  4ZDL A;  1G7X A;  1B9I A;  2C44 A;  2RFV A;  4EB7 A;  3RI6 A;  5EAA A;  1QIS A;  1QIT A;  1W23 A;  3LVJ A;  1MDO A;  4A0H A;  1XEY A;  2QBT A;  2CFB A;  4OCA A;  2HP2 A;  1WKH A;  2VMY A;  2D64 A;  1DJ9 A;  2R5C B;  3HMU A;  3COG A;  5IWQ A;  1S07 A;  3VAX A;  4A0R A;  3G8M A;  3FCR A;  3UAK A;  4WXG A;  4JF0 A;  3W1I A;  3JWB A;  1V72 A;  3UWC A;  3K7Y A;  3HLM A;  2W7M A;  5EAV A;  2BHX A;  4AO4 A;  2OKK A;  3RUY A;  3GSB A;  3QGU A;  5BJ4 A;  4M2M A;  1QZ9 A;  3BCB A;  3GZD A;  1M0N A;  3DR7 A;  2GMS A;  1O61 A;  1KMJ A;  2ORD A;  4WYF A;  3RBF A;  3FQ7 A;  4IXS A;  1AMA A;  4ZSW A;  2QLR A;  2NMP A;  1O62 A;  3WKS A;  4DQ6 A;  2BI9 A;  1GC3 A;  2D7Y A;  3B46 A;  4F5K A;  1CL2 A;  1WYV A;  4TMR A;  5M49 A;  3PDB A;  1CQ6 A;  1TOE A;  2VMP A;  2CIN A;  1OHW A;  1D7S A;  2BWP A;  2W8V A;  2AAT A;  1B5O A;  3DOD A;  2VMN A;  3FFR A;  1UU1 A;  4XJM A;  4K2B A;  3A9Z A;  4WXF A;  3DC1 A;  3GZD C;  5AX8 A;  2W7H A;  3WGC A;  3I5T A;  4IYO B;  1IAX A;  1BJO A;  2DOU A;  4UOY A;  2E54 A;  3AOW A;  1V2F A;  2HOX A;  4RJ0 A;  5LH9 A;  1ASN A;  2OKJ A;  2VLF A;  4IW7 A;  4F5I A;  1KL1 A;  3OKS A;  3CQ6 A;  5C6U A;  4EFF A;  3N75 A;  2WK7 A;  1H0C A;  1WST A;  2FQ6 A;  3TAT A;  5FT4 A;  1V2D A;  2C0R A;  4WB0 A;  3WKR A;  2CH2 A;  1DKA A;  4KAM A;  1C4K A;  4UHM A;  3DRD A;  2VI9 A;  4XJO A;  4E3R A;  4GE7 A;  2BIG A;  3HQT A;  1AJS B;  1LC5 A;  3NUB A;  3NU7 A;  3RBL A;  4A0G A;  3NUI A;  3HT4 A;  2ZYJ A;  4BA5 A;  4XAU A;  4WYG A;  4GSA A;  3RQ1 A;  4WP0 A;  1MDX A;  2VMX A; 
#chains in the Genus database with same CATH topology
 4TV7 A;  1RVU A;  4I8A A;  1SPA A;  5BJ3 A;  1IX6 A;  2D5Y A;  2Z67 A;  1O69 A;  5G2Q A;  1TAT A;  3RCH B;  3GBX A;  2E7J A;  4UQV A;  1AHX A;  3GZC A;  4GEB A;  4A72 A;  4B98 A;  4ADD A;  2ZP7 A;  2E7U A;  3BN1 A;  2GSA A;  3LG0 A;  3DU4 A;  1M0O A;  4ATQ A;  3GJU A;  4A6R A;  2VMV A;  3BWO A;  5EUN A;  2GQN A;  7AAT A;  2VGW A;  1AIB A;  3ASB A;  2BWO A;  1AMQ A;  3NYU A;  5EUE A;  1B9H A;  1CQ8 A;  2AEV A;  2YHK A;  3G0T A;  3KE3 A;  4WLJ A;  4ZM4 A;  5M4D A;  3A8U X;  3ZRR A;  4WYC A;  3MC6 A;  2W7L A;  1YIY A;  3ASA A;  4MQP A;  3B1C A;  1ASE A;  2GB3 A;  3A9X A;  1GC2 A;  3NNK A;  8AAT A;  2QB3 A;  1Z7D A;  2YKX A;  2EZ2 A;  1S08 A;  2AY9 A;  2DR1 A;  3EUC A;  3E2Z A;  4JEV A;  4AZJ A;  2E7I A;  1BQD A;  1ZOD A;  2FYF A;  1ASL A;  5FT5 A;  1KAF A;  1EQB A;  1AJR A;  4Q76 A;  1M0P A;  2VGU A;  1P3W A;  3KGX A;  3NYT A;  3VK2 A;  2YCP A;  4H51 A;  2CY8 A;  4L0O A;  4XQ2 A;  3G7Q A;  3NU8 A;  3PAA A;  4ZSY A;  4ZWM A;  3P6K A;  2ZY3 A;  1OAT A;  3MC6 C;  4Y0D A;  1W3U A;  1I41 A;  3AEP A;  1ASD A;  3NYS A;  4GE4 A;  3WY7 A;  2ZY2 A;  4OT8 A;  1BKG A;  1ART A;  1AHF A;  2WKA A;  2O1B A;  4MKK A;  1LC7 A;  2PB2 A;  2XH1 A;  1TAS A;  3DYD A;  3JU7 A;  4A0F A;  1KL2 A;  1ZOB A;  1AIA A;  1LS3 A;  3TQX A;  5M46 A;  4O6Z A;  1IX7 A;  2YKU A;  1WYU A;  2A1V A;  3FKD A;  2QA3 A;  1CQ7 A;  1GEW A;  3PIU A;  4W8I A;  5EQC A;  2CJG A;  1YJZ A;  1Z3Z A;  2VGS A;  3AEL A;  4GE9 A;  3FTB A;  2FM1 A;  4EMY A;  2G6W A;  3FSL A;  3CQ4 A;  3ELE A;  1G7W A;  3VP6 A;  3I4J A;  3EI7 A;  2ZUK A;  5HXX A;  4ZAS A;  3ACZ A;  1D7V A;  2Z1Y A;  3MAF A;  1N31 A;  1ASC A;  3JW9 A;  1PFF A;  3PA9 A;  4GRX A;  3W1H A;  4IY7 A;  1IBJ A;  3DXW A;  4PFF A;  2VIB A;  1GC4 A;  3AEM A;  2DGM A;  2VMW A;  4CVQ A;  3AEN A;  3QI6 A;  3PGY A;  3A9Y A;  3WLX A;  3TFT A;  3BCA A;  1B4X A;  4JEZ A;  3CAI A;  1E5F A;  1J32 A;  1MAQ A;  3AEO A;  1D2F A;  3QHX A;  1JS3 A;  1YNU A;  2BKW A;  4RIZ A;  1FG7 A;  3HBX A;  4LNL A;  4AH3 A;  3NRA A;  4LC3 A;  1ELQ A;  4JE5 D;  3F9T A;  4M2K A;  4PIW A;  2D61 A;  5G09 A;  1GD9 A;  3AEM C;  4KYO A;  4AZK A;  2YRR A;  4W5K A;  5DB5 A;  2CAN A;  2O7C A;  4Q31 A;  2GMU A;  4F5J A;  2HUI A;  3LY1 A;  1W7N A;  4E3Q A;  1BT4 A;  1SFF A;  1AKA A;  4N0B A;  3ZRP A;  2Z9V A;  3LVM A;  4MGR A;  3H7F A;  1AAW A;  3AEJ A;  1CZE A;  3N0L A;  2D63 A;  1OXO A;  1X29 A;  1LC8 A;  4ZM3 A;  1WYT B;  3EIB A;  4EB5 A;  1X0M A;  1Y4I A;  2BIA A;  3PD6 B;  3R9A A;  4CXR A;  2VLH A;  1JS6 A;  1CZC A;  1AMR A;  5TF5 A;  3GET A;  4W1W A;  2VMO A;  2CH1 A;  4BHD A;  2BI3 A;  2O0R A;  4J8L A;  2VYC A;  2VIA A;  5EIG A;  9AAT A;  1WKG A;  2CB1 A;  1IUG A;  1TPL A;  1D7R A;  3ELP A;  1DGE A;  2BI1 A;  1YAA A;  1FG3 A;  3QM2 A;  3NDN A;  1VEF A;  1SZS A;  1BJ4 A;  1B8G A;  3GWP A;  1M6S A;  3AV7 A;  3K40 A;  1AHE A;  4F5F A;  4LNJ A;  1X2A A;  2QB2 A;  3BV0 A;  4RAE A;  4ISY A;  2BI2 A;  2D66 A;  1OHV A;  2HZP A;  3ZZJ A;  5I92 A;  1GCK A;  2XBN A;  2X5F A;  2VMU A;  4ZLV A;  2HUU A;  4CBR A;  4MKJ A;  4XK1 A;  1I48 A;  1ASM A;  1S09 A;  1ARG A;  4FL0 A;  4RKC A;  2AY7 A;  4HVK A;  2EPJ A;  4MSO A;  2BI5 A;  2HP1 A;  2JJF A;  4GDY A;  1C0N A;  4IXO A;  2VGZ A;  5G4I A;  1ARS A;  1AKC A;  1W7M A;  2FN6 A;  2W7J A;  1IVR A;  3PDB B;  4PVF A;  5FT6 A;  4CBS A;  4ZDP A;  2DGL A;  4F5H A;  3EI6 A;  3PPL A;  3EI5 A;  5FT8 A;  4ADE A;  4RLG A;  3B1E A;  4JEX A;  2BWN A;  1AKB A;  1GC0 A;  1ZC9 A;  3N5M A;  5E5I A;  4ZWV A;  1BJO B;  1BW0 A;  2ZC0 A;  1EG5 A;  4PFN A;  2D65 A;  4M2J A;  2HOR A;  2X8U A;  1IX8 A;  1ASG A;  2OGA A;  3MBB A;  2R5C A;  1ORD A;  2W7D A;  4F5M A;  3LVK A;  3LV2 A;  4ZAH A;  5EUD A;  1X28 A;  2YCT A;  2YKY A;  3F0H A;  1M0Q A;  4QGR A;  2EO5 A;  1C9C A;  3H14 A;  1FC4 A;  1UKJ A;  1DJU A;  2Z9W A;  4JEY A;  4U2H A;  2YKV A;  1M4N A;  4WB0 B;  1TOG A;  2Z1Z A;  4RM1 A;  1W7L A;  2R5E A;  3ZRQ A;  1B5P A;  1ECX A;  1EJI A;  4TN4 A;  4NOG A;  3WGB A;  5HHY A;  5D5S A;  2OQX A;  3ZZK A;  3FDB A;  1MLZ A;  3FVU A;  2R0T A;  1ASB A;  5JAY A;  5KTB A;  4OTL A;  1SZK A;  3FZ6 A;  2VMQ A;  5G0A A;  2JGT A;  3HVY A;  3TCM A;  1RV4 A;  3BC8 A;  2VMR A;  4R2N A;  2AY5 A;  4RJY A;  2HOY A;  3PDX A;  4E77 A;  2W7E A;  1KKJ A;  2YOB A;  1ELU A;  1I29 A;  1MDZ A;  1KKP A;  4K2I A;  4XEW A;  4AO9 A;  2KFP A;  2W7K A;  4MQQ A;  3HDO A;  2HOZ A;  3BCX A;  4EU1 A;  2AY6 A;  2YRI A;  4Y0I A;  4K05 A;  1UU0 A;  2Z61 A;  4R5Z A;  3WX9 A;  4IYO A;  3QN6 A;  1YOO A;  4WXB A;  2V1P A;  3VK3 A;  3VK4 A;  1RVY A;  1AY4 A;  2W7F A;  3LWS A;  1AIC A;  2DKB A;  1AHY A;  4UHO A;  4W1X A;  4WBT A;  1M32 A;  4UHN A;  3DZZ A;  3DXV A;  2Q7W A;  4N0W A;  4OMA A;  3WCO A;  2JJG A;  1U08 A;  4LW4 A;  4DGT A;  2D7Z A;  3B1D A;  4E1O A;  2DKJ A;  2W8W A;  2AY8 A;  4HF8 A;  3ECD A;  1AJS A;  3FVX A;  5HDM A;  2C7T A;  3L8A A;  4F5L A;  2ZY5 A;  4A6T A;  2EZ1 A;  1PMO A;  1G4V A;  1TOJ A;  2BIE A;  3KKI A;  3N4S A;  4P7Y A;  1GBN A;  1OXP A;  2PB0 A;  2YCN A;  2VMS A;  2FNU A;  4Q75 A;  1BS0 A;  4W91 A;  1AY8 A;  3BS8 A;  2CJH A;  4OYT A;  3BWN A;  2ZJG A;  4WYD A;  1ARH A;  1H1C A;  1AAM A;  1IAY A;  1ASA A;  3FRK A;  2VMT A;  3L44 A;  4ITX A;  3RCH A;  4ATP A;  4Y0H A;  5G4J A;  1J04 A;  1AX4 A;  2V0Y A;  2VGT A;  3HL2 A;  4H63 Q;  1C7O A;  1LKC A;  3PJ0 A;  4R5F A;  2QMA A;  3FQA A;  1E5E A;  3EI9 A;  3JZL A;  4F4E A;  4JEW A;  1ASF A;  1CJ0 A;  2OAT A;  1WYU B;  3JWA A;  2AEU A;  4J5U A;  3N4R A;  2VMZ A;  1M7Y A;  4MQR A;  3E9K A;  3TFU A;  2G7J A;  5E4Z A;  3MAU A;  1RV3 A;  3USF A;  3WCN A;  1S06 A;  3BWN C;  1AY5 A;  2ZSL A;  4OBU A;  1PMM A;  2TPL A;  1T3I A;  3FZ7 A;  4XJL A;  4BQ0 A;  1XI9 A;  2WK9 A;  3DR4 A;  4XJP A;  3FFH A;  1C7G A;  1TAR A;  2AY3 A;  4IX8 A;  4JF1 A;  1JG8 A;  3AEJ C;  3II0 A;  3MAF B;  4K2M A;  3UE8 A;  3MAD A;  5F9S A;  3F6T A;  3WZF A;  3E2F A;  4Q6R A;  2QSR A;  5DX5 A;  3EZ1 A;  5E3K A;  2W8J A;  3FQ8 A;  3W1J A;  1VP4 A;  3M5U A;  4W1V A;  4WLH A;  2WB6 A;  1I43 A;  3AEN B;  1OHY A;  2AY2 A;  4CXQ A;  4P3M A;  1PG8 A;  4JE5 A;  1BJW A;  1GEX A;  2FNI A;  2F8J A;  3GR9 A;  3VOM A;  2VI8 A;  1CS1 A;  1AMS A;  2AY4 A;  2DGK A;  1CL1 A;  2WK8 A;  1DTY A;  4RIT A;  2X5D A;  3K28 A;  3QPG A;  4BMK A;  4ZDO A;  3MEB A;  1ARI A;  2BYJ A;  2VGV A;  3EZS A;  3BB8 A;  1WYV B;  4ITG A;  1YJS A;  4LNM A;  1MLY A;  3KGW A;  2CTZ A;  2X3L A;  3H9X A;  1DFO A;  5J8Q A;  4U1T A;  1QGN A;  3B8X A;  2AY1 A;  3E6G A;  3D6K A;  5DJ9 A;  4B9B A;  4OC9 A;  1YIZ A;  2CJD A;  2Z20 A;  4WD2 A;  3E2Y A;  4FFC A;  2ZY4 A;  3I16 A;  1AHG A;  1LK9 A;  1UU2 A;  1BJN A;  2OGE A;  3NTJ A;  1JF9 A;  3E77 A;  3EI8 A;  1C7N A;  4MY5 A;  3AOV A;  4DBC A;  3MKJ A;  3ISL A;  3FD0 A;  2W8T A;  4F5G A;  3N4X A;  2PO3 A;  5G2P A;  2JJH A;  1QJ5 A;  2ZSM A;  3CBF A;  1N2T A;  1DGD A;  2CST A;  1GEY A;  1SZU A;  1TOI A;  3IF2 A;  2FKI A;  2HUF A;  2BYL A;  3LVL B;  4WYE A;  3FZ8 A;  5EIG B;  1O4S A;  3FDD A;  3P1T A;  2JJE A;  1N8P A;  1GDE A;  1YJY A;  3OP7 A;  2JG2 A;  3IHJ A;  3AAT A;  2Z9X A;  2JIS A;  4RKD A;  3R4T A;  5DJ1 A;  3FVS A;  1LW5 A;  3ATH A;  5D95 A;  2W8U A;  2EH6 A;  5LHA A;  2C81 A;  1SVV A;  4WYA A;  4A6U A;  4BA4 A;  5M4B A;  1DJE A;  2EYQ A;  3JTX A;  1D7U A;  4ADC A;  1KMK A;  3NX3 A;  2R2N A;  4ADB A;  5EFS A;  1MGV A;  1V2E A;  1SF2 A;  3Q8N A;  1BQA A;  3T32 A;  5F8V A;  2Z9U A;  1TOK A;  4OBV A;  2W7I A;  1QIR A;  1G4X A;  3QBO A;  4R8D A;  1IJI A;  4IXZ A;  2EGY A;  3EIA A;  4LW2 A;  3CQ5 A;  1LW4 A;  1QJ3 A;  2W7G A;  4A00 A;  1S0A A;  5K8B A;  3A2B A;  1VJO A;  1WYT A;  4KXK A;  3PD6 A;  4AOA A;  3E2Z B;  1MAP A;  4ZDL A;  1G7X A;  1B9I A;  2C44 A;  2RFV A;  4EB7 A;  3N7N A;  3RI6 A;  5EAA A;  1QIS A;  1QIT A;  1W23 A;  3LVJ A;  1MDO A;  4A0H A;  1XEY A;  2QBT A;  2CFB A;  4OCA A;  2HP2 A;  1WKH A;  2VMY A;  2D64 A;  1DJ9 A;  2R5C B;  3HMU A;  3COG A;  5IWQ A;  1S07 A;  3VAX A;  4A0R A;  3G8M A;  3FCR A;  3UAK A;  4WXG A;  4JF0 A;  3W1I A;  3JWB A;  1V72 A;  3UWC A;  3K7Y A;  3HLM A;  2W7M A;  5EAV A;  2BHX A;  4AO4 A;  2OKK A;  3RUY A;  3GSB A;  3QGU A;  5BJ4 A;  4M2M A;  1QZ9 A;  3BCB A;  3GZD A;  1M0N A;  3DR7 A;  2GMS A;  1O61 A;  1KMJ A;  2ORD A;  4WYF A;  3RBF A;  3FQ7 A;  4IXS A;  1AMA A;  4ZSW A;  2QLR A;  2NMP A;  1O62 A;  3WKS A;  4DQ6 A;  2BI9 A;  1GC3 A;  2D7Y A;  3B46 A;  4F5K A;  1CL2 A;  1WYV A;  4TMR A;  5M49 A;  3PDB A;  1CQ6 A;  1TOE A;  2VMP A;  2CIN A;  1OHW A;  1D7S A;  2BWP A;  2W8V A;  2AAT A;  1B5O A;  3DOD A;  2VMN A;  3FFR A;  1UU1 A;  4XJM A;  4K2B A;  3A9Z A;  4WXF A;  3DC1 A;  3GZD C;  5AX8 A;  2W7H A;  3WGC A;  3I5T A;  4IYO B;  1IAX A;  1BJO A;  2DOU A;  4UOY A;  2E54 A;  3AOW A;  1V2F A;  2HOX A;  4RJ0 A;  5LH9 A;  1ASN A;  2OKJ A;  2VLF A;  4IW7 A;  4F5I A;  1KL1 A;  3OKS A;  3CQ6 A;  5C6U A;  4EFF A;  3N75 A;  2WK7 A;  1H0C A;  1WST A;  2FQ6 A;  3TAT A;  5FT4 A;  1V2D A;  2C0R A;  4WB0 A;  3WKR A;  2CH2 A;  1DKA A;  4KAM A;  1C4K A;  4UHM A;  3DRD A;  2VI9 A;  4XJO A;  4E3R A;  4GE7 A;  2BIG A;  3HQT A;  1AJS B;  1LC5 A;  3NUB A;  3NU7 A;  3RBL A;  4A0G A;  3NUI A;  3HT4 A;  2ZYJ A;  4BA5 A;  4XAU A;  4WYG A;  4GSA A;  3RQ1 A;  4WP0 A;  1MDX A;  2VMX A; 
#chains in the Genus database with same CATH homology
 4TV7 A;  1RVU A;  4I8A A;  1SPA A;  5BJ3 A;  1IX6 A;  2D5Y A;  2Z67 A;  1O69 A;  5G2Q A;  1TAT A;  3RCH B;  3GBX A;  2E7J A;  4UQV A;  1AHX A;  3GZC A;  4GEB A;  4A72 A;  4B98 A;  4ADD A;  2ZP7 A;  2E7U A;  3BN1 A;  2GSA A;  3LG0 A;  3DU4 A;  1M0O A;  4ATQ A;  3GJU A;  4A6R A;  2VMV A;  3BWO A;  5EUN A;  2GQN A;  7AAT A;  2VGW A;  1AIB A;  3ASB A;  2BWO A;  1AMQ A;  3NYU A;  5EUE A;  1B9H A;  1CQ8 A;  2AEV A;  2YHK A;  3G0T A;  3KE3 A;  4WLJ A;  4ZM4 A;  5M4D A;  3A8U X;  3ZRR A;  4WYC A;  3MC6 A;  2W7L A;  1YIY A;  3ASA A;  4MQP A;  3B1C A;  1ASE A;  2GB3 A;  3A9X A;  1GC2 A;  3NNK A;  8AAT A;  2QB3 A;  1Z7D A;  2YKX A;  2EZ2 A;  1S08 A;  2AY9 A;  2DR1 A;  3EUC A;  3E2Z A;  4JEV A;  4AZJ A;  2E7I A;  1BQD A;  1ZOD A;  2FYF A;  1ASL A;  5FT5 A;  1EQB A;  1AJR A;  4Q76 A;  1M0P A;  2VGU A;  1P3W A;  3KGX A;  3NYT A;  3VK2 A;  2YCP A;  4H51 A;  2CY8 A;  4L0O A;  4XQ2 A;  3G7Q A;  3NU8 A;  3PAA A;  4ZSY A;  4ZWM A;  3P6K A;  2ZY3 A;  1OAT A;  3MC6 C;  4Y0D A;  1W3U A;  1I41 A;  3AEP A;  1ASD A;  3NYS A;  4GE4 A;  3WY7 A;  2ZY2 A;  4OT8 A;  1BKG A;  1ART A;  1AHF A;  2WKA A;  2O1B A;  4MKK A;  1LC7 A;  2PB2 A;  2XH1 A;  1TAS A;  3DYD A;  3JU7 A;  4A0F A;  1KL2 A;  1ZOB A;  1AIA A;  1LS3 A;  3TQX A;  5M46 A;  4O6Z A;  1IX7 A;  2YKU A;  1WYU A;  2A1V A;  3FKD A;  2QA3 A;  1CQ7 A;  1GEW A;  3PIU A;  4W8I A;  5EQC A;  2CJG A;  1YJZ A;  1Z3Z A;  2VGS A;  3AEL A;  4GE9 A;  3FTB A;  2FM1 A;  4EMY A;  2G6W A;  3FSL A;  3CQ4 A;  3ELE A;  1G7W A;  3VP6 A;  3I4J A;  3EI7 A;  2ZUK A;  5HXX A;  4ZAS A;  3ACZ A;  1D7V A;  2Z1Y A;  3MAF A;  1N31 A;  1ASC A;  3JW9 A;  1PFF A;  3PA9 A;  4GRX A;  3W1H A;  4IY7 A;  1IBJ A;  3DXW A;  4PFF A;  2VIB A;  1GC4 A;  3AEM A;  2DGM A;  2VMW A;  4CVQ A;  3AEN A;  3QI6 A;  3PGY A;  3A9Y A;  3WLX A;  3TFT A;  3BCA A;  1B4X A;  4JEZ A;  3CAI A;  1E5F A;  1J32 A;  1MAQ A;  3AEO A;  1D2F A;  3QHX A;  1JS3 A;  1YNU A;  2BKW A;  4RIZ A;  1FG7 A;  3HBX A;  4LNL A;  4AH3 A;  3NRA A;  4LC3 A;  1ELQ A;  4JE5 D;  3F9T A;  4M2K A;  4PIW A;  2D61 A;  5G09 A;  1GD9 A;  3AEM C;  4KYO A;  4AZK A;  2YRR A;  4W5K A;  5DB5 A;  2CAN A;  2O7C A;  4Q31 A;  2GMU A;  4F5J A;  2HUI A;  3LY1 A;  1W7N A;  4E3Q A;  1BT4 A;  1SFF A;  1AKA A;  4N0B A;  3ZRP A;  2Z9V A;  3LVM A;  4MGR A;  3H7F A;  1AAW A;  3AEJ A;  1CZE A;  3N0L A;  2D63 A;  1OXO A;  1X29 A;  1LC8 A;  4ZM3 A;  1WYT B;  3EIB A;  4EB5 A;  1X0M A;  1Y4I A;  2BIA A;  3PD6 B;  3R9A A;  4CXR A;  2VLH A;  1JS6 A;  1CZC A;  1AMR A;  5TF5 A;  3GET A;  4W1W A;  2VMO A;  2CH1 A;  4BHD A;  2BI3 A;  2O0R A;  4J8L A;  2VYC A;  2VIA A;  5EIG A;  9AAT A;  1WKG A;  2CB1 A;  1IUG A;  1TPL A;  1D7R A;  3ELP A;  1DGE A;  2BI1 A;  1YAA A;  1FG3 A;  3QM2 A;  3NDN A;  1VEF A;  1SZS A;  1BJ4 A;  1B8G A;  3GWP A;  1M6S A;  3AV7 A;  3K40 A;  1AHE A;  4F5F A;  4LNJ A;  1X2A A;  2QB2 A;  3BV0 A;  4RAE A;  4ISY A;  2BI2 A;  2D66 A;  1OHV A;  2HZP A;  3ZZJ A;  5I92 A;  1GCK A;  2XBN A;  2X5F A;  2VMU A;  4ZLV A;  2HUU A;  4CBR A;  4MKJ A;  4XK1 A;  1I48 A;  1ASM A;  1S09 A;  1ARG A;  4FL0 A;  4RKC A;  2AY7 A;  4HVK A;  2EPJ A;  4MSO A;  2BI5 A;  2HP1 A;  2JJF A;  4GDY A;  1C0N A;  4IXO A;  2VGZ A;  5G4I A;  1ARS A;  1AKC A;  1W7M A;  2FN6 A;  2W7J A;  1IVR A;  3PDB B;  4PVF A;  5FT6 A;  4CBS A;  4ZDP A;  2DGL A;  4F5H A;  3EI6 A;  3PPL A;  3EI5 A;  5FT8 A;  4ADE A;  4RLG A;  3B1E A;  4JEX A;  2BWN A;  1AKB A;  1GC0 A;  1ZC9 A;  3N5M A;  5E5I A;  4ZWV A;  1BJO B;  1BW0 A;  2ZC0 A;  1EG5 A;  4PFN A;  2D65 A;  4M2J A;  2HOR A;  2X8U A;  1IX8 A;  1ASG A;  2OGA A;  3MBB A;  2R5C A;  1ORD A;  2W7D A;  4F5M A;  3LVK A;  3LV2 A;  4ZAH A;  5EUD A;  1X28 A;  2YCT A;  2YKY A;  3F0H A;  1M0Q A;  4QGR A;  2EO5 A;  1C9C A;  3H14 A;  1FC4 A;  1UKJ A;  1DJU A;  2Z9W A;  4JEY A;  4U2H A;  2YKV A;  1M4N A;  4WB0 B;  1TOG A;  2Z1Z A;  4RM1 A;  1W7L A;  2R5E A;  3ZRQ A;  1B5P A;  1ECX A;  1EJI A;  4TN4 A;  4NOG A;  3WGB A;  5HHY A;  5D5S A;  2OQX A;  3ZZK A;  3FDB A;  1MLZ A;  3FVU A;  2R0T A;  1ASB A;  5JAY A;  5KTB A;  4OTL A;  1SZK A;  3FZ6 A;  2VMQ A;  5G0A A;  2JGT A;  3HVY A;  3TCM A;  1RV4 A;  3BC8 A;  2VMR A;  4R2N A;  2AY5 A;  4RJY A;  2HOY A;  3PDX A;  4E77 A;  2W7E A;  1KKJ A;  2YOB A;  1ELU A;  1I29 A;  1MDZ A;  1KKP A;  4K2I A;  4XEW A;  4AO9 A;  2KFP A;  2W7K A;  4MQQ A;  3HDO A;  2HOZ A;  3BCX A;  4EU1 A;  2AY6 A;  2YRI A;  4Y0I A;  4K05 A;  1UU0 A;  2Z61 A;  4R5Z A;  3WX9 A;  4IYO A;  3QN6 A;  1YOO A;  4WXB A;  2V1P A;  3VK3 A;  3VK4 A;  1RVY A;  1AY4 A;  2W7F A;  3LWS A;  1AIC A;  2DKB A;  1AHY A;  4UHO A;  4W1X A;  4WBT A;  1M32 A;  4UHN A;  3DZZ A;  3DXV A;  2Q7W A;  4N0W A;  4OMA A;  3WCO A;  2JJG A;  1U08 A;  4LW4 A;  4DGT A;  2D7Z A;  3B1D A;  4E1O A;  2DKJ A;  2W8W A;  2AY8 A;  4HF8 A;  3ECD A;  1AJS A;  3FVX A;  5HDM A;  2C7T A;  3L8A A;  4F5L A;  2ZY5 A;  4A6T A;  2EZ1 A;  1PMO A;  1G4V A;  1TOJ A;  2BIE A;  3KKI A;  3N4S A;  4P7Y A;  1GBN A;  1OXP A;  2PB0 A;  2YCN A;  2VMS A;  2FNU A;  4Q75 A;  1BS0 A;  4W91 A;  1AY8 A;  3BS8 A;  2CJH A;  4OYT A;  3BWN A;  2ZJG A;  4WYD A;  1ARH A;  1H1C A;  1AAM A;  1IAY A;  1ASA A;  3FRK A;  2VMT A;  3L44 A;  4ITX A;  3RCH A;  4ATP A;  4Y0H A;  5G4J A;  1J04 A;  1AX4 A;  2V0Y A;  2VGT A;  3HL2 A;  4H63 Q;  1C7O A;  1LKC A;  3PJ0 A;  4R5F A;  2QMA A;  3FQA A;  1E5E A;  3EI9 A;  3JZL A;  4F4E A;  4JEW A;  1ASF A;  1CJ0 A;  2OAT A;  1WYU B;  3JWA A;  2AEU A;  4J5U A;  3N4R A;  2VMZ A;  1M7Y A;  4MQR A;  3E9K A;  3TFU A;  2G7J A;  5E4Z A;  3MAU A;  1RV3 A;  3USF A;  3WCN A;  1S06 A;  3BWN C;  1AY5 A;  2ZSL A;  4OBU A;  1PMM A;  2TPL A;  1T3I A;  3FZ7 A;  4XJL A;  4BQ0 A;  1XI9 A;  2WK9 A;  3DR4 A;  4XJP A;  3FFH A;  1C7G A;  1TAR A;  2AY3 A;  4IX8 A;  4JF1 A;  1JG8 A;  3AEJ C;  3II0 A;  3MAF B;  4K2M A;  3UE8 A;  3MAD A;  5F9S A;  3F6T A;  3WZF A;  3E2F A;  4Q6R A;  2QSR A;  5DX5 A;  3EZ1 A;  5E3K A;  2W8J A;  3FQ8 A;  3W1J A;  1VP4 A;  3M5U A;  4W1V A;  4WLH A;  2WB6 A;  1I43 A;  3AEN B;  1OHY A;  2AY2 A;  4CXQ A;  4P3M A;  1PG8 A;  4JE5 A;  1BJW A;  1GEX A;  2FNI A;  2F8J A;  3GR9 A;  3VOM A;  2VI8 A;  1CS1 A;  1AMS A;  2AY4 A;  2DGK A;  1CL1 A;  2WK8 A;  1DTY A;  4RIT A;  2X5D A;  3K28 A;  3QPG A;  4BMK A;  4ZDO A;  3MEB A;  1ARI A;  2BYJ A;  2VGV A;  3EZS A;  3BB8 A;  1WYV B;  4ITG A;  1YJS A;  4LNM A;  1MLY A;  3KGW A;  2CTZ A;  2X3L A;  3H9X A;  1DFO A;  5J8Q A;  4U1T A;  1QGN A;  3B8X A;  2AY1 A;  3E6G A;  3D6K A;  5DJ9 A;  4B9B A;  4OC9 A;  1YIZ A;  2CJD A;  2Z20 A;  4WD2 A;  3E2Y A;  4FFC A;  2ZY4 A;  3I16 A;  1AHG A;  1LK9 A;  1UU2 A;  1BJN A;  2OGE A;  3NTJ A;  1JF9 A;  3E77 A;  3EI8 A;  1C7N A;  4MY5 A;  3AOV A;  4DBC A;  3MKJ A;  3ISL A;  3FD0 A;  2W8T A;  4F5G A;  3N4X A;  2PO3 A;  5G2P A;  2JJH A;  1QJ5 A;  2ZSM A;  3CBF A;  1N2T A;  1DGD A;  2CST A;  1GEY A;  1SZU A;  1TOI A;  3IF2 A;  2FKI A;  2HUF A;  2BYL A;  3LVL B;  4WYE A;  3FZ8 A;  5EIG B;  1O4S A;  3FDD A;  3P1T A;  2JJE A;  1N8P A;  1GDE A;  1YJY A;  3OP7 A;  2JG2 A;  3IHJ A;  3AAT A;  2Z9X A;  2JIS A;  4RKD A;  3R4T A;  5DJ1 A;  3FVS A;  1LW5 A;  3ATH A;  5D95 A;  2W8U A;  2EH6 A;  5LHA A;  2C81 A;  1SVV A;  4WYA A;  4A6U A;  4BA4 A;  5M4B A;  1DJE A;  2EYQ A;  3JTX A;  1D7U A;  4ADC A;  1KMK A;  3NX3 A;  2R2N A;  4ADB A;  5EFS A;  1MGV A;  1V2E A;  1SF2 A;  3Q8N A;  1BQA A;  3T32 A;  5F8V A;  2Z9U A;  1TOK A;  4OBV A;  2W7I A;  1QIR A;  1G4X A;  3QBO A;  4R8D A;  1IJI A;  4IXZ A;  2EGY A;  3EIA A;  4LW2 A;  3CQ5 A;  1LW4 A;  1QJ3 A;  2W7G A;  4A00 A;  1S0A A;  5K8B A;  3A2B A;  1VJO A;  1WYT A;  4KXK A;  3PD6 A;  4AOA A;  3E2Z B;  1MAP A;  4ZDL A;  1G7X A;  1B9I A;  2C44 A;  2RFV A;  4EB7 A;  3N7N A;  3RI6 A;  5EAA A;  1QIS A;  1QIT A;  1W23 A;  3LVJ A;  1MDO A;  4A0H A;  1XEY A;  2QBT A;  2CFB A;  4OCA A;  2HP2 A;  1WKH A;  2VMY A;  2D64 A;  1DJ9 A;  2R5C B;  3HMU A;  3COG A;  5IWQ A;  1S07 A;  3VAX A;  4A0R A;  3G8M A;  3FCR A;  3UAK A;  4WXG A;  4JF0 A;  3W1I A;  3JWB A;  1V72 A;  3UWC A;  3K7Y A;  3HLM A;  2W7M A;  5EAV A;  2BHX A;  4AO4 A;  2OKK A;  3RUY A;  3GSB A;  3QGU A;  5BJ4 A;  4M2M A;  1QZ9 A;  3BCB A;  3GZD A;  1M0N A;  3DR7 A;  2GMS A;  1O61 A;  1KMJ A;  2ORD A;  4WYF A;  3RBF A;  3FQ7 A;  4IXS A;  1AMA A;  4ZSW A;  2QLR A;  2NMP A;  1O62 A;  3WKS A;  4DQ6 A;  2BI9 A;  1GC3 A;  2D7Y A;  3B46 A;  4F5K A;  1CL2 A;  1WYV A;  4TMR A;  5M49 A;  3PDB A;  1CQ6 A;  1TOE A;  2VMP A;  2CIN A;  1OHW A;  1D7S A;  2BWP A;  2W8V A;  2AAT A;  1B5O A;  3DOD A;  2VMN A;  3FFR A;  1UU1 A;  4XJM A;  4K2B A;  3A9Z A;  4WXF A;  3DC1 A;  3GZD C;  5AX8 A;  2W7H A;  3WGC A;  3I5T A;  4IYO B;  1IAX A;  1BJO A;  2DOU A;  4UOY A;  2E54 A;  3AOW A;  1V2F A;  2HOX A;  4RJ0 A;  5LH9 A;  1ASN A;  2OKJ A;  2VLF A;  4IW7 A;  4F5I A;  1KL1 A;  3OKS A;  3CQ6 A;  5C6U A;  4EFF A;  3N75 A;  2WK7 A;  1H0C A;  1WST A;  2FQ6 A;  3TAT A;  5FT4 A;  1V2D A;  2C0R A;  4WB0 A;  3WKR A;  2CH2 A;  1DKA A;  4KAM A;  1C4K A;  4UHM A;  3DRD A;  2VI9 A;  4XJO A;  4E3R A;  4GE7 A;  2BIG A;  3HQT A;  1AJS B;  1LC5 A;  3NUB A;  3NU7 A;  3RBL A;  4A0G A;  3NUI A;  3HT4 A;  2ZYJ A;  4BA5 A;  4XAU A;  4WYG A;  4GSA A;  3RQ1 A;  4WP0 A;  1MDX A;  2VMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...