2DGRA

Solution structure of the second kh domain in ring finger and kh domain containing protein 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
83
Chain Sequence
GSSGSSGGQTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPENVDRAREEIEAHITLRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RING finger and KH domain-containing protein 1
publication title Solution structure of the second KH domain in ring finger and KH domain containing protein 1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2dgrA01
5K36G 1DT4A 1J4WA 1ZTGA 2Z0SA 2QNDA 2NN6G 4LIJA 1ZZKA 2BL5A 2CTJA 1WVNA 4WALA 4QMFB 1ZZJA 2JZXA 4AIMA 2ANNA 2PY9A 4JVHA 2HH3A 2JE6I 1X4MA 4NBQA 3V69A 5C0XG 4BA1I 2CPQA 1X4NA 1VIGA 2OPUA 3VKEA 3AEVB 2P2RA 2PQUA 3U1KA 4OO1G 1K1GA 1DTJA 1VIHA 2YQRA 5JEAG 2HH2A 2E3UA 2ANRA 1TUAA 2MJHA 3L7ZC 1EC6A 2FMRA 2CTEA 4B8TA 2AXYA 2JA9A 2OPVA 4BA2I 4JVYA 1J5KA 4IFDG 2CTKA 2JEBI 2BA0A 4AM3A 2CTLA 2JEAI 2CTMA 2JVZA 1KHMA 2DGRA 2CTFA 1WE8A 1ZZIA 4WANA
chains in the Genus database with same CATH superfamily
3KDKA 4DR6H 2HHHH 1ZZKA 4NZRM 1IBKH 1WVNA 4WALA 1XMOH 2ANNA 2O4CA 2X06A 1HNXH 2JE6I 5C0XG 4LF8H 3UOEA 4LF7H 1IBLH 4JI8H 4DR5H 2P2RA 3U1KA 1K1GA 1VIHA 4LF6H 1I94H 2LTLA 2E3UA 4JI6H 1EC6A 5IWAH 3RF2A 4OX9H 4B8TA 2AXYA 4BA2I 5IT9W 2BA0A 4DR3H 4JYAH 1Z2IA 2CTLA 4JI4H 2JEAI 1X9ZA 2CTMA 4DUZH 4DV5H 4JI5H 1I6UA 5K36G 1DT4A 1J4WA 1ZTGA 4JI7H 4X65H 4DV7H 2A1SA 4K0KH 4OCHA 4QMFB 1ZZJA 4AIMA 4KHPH 2PY9A 4EC5A 4NBQA 1FJGH 3OTOH 4GKKH 4NXMH 3GR5A 3VKEA 2M6QA 4X62H 3AEVB 2PQUA 5LMNH 1ODHA 4PDBA 1PQXA 1DTJA 4DV6H 2LF0A 4DUYH 4H8AA 1FKAH 2UU9H 4DR1H 2UUAH 2FPHX 1UG8A 3OSSD 4X66H 5BR8H 4DR4H 2FMRA 3QD7X 2JA9A 4B8CD 4JVYA 4X64H 1J5KA 2CTKA 2JEBI 4JI2H 1KHMA 2G8YA 2K1HA 1HNZH 1ZZIA 4B3TH 2Z0SA 4NXNH 2NN6G 4B3SH 4LIJA 4DV4H 2BL5A 2CTJA 1VBIA 1V8CA 1WTJA 1IBMH 1N32H 2UXDH 2UXCH 4JI0H 2UXBH 4BA1I 3J81W 2UUBH 1X4NA 2OPUA 1X0AA 2Y3MA 2CWFA 2VQFH 4GKJH 5LL6b 4AQYH 4FJUA 1XMQH 3T1HH 5JEAG 4LFCH 4JI1H 4DV0H 1XNQH 1TUAA 3EZJA 3FAUA 5LMUH 1SEIA 1XRHA 3JAMW 2CTEA 2VKCA 2MJHA 2OPVA 1MSZA 3SB1A 1S03G 1XNRH 2VQEH 5A2QW 1N33H 2FFMA 4NZTM 3J80W 2JVZA 4LF5H 2F4VH 2DGRA 2CTFA 1WE8A 4LFBH 2CWHA 4DV2H 4WANA 1F0XA 2LTMA 2QNDA 4DR7H 4LF4H 1J5EH 1N34H 4JI3H 2JZXA 1WHRA 2E5LH 4JVHA 4JV5H 2HH3A 1X4MA 3V69A 3I0PA 4DR2H 4DV3H 2CPQA 1VIGA 4E9JA 1HR0H 3J7AK 2D9IA 2UUCH 3OETA 3GABA 4OO1G 2ZM6H 4YHHH 4B3RH 2M8WA 4LF9H 4G08A 2HH2A 2PT7G 4OD6A 3KDGA 5FLXW 3T1YH 3L7ZC 2ANRA 2LRRA 1HNWH 4FJSA 4B3MH 1NXUA 1N36H 1AN7A 4IFDG 4YY3H 3GKUA 5DT9A 4AM3A 4DV1H 4LFAH 1S20A 1V9NA 2CPMA 2ZQEA 2YQRA 3NCVA
chains in the Genus database with same CATH topology
5K36G 1DT4A 1J4WA 1ZTGA 2Z0SA 2QNDA 2NN6G 4LIJA 1ZZKA 2BL5A 2CTJA 1WVNA 4WALA 4QMFB 1ZZJA 2JZXA 4AIMA 2ANNA 2PY9A 4JVHA 2HH3A 2JE6I 1X4MA 4NBQA 3V69A 5C0XG 4BA1I 2CPQA 1X4NA 1VIGA 2OPUA 3VKEA 3AEVB 2P2RA 2PQUA 3U1KA 4OO1G 1K1GA 1DTJA 1VIHA 2YQRA 5JEAG 2HH2A 2E3UA 2ANRA 1TUAA 2MJHA 3L7ZC 1EC6A 2FMRA 2CTEA 4B8TA 2AXYA 2JA9A 2OPVA 4BA2I 4JVYA 1J5KA 4IFDG 2CTKA 2JEBI 2BA0A 4AM3A 2CTLA 2JEAI 2CTMA 2JVZA 1KHMA 2DGRA 2CTFA 1WE8A 1ZZIA 4WANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 G;  1DT4 A;  1J4W A;  1ZTG A;  2Z0S A;  2QND A;  2NN6 G;  4LIJ A;  1ZZK A;  2BL5 A;  2CTJ A;  1WVN A;  4WAL A;  4QMF B;  1ZZJ A;  2JZX A;  4AIM A;  2ANN A;  2PY9 A;  4JVH A;  2HH3 A;  2JE6 I;  1X4M A;  4NBQ A;  3V69 A;  5C0X G;  4BA1 I;  2CPQ A;  1X4N A;  1VIG A;  2OPU A;  3VKE A;  3AEV B;  2P2R A;  2PQU A;  3U1K A;  4OO1 G;  1K1G A;  1DTJ A;  1VIH A;  2YQR A;  5JEA G;  2HH2 A;  2E3U A;  2ANR A;  1TUA A;  2MJH A;  3L7Z C;  1EC6 A;  2FMR A;  2CTE A;  4B8T A;  2AXY A;  2JA9 A;  2OPV A;  4BA2 I;  4JVY A;  1J5K A;  4IFD G;  2CTK A;  2JEB I;  2BA0 A;  4AM3 A;  2CTL A;  2JEA I;  2CTM A;  2JVZ A;  1KHM A;  2DGR A;  2CTF A;  1WE8 A;  1ZZI A;  4WAN A; 
#chains in the Genus database with same CATH topology
 3KDK A;  4DR6 H;  2HHH H;  1ZZK A;  4NZR M;  1IBK H;  1WVN A;  4WAL A;  1XMO H;  2ANN A;  2O4C A;  2X06 A;  1HNX H;  2JE6 I;  5C0X G;  4LF8 H;  3UOE A;  4LF7 H;  1IBL H;  4JI8 H;  4DR5 H;  2P2R A;  3U1K A;  1K1G A;  1VIH A;  4LF6 H;  1I94 H;  2LTL A;  2E3U A;  4JI6 H;  1EC6 A;  5IWA H;  3RF2 A;  4OX9 H;  4B8T A;  2AXY A;  4BA2 I;  5IT9 W;  2BA0 A;  4DR3 H;  4JYA H;  1Z2I A;  2CTL A;  4JI4 H;  2JEA I;  1X9Z A;  2CTM A;  4DUZ H;  4DV5 H;  4JI5 H;  1I6U A;  5K36 G;  1DT4 A;  1J4W A;  1ZTG A;  4JI7 H;  4X65 H;  4DV7 H;  2A1S A;  4K0K H;  4OCH A;  4QMF B;  1ZZJ A;  4AIM A;  4KHP H;  2PY9 A;  4EC5 A;  4NBQ A;  1FJG H;  3OTO H;  4GKK H;  4NXM H;  3GR5 A;  3VKE A;  2M6Q A;  4X62 H;  3AEV B;  2PQU A;  5LMN H;  1ODH A;  4PDB A;  1PQX A;  1DTJ A;  4DV6 H;  2LF0 A;  4DUY H;  4H8A A;  1FKA H;  2UU9 H;  4DR1 H;  2UUA H;  2FPH X;  1UG8 A;  3OSS D;  4X66 H;  5BR8 H;  4DR4 H;  2FMR A;  3QD7 X;  2JA9 A;  4B8C D;  4JVY A;  4X64 H;  1J5K A;  2CTK A;  2JEB I;  4JI2 H;  1KHM A;  2G8Y A;  2K1H A;  1HNZ H;  1ZZI A;  4B3T H;  2Z0S A;  4NXN H;  2NN6 G;  4B3S H;  4LIJ A;  4DV4 H;  2BL5 A;  2CTJ A;  1VBI A;  1V8C A;  1WTJ A;  1IBM H;  1N32 H;  2UXD H;  2UXC H;  4JI0 H;  2UXB H;  4BA1 I;  3J81 W;  2UUB H;  1X4N A;  2OPU A;  1X0A A;  2Y3M A;  2CWF A;  2VQF H;  4GKJ H;  5LL6 b;  4AQY H;  4FJU A;  1XMQ H;  3T1H H;  5JEA G;  4LFC H;  4JI1 H;  4DV0 H;  1XNQ H;  1TUA A;  3EZJ A;  3FAU A;  5LMU H;  1SEI A;  1XRH A;  3JAM W;  2CTE A;  2VKC A;  2MJH A;  2OPV A;  1MSZ A;  3SB1 A;  1S03 G;  1XNR H;  2VQE H;  5A2Q W;  1N33 H;  2FFM A;  4NZT M;  3J80 W;  2JVZ A;  4LF5 H;  2F4V H;  2DGR A;  2CTF A;  1WE8 A;  4LFB H;  2CWH A;  4DV2 H;  4WAN A;  1F0X A;  2LTM A;  2QND A;  4DR7 H;  4LF4 H;  1J5E H;  1N34 H;  4JI3 H;  2JZX A;  1WHR A;  2E5L H;  4JVH A;  4JV5 H;  2HH3 A;  1X4M A;  3V69 A;  3I0P A;  4DR2 H;  4DV3 H;  2CPQ A;  1VIG A;  4E9J A;  1HR0 H;  3J7A K;  2D9I A;  2UUC H;  3OET A;  3GAB A;  4OO1 G;  2ZM6 H;  4YHH H;  4B3R H;  2M8W A;  4LF9 H;  4G08 A;  2HH2 A;  2PT7 G;  4OD6 A;  3KDG A;  5FLX W;  3T1Y H;  3L7Z C;  2ANR A;  2LRR A;  1HNW H;  4FJS A;  4B3M H;  1NXU A;  1N36 H;  1AN7 A;  4IFD G;  4YY3 H;  3GKU A;  5DT9 A;  4AM3 A;  4DV1 H;  4LFA H;  1S20 A;  1V9N A;  2CPM A;  2ZQE A;  2YQR A;  3NCV A; 
#chains in the Genus database with same CATH homology
 5K36 G;  1DT4 A;  1J4W A;  1ZTG A;  2Z0S A;  2QND A;  2NN6 G;  4LIJ A;  1ZZK A;  2BL5 A;  2CTJ A;  1WVN A;  4WAL A;  4QMF B;  1ZZJ A;  2JZX A;  4AIM A;  2ANN A;  2PY9 A;  4JVH A;  2HH3 A;  2JE6 I;  1X4M A;  4NBQ A;  3V69 A;  5C0X G;  4BA1 I;  2CPQ A;  1X4N A;  1VIG A;  2OPU A;  3VKE A;  3AEV B;  2P2R A;  2PQU A;  3U1K A;  4OO1 G;  1K1G A;  1DTJ A;  1VIH A;  2YQR A;  5JEA G;  2HH2 A;  2E3U A;  2ANR A;  1TUA A;  2MJH A;  3L7Z C;  1EC6 A;  2FMR A;  2CTE A;  4B8T A;  2AXY A;  2JA9 A;  2OPV A;  4BA2 I;  4JVY A;  1J5K A;  4IFD G;  2CTK A;  2JEB I;  2BA0 A;  4AM3 A;  2CTL A;  2JEA I;  2CTM A;  2JVZ A;  1KHM A;  2DGR A;  2CTF A;  1WE8 A;  1ZZI A;  4WAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...