2DGRA

Solution structure of the second kh domain in ring finger and kh domain containing protein 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
83
structure length
83
Chain Sequence
GSSGSSGGQTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPENVDRAREEIEAHITLRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RING finger and KH domain-containing protein 1
publication title Solution structure of the second KH domain in ring finger and KH domain containing protein 1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2dgrA01
4BA1I 1KHMA 1WVNA 4BA2I 4OO1G 2JEBI 2PY9A 2BL5A 2BA0A 2CTFA 4JVYA 1DT4A 2PQUA 1DTJA 1ZZKA 2HH3A 3VKEA 2JVZA 1K1GA 1X4NA 4NBQA 4WANA 2CPQA 2OPUA 3AEVB 2CTKA 4WALA 2JA9A 2JEAI 4LIJA 1VIHA 1ZZIA 2CTLA 4B8TA 5K36G 1VIGA 2OPVA 1WE8A 4QMFB 1TUAA 2FMRA 5JEAG 2HH2A 3V69A 1ZTGA 2ANNA 4JVHA 2Z0SA 2JZXA 2NN6G 1J5KA 2E3UA 2P2RA 2CTMA 2YQRA 2QNDA 4IFDG 3U1KA 2CTEA 3L7ZC 2CTJA 4AM3A 5C0XG 2JE6I 1X4MA 2DGRA 1J4WA 2AXYA 2ANRA 4AIMA 1ZZJA 1EC6A 2MJHA
chains in the Genus database with same CATH superfamily
2FFMA 1WVNA 1IBMH 5A2QW 1S03G 4B3SH 1AN7A 2BL5A 2CTFA 4JVYA 4LF7H 2UUBH 1ZZKA 2HH3A 4LF6H 2JVZA 3OETA 4E9JA 4WANA 4NZTM 2OPUA 5BR8H 5FLXW 2JA9A 4LIJA 2CTLA 4B8TA 5K36G 1VIGA 4QMFB 2O4CA 5JEAG 4X64H 2D9IA 4JI4H 1FJGH 4DV2H 1N33H 4X62H 1SEIA 4DV5H 1N32H 4NXMH 2CTMA 4FJSA 2QNDA 4DV7H 2UU9H 3L7ZC 3NCVA 4AM3A 4G08A 4LFCH 4JI6H 2DGRA 2E5LH 2CWFA 1J4WA 2ANRA 5DT9A 1V9NA 2CWHA 1ZZJA 4H8AA 4BA1I 1K1GA 2UUAH 4LF8H 4OX9H 4OO1G 1S20A 4DR1H 2FPHX 2PY9A 4GKKH 2HHHH 2PQUA 4B3MH 3JAMW 1X4NA 2VKCA 4NBQA 4YY3H 2CPQA 3SB1A 4DUZH 1XMOH 2CTKA 4B3TH 4LFAH 5LMNH 1HNZH 4JI7H 2LTLA 1WE8A 2K1HA 1NXUA 1J5EH 4LF4H 4DR4H 2UXBH 1WHRA 4OD6A 4DR7H 1MSZA 2JZXA 2NN6G 3KDGA 3UOEA 1J5KA 2Y3MA 1VBIA 4DUYH 1IBLH 2LF0A 2ZM6H 4NXNH 4JYAH 4DV6H 1UG8A 2JE6I 1N36H 4LF5H 1F0XA 2AXYA 2JEAI 1I94H 4K0KH 3T1YH 3J7AK 4DR2H 5IWAH 4BA2I 2X06A 2JEBI 3J80W 1X0AA 2BA0A 1XMQH 4JI2H 3GABA 4DR5H 1I6UA 4JI3H 3I0PA 4X66H 1HNWH 4DV1H 4DR3H 4PDBA 3QD7X 4B8CD 4FJUA 4WALA 3OTOH 1PQXA 2ZQEA 1TUAA 4DV0H 1ZTGA 2HH2A 3V69A 4YHHH 1HR0H 2ANNA 4DR6H 4DV3H 4OCHA 2E3UA 4EC5A 2P2RA 1IBKH 4NZRM 3U1KA 1XNRH 2CTJA 1V8CA 5IT9W 4GKJH 4DV4H 3T1HH 1KHMA 1XNQH 2F4VH 2MJHA 1EC6A 2PT7G 4AQYH 4JI0H 4JV5H 1ODHA 4JI1H 4B3RH 2G8YA 4X65H 2UXCH 1DT4A 2VQEH 1DTJA 3VKEA 2A1SA 4KHPH 2UXDH 4JI5H 2M8WA 3AEVB 4LF9H 1VIHA 2LRRA 3GKUA 5LL6b 1ZZIA 4LFBH 1XRHA 2OPVA 3KDKA 5LMUH 2FMRA 1WTJA 2LTMA 4JI8H 4JVHA 3EZJA 2Z0SA 2UUCH 1X9ZA 2YQRA 1N34H 1FKAH 4IFDG 2VQFH 2CTEA 1HNXH 1Z2IA 5C0XG 3FAUA 3RF2A 2M6QA 3J81W 1X4MA 2CPMA 4AIMA 3GR5A 3OSSD
chains in the Genus database with same CATH topology
4BA1I 1KHMA 1WVNA 4BA2I 4OO1G 2JEBI 2PY9A 2BL5A 2BA0A 2CTFA 4JVYA 1DT4A 2PQUA 1DTJA 1ZZKA 2HH3A 3VKEA 2JVZA 1K1GA 1X4NA 4NBQA 4WANA 2CPQA 2OPUA 3AEVB 2CTKA 4WALA 2JA9A 2JEAI 4LIJA 1VIHA 1ZZIA 2CTLA 4B8TA 5K36G 1VIGA 2OPVA 1WE8A 4QMFB 1TUAA 2FMRA 5JEAG 2HH2A 3V69A 1ZTGA 2ANNA 4JVHA 2Z0SA 2JZXA 2NN6G 1J5KA 2E3UA 2P2RA 2CTMA 2YQRA 2QNDA 4IFDG 3U1KA 2CTEA 3L7ZC 2CTJA 4AM3A 5C0XG 2JE6I 1X4MA 2DGRA 1J4WA 2AXYA 2ANRA 4AIMA 1ZZJA 1EC6A 2MJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA1 I;  1KHM A;  1WVN A;  4BA2 I;  4OO1 G;  2JEB I;  2PY9 A;  2BL5 A;  2BA0 A;  2CTF A;  4JVY A;  1DT4 A;  2PQU A;  1DTJ A;  1ZZK A;  2HH3 A;  3VKE A;  2JVZ A;  1K1G A;  1X4N A;  4NBQ A;  4WAN A;  2CPQ A;  2OPU A;  3AEV B;  2CTK A;  4WAL A;  2JA9 A;  2JEA I;  4LIJ A;  1VIH A;  1ZZI A;  2CTL A;  4B8T A;  5K36 G;  1VIG A;  2OPV A;  1WE8 A;  4QMF B;  1TUA A;  2FMR A;  5JEA G;  2HH2 A;  3V69 A;  1ZTG A;  2ANN A;  4JVH A;  2Z0S A;  2JZX A;  2NN6 G;  1J5K A;  2E3U A;  2P2R A;  2CTM A;  2YQR A;  2QND A;  4IFD G;  3U1K A;  2CTE A;  3L7Z C;  2CTJ A;  4AM3 A;  5C0X G;  2JE6 I;  1X4M A;  2DGR A;  1J4W A;  2AXY A;  2ANR A;  4AIM A;  1ZZJ A;  1EC6 A;  2MJH A; 
#chains in the Genus database with same CATH topology
 2FFM A;  1WVN A;  1IBM H;  5A2Q W;  1S03 G;  4B3S H;  1AN7 A;  2BL5 A;  2CTF A;  4JVY A;  4LF7 H;  2UUB H;  1ZZK A;  2HH3 A;  4LF6 H;  2JVZ A;  3OET A;  4E9J A;  4WAN A;  4NZT M;  2OPU A;  5BR8 H;  5FLX W;  2JA9 A;  4LIJ A;  2CTL A;  4B8T A;  5K36 G;  1VIG A;  4QMF B;  2O4C A;  5JEA G;  4X64 H;  2D9I A;  4JI4 H;  1FJG H;  4DV2 H;  1N33 H;  4X62 H;  1SEI A;  4DV5 H;  1N32 H;  4NXM H;  2CTM A;  4FJS A;  2QND A;  4DV7 H;  2UU9 H;  3L7Z C;  3NCV A;  4AM3 A;  4G08 A;  4LFC H;  4JI6 H;  2DGR A;  2E5L H;  2CWF A;  1J4W A;  2ANR A;  5DT9 A;  1V9N A;  2CWH A;  1ZZJ A;  4H8A A;  4BA1 I;  1K1G A;  2UUA H;  4LF8 H;  4OX9 H;  4OO1 G;  1S20 A;  4DR1 H;  2FPH X;  2PY9 A;  4GKK H;  2HHH H;  2PQU A;  4B3M H;  3JAM W;  1X4N A;  2VKC A;  4NBQ A;  4YY3 H;  2CPQ A;  3SB1 A;  4DUZ H;  1XMO H;  2CTK A;  4B3T H;  4LFA H;  5LMN H;  1HNZ H;  4JI7 H;  2LTL A;  1WE8 A;  2K1H A;  1NXU A;  1J5E H;  4LF4 H;  4DR4 H;  2UXB H;  1WHR A;  4OD6 A;  4DR7 H;  1MSZ A;  2JZX A;  2NN6 G;  3KDG A;  3UOE A;  1J5K A;  2Y3M A;  1VBI A;  4DUY H;  1IBL H;  2LF0 A;  2ZM6 H;  4NXN H;  4JYA H;  4DV6 H;  1UG8 A;  2JE6 I;  1N36 H;  4LF5 H;  1F0X A;  2AXY A;  2JEA I;  1I94 H;  4K0K H;  3T1Y H;  3J7A K;  4DR2 H;  5IWA H;  4BA2 I;  2X06 A;  2JEB I;  3J80 W;  1X0A A;  2BA0 A;  1XMQ H;  4JI2 H;  3GAB A;  4DR5 H;  1I6U A;  4JI3 H;  3I0P A;  4X66 H;  1HNW H;  4DV1 H;  4DR3 H;  4PDB A;  3QD7 X;  4B8C D;  4FJU A;  4WAL A;  3OTO H;  1PQX A;  2ZQE A;  1TUA A;  4DV0 H;  1ZTG A;  2HH2 A;  3V69 A;  4YHH H;  1HR0 H;  2ANN A;  4DR6 H;  4DV3 H;  4OCH A;  2E3U A;  4EC5 A;  2P2R A;  1IBK H;  4NZR M;  3U1K A;  1XNR H;  2CTJ A;  1V8C A;  5IT9 W;  4GKJ H;  4DV4 H;  3T1H H;  1KHM A;  1XNQ H;  2F4V H;  2MJH A;  1EC6 A;  2PT7 G;  4AQY H;  4JI0 H;  4JV5 H;  1ODH A;  4JI1 H;  4B3R H;  2G8Y A;  4X65 H;  2UXC H;  1DT4 A;  2VQE H;  1DTJ A;  3VKE A;  2A1S A;  4KHP H;  2UXD H;  4JI5 H;  2M8W A;  3AEV B;  4LF9 H;  1VIH A;  2LRR A;  3GKU A;  5LL6 b;  1ZZI A;  4LFB H;  1XRH A;  2OPV A;  3KDK A;  5LMU H;  2FMR A;  1WTJ A;  2LTM A;  4JI8 H;  4JVH A;  3EZJ A;  2Z0S A;  2UUC H;  1X9Z A;  2YQR A;  1N34 H;  1FKA H;  4IFD G;  2VQF H;  2CTE A;  1HNX H;  1Z2I A;  5C0X G;  3FAU A;  3RF2 A;  2M6Q A;  3J81 W;  1X4M A;  2CPM A;  4AIM A;  3GR5 A;  3OSS D; 
#chains in the Genus database with same CATH homology
 4BA1 I;  1KHM A;  1WVN A;  4BA2 I;  4OO1 G;  2JEB I;  2PY9 A;  2BL5 A;  2BA0 A;  2CTF A;  4JVY A;  1DT4 A;  2PQU A;  1DTJ A;  1ZZK A;  2HH3 A;  3VKE A;  2JVZ A;  1K1G A;  1X4N A;  4NBQ A;  4WAN A;  2CPQ A;  2OPU A;  3AEV B;  2CTK A;  4WAL A;  2JA9 A;  2JEA I;  4LIJ A;  1VIH A;  1ZZI A;  2CTL A;  4B8T A;  5K36 G;  1VIG A;  2OPV A;  1WE8 A;  4QMF B;  1TUA A;  2FMR A;  5JEA G;  2HH2 A;  3V69 A;  1ZTG A;  2ANN A;  4JVH A;  2Z0S A;  2JZX A;  2NN6 G;  1J5K A;  2E3U A;  2P2R A;  2CTM A;  2YQR A;  2QND A;  4IFD G;  3U1K A;  2CTE A;  3L7Z C;  2CTJ A;  4AM3 A;  5C0X G;  2JE6 I;  1X4M A;  2DGR A;  1J4W A;  2AXY A;  2ANR A;  4AIM A;  1ZZJ A;  1EC6 A;  2MJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...