2DGTA

Solution structure of the second rna binding domain in rna-binding protein 30
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'GSSGSSGKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 30
publication title Solution structure of the second RNA binding domain in RNA-binding protein 30
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dgtA01
2DNGA 1KQSR 2MKSA 2HGLA 2LEAA 2LA4A 2XS7A 3H2UB 2KHCA 1U1PA 3R1HA 2SXLA 1ZH5A 3CC2S 2HYIB 1X4AA 2MKJA 2OSQA 2BOPA 3CTRA 2DHXA 1H2UX 2X1FA 1VQPS 3PIPQ 2X1GA 3SDEB 2J76E 1XN9A 3B4DA 5GAGU 3VAGA 2KFYA 1F9FA 1VQ4S 2VONA 2QEXS 4Z2XA 2J8AA 4OZ0A 5CYJA 2XB2D 5IM0A 3MI7X 3CCLS 3P6YC 2MYFA 1X4DA 1BY9A 3BO2A 2BZ2A 4TLQA 2DISA 4QU6A 1RKJA 2CQDA 2LEBA 5GAEU 1VQOS 1X5PA 3UWTA 3VAIA 2FHOB 2LECA 2PEHA 2DNKA 1UP1A 3P49B 3ZZZA 2XS2A 3Q2TC 4FXWA 1N54B 2DO4A 2CQ0A 2DB1A 2DITA 1QVFR 2MSSA 4IO9Q 5LSOA 1WI6A 2KH9A 2WBRA 1DZ5A 2Q79A 1JJ4A 1B7FA 1JJ2R 1A9NB 2MQPA 2RRAA 4UY8T 1CVJA 2DO0A 3B4MA 1YWXA 2MKHA 4YOEA 2KT5A 3BEGB 3VAHA 2CPEA 1AUDA 5IFMA 1WF0A 4WF9Q 4ZKAA 2B0GA 3CC4S 2G1DA 3BS9A 2MZQA 2M7SA 4LJMA 1WI8A 3HHNB 1X0FA 1NO8A 3PIOQ 5FJ4A 1S72S 2ZJQQ 5HO4A 2DNRA 4FXVA 3SMZA 1FO1A 1VQ8S 2DHSA 2JX2A 1FNXH 2DGQA 2D9PA 3NNAA 1YJ9S 2RQ4A 2MY8A 1QVGR 5GMKa 3CPWR 5D78A 3LQVA 3G9CA 2M9KA 3CF5Q 2E5GA 2DIVA 2LXUA 3THPA 3MUTP 4V19X 2MKKA 3J7ZT 2AYMA 4WFNQ 1M5VC 2MHNA 2PE8A 5GADU 5DM6Q 1SJQA 4YB1P 2G4BA 2DIUA 3D2WA 2I2YA 5H1SV 4PKDB 2XNRA 1VQ6S 3MXHP 1U6FA 1U1RA 2MB0B 1G2EA 3US5A 2CPXA 5CXTA 2MJNA 2CQ1A 1WTBA 1VBXA 3TP2A 4ED5A 2DHGA 1VBYA 2KM8C 1YIJS 3S01A 1X4EA 2DH9A 2DHAA 1K73T 3CC7S 2LCWA 1SJRA 1YHQS 3THTA 3ZZYA 5BJRA 1D8ZA 3VAJA 3R1LA 3JB9k 3NNHA 2CPJA 3FEYB 4Y00A 1X5TA 5DDQC 1U1NA 1WEYA 2DNNA 2KVIA 2M8HA 1U6BA 2DGTA 2G0CA 1U1LA 4F26A 1FXLA 3LPYA 2DNQA 1KOOA 2KM8B 2DGXA 2E5JA 2A3JA 3I55S 1FJEB 2J0QD 3P5TL 1VQ9S 3MOJB 2E5HA 1WHWA 4TU9A 2OTJS 2M8DB 1WHXA 2NLWA 1VC0A 3UE2A 4CH0S 3S7RA 2E5IA 1KC8T 1H2TZ 4LMZA 1PO6A 3ULHA 4C4WA 3L3CA 4EGLA 3U1MA 1VQKS 4P6QA 2QA4S 5DDPC 2MQOA 1WHYA 2DNPA 4IOAQ 2M52A 2ERRA 3G4SS 1N88A 3CULA 2MZTA 3CCMS 4BS2A 4QQBA 5LSLA 3NNCA 2EK1A 4TU8A 1VC6A 2CQPA 1YJWS 1D9AA 2F9JA 3NS5A 2CQ4A 2YH1A 4UQTA 2KRRA 1U1QA 2DK2A 1M5KC 2VOPA 2MPUA 2FY1A 2DNZA 2MJUA 1OO0B 1SXLA 3UD4P 1VQMS 1WELA 2OTLS 2RNEA 2MZ1A 1KD1T 3CCQS 3G8TA 2MQNA 1HA1A 5DM7Q 2HVZA 2X1BA 2VODA 2UP1A 2RT3A 1IQTA 2RVJA 5LXYA 2L9WA 1NJIT 1N52B 1WHVA 2ADCA 2HZCA 4WIIA 3VAMA 3UCZP 5JVGQ 1WG1A 3CCJS 2KYXA 2D3OR 5LXRA 4WFAQ 2U2FA 5D77A 1X4BA 1PGZA 1L3KA 1O0PA 1U2FA 2CQCA 1YTYA 2JWNA 1HL6A 2LYVA 2YH0A 1YJNS 2KG1A 1Q86T 3DLLQ 2U1AA 4CIOA 2MY7A 1JJHA 2MQQA 3SDEA 2N3LA 3UCGA 1OWXA 1X4FA 2XSFA 3HI9A 4Y0FA 5DDRC 3VALA 2N3OA 3S6EA 2EVZA 2CQGA 2DGSA 2MMYA 3CUNA 5IM0B 2CQBA 1HD1A 1WG5A 2DH8A 4PRFA 3I56S 4PR6A 2DGOA 2FC8A 2DH7A 2CPYA 2VOOA 2LMIA 2ZJRQ 1U1MA 2ADBA 2N7CA 2JVRA 1FJCA 1X5OA 2DNLA 4QPTA 2K8GA 2HGNA 2DNOA 5IQQA 1JMTA 1FT8A 1R8HA 1K8AT 2KU7A 1RK8A 3IRWP 3VAFA 3G71S 2YTCA 1DBDA 2HGMA 1X5SA 2MGZA 1YITS 2L08A 3CMES 2F9DA 2MKIA 1UFWA 3RW7A 2MZRA 1M1KT 1WWHA 3CCUS 3NMRA 4WCEQ 2CJKA 1X4CA 5CA5A 2KRBA 3EX7B 2FPHX 3R27A 2CQIA 3CD6S 2MQLA 2OIHA 4CH1A 3UD3P 4ERDA 2JRSA 2L41A 3UCUP 1QM9A 4RU2A 1VQNS 2CPHA 1VC5A 1VQLS 4QU7A 3K0JA 2KXHA 5ITHA 2RQCA 2GO9A 2OJ3A 4M5DB 4F02A 3N9UC 2V94A 3MDFA 1HD0A 3BO3A 3TO8A 3G8SA 1W2BR 4W92B 2CPIA 1P27B 3MD3A 3BO4A 1Q81T 2AYGA 2JVOA 2KG0A 2DNYA 2DGVA 2KN4A 2YKAA 4A8XA 2ZJPQ 3FEXB 4WFBQ 2QFJA 2CPDA 2FC9A 2MKCA 1U1OA 2KI2A 1S79A 1H2VZ 2KXFA 3CXCR 1WG4A 3H2VE 3G96A 3CCRS 3CCVS 5JVHQ 2XS5A 1URNA 4IUFA 3MUMP 1R8PA 2F3JA 1SJ3P 3EGZA 2OSRA 2M70A 2DNHA 3U1LA 2RRBA 2RU3A 2AYBA 1OPIA 1WEZA 1SJ4P 2CPZA 3Q2SC 1K9MT 2LA6A 2CQ2A 2MZJA 5MLCV 2MGZB 2D9OA 4C0OC 1DRZA 2CPFA 1VBZA 3CCSS 2LKZA 1FJ7A 4J5OA 2NZ4A 3VF0B 2MXYA 2M4MA 3DXBA 1WEXA 1FHTA 5HL7Q 1H6KX 3TYTA 3EGNA 3SXLA 1ZZNA 1VQ7S 2RUGA 2KXNB 1N8RT 2XNQA 3S8SA 1X4GA 3V4MA 2O3DA 1YI2S 5LJ5Y 5DDOC 4CQ1A 3VAKA 4OZ1A 1M90T 4W90B 4YUDA 1UAWA 2CQ3A 2MSTA 1M5PC 2MQMA 3OW2R 5EN1A 2M0GB 2J0SD 2N82B 1A7GE 4IOCQ 2I38A 2RS8A 2K3KA 2M88A 5GAHU 3CMAS 2CQHA 1UW4A 4F25A 2LQ5A 3MD1A 1M5OC 3J7YU 4C7QA 4WKRA 2DGUA 1WF2A 2E44A 2LXIA 2AYEA 5GVQA 3NS6A 1DHMA 2DGWA 4LIRA 1Q82T 1X4HA 3P3DA 1SJFA 2X1AA 4U67Q 2YWKA 3MURP 3G6ES 1OIAA 3MUVP 2DNMA 1KOHA 1ZZFA 5LJ3Y 2RS2A 2EK6A 2GHPA 3IWNC 3CCES 5DETA 3RW6A 1VQ5S 2M2BA 4TU7A 1NU4A 2MZSA 1P1TA 1Q7YT 2AD9A 1WF1A 1U1KA
chains in the Genus database with same CATH superfamily
4LF6J 2RD5C 5A2QY 4PQUA 4PAAA 3QO9B 3R1HA 1RTJA 2B56A 4DFKA 2WONA 3CTRA 4WE1A 5IS2A 2X1FA 2O01C 1VQPS 1NK6A 1FRJA 2J6UA 4U96A 2CNOB 2KFYA 5A0YA 1R8BA 3WQPA 4HTIA 1UWBA 1X4DA 1TMMA 3R6LB 2IAJA 5GAEU 4JV0A 1KSPA 4IG3B 4CH7A 1VLOA 1UFLA 5D4LA 3WIUA 4IR1A 3PJ9A 3CJTA 4FYDA 4YOEA 1NDKA 5KT4A 1WF0A 1K1SA 2ACYA 1X9SA 1TR0A 3H90A 4B17A 3PIOQ 3F41A 1B0TA 4KKOB 2M9KA 2ZE2B 4OJ3A 4EWTA 4ZJLA 1NHKL 3M2UB 4OHZA 3R3TA 5EUHA 3TP2A 1O5JA 4NA1A 3M2RB 3Q8VA 4OZLA 4FS2A 3LP2A 4YHHF 4FXDA 3NNHA 1HBNA 2FGOA 3GU0A 1XNQF 2VG6A 2E7VA 2LDYA 1WORA 1GT8A 3CW2C 3VGVA 5KFBA 3Q0AA 5H9EK 1RWMB 4IR9A 4HLBA 2L48A 3WX4A 1CJUB 4HVZA 1ZAVA 3M8PA 2XYPB 3ZTPA 1S0OA 5JXSA 3NP5A 4ECRA 2W7PA 4IOAQ 2ERRA 3G4SS 2MZTA 2GQCA 3MR2A 1HQEB 3R2CJ 2JLFA 3KJNB 4LF4F 2KRRA 1U1QA 1RBOB 1HWJA 5DQIA 1J27A 1JXVA 1SL0A 1VR6A 4O3RA 2UP1A 2NREA 3MEDB 3M9OB 1VQSA 2IM0A 3MPDA 4GKKF 2FHJD 2ZD1A 2PC6A 5DG9A 3VAMA 3BPDA 4RU9A 1S1XA 4XPEA 3SI8A 2Z2YB 3BH6B 3QRPA 5M2UA 2ZWOA 2U2FA 3ETMA 3DN9A 1X4BA 4NLWA 2DKOB 1JWWA 2V50A 1SV5A 4OI3A 2QFIA 4J9VA 1RTJB 4XPCA 2WONB 3HK2A 3B82A 1RLCL 2GJFA 2F8EX 4K0KJ 2KZZA 2DGSA 1QLNA 2H5JB 2WB4A 9RUBA 2CA9A 3M8WA 1AYEA 1FFWB 2DH7A 4C8KA 3HLUA 1A0OB 1PKUA 1GMVA 3HJFA 1LQ9A 3QWUA 3CB4A 1N56A 4QJVA 4DL3A 4CO2A 3IA0A 2HGMA 3OL8A 1TP7A 2Y3YA 1MU2B 4KGVB 4RW7A 2YWFA 4ZLJA 1HHTP 3MWBA 3PX4A 2HQGA 1FRHA 4QWBA 4DN0A 3FBFA 1FK9A 1CC8A 4CNYA 2RRNA 2XZWA 2BJ7A 1VQLS 3SIPB 4ANEA 2I6WA 1NB7A 4BBYA 1WC3A 4IRDA 2ZHAA 1JKHA 2DNYA 4HT5A 4A8XA 1P1LA 3LP2B 5IV3A 2KJWA 1V5VA 4KAIA 3MCNA 2VG6B 3BGRA 2XYHB 2I9SA 2AF6A 2RRBA 1RBLA 1XMBA 4B9TA 2XHWA 2CQ2A 4DZ6A 1PG5B 3GFZA 2O67A 3ZZPA 2QTWA 4F4WA 4GVBA 2RILA 1VQYA 2A10A 2BQ3A 3OHAA 1R27B 3DCAA 2ZVIA 4OYWA 2HFNA 1IBKJ 1FRXA 1JIHA 2AV5A 5HJYA 1S99A 4DL7A 2UVRA 3CMAS 1EIYB 2CQHA 4A8QA 4X4OA 4PG6A 5CZVA 1SVDA 1UA0A 2ZKUA 1HBMB 2AX1A 3ICLA 2ZH1A 1VRTA 1T9YA 3PEJA 4R8UA 2ZD1B 3EXYA 4AE5A 3HSGA 2ZZMA 3H25A 3M8SA 3LA0A 3BN7A 2IVMA 2HWIA 2NSBA 3E51A 3CDBA 3D0IE 1ZETA 3PW0A 1SV5B 2IA0A 3MM5A 2IDEA 3PIPQ 1RBAA 3NGSA 1KS2A 2DY1A 1FDDA 5IWAF 1CEZA 2DPIA 1Q16B 1C4CA 3P6YC 3HVWA 2FJAB 4TLQA 4W4MA 4QU6A 1EQMA 4ECSA 5JUMA 4O0IA 1XMQF 2VDHA 2V5HG 1S77D 1QVFR 4IO9Q 1FWKA 2W2QP 3EVWA 1DZ5A 5F8LA 1ELOA 3DLEB 4DV5F 1WDDA 3UNYA 4IDKB 3IBWA 4GKKJ 2CZ9A 4RW7B 4AQYJ 3GCXP 3HMJG 3NNAA 4DFMA 1K1QA 1MG7A 1N32J 3OSNA 5LSRA 1FK9B 2LP4A 3CNQP 5A8WA 3BV8A 1IUJA 2UXBJ 1ZTWA 3GIIA 2DIUA 3GYGA 1QAJA 4PXEA 2ROGA 2MJNA 2ZZNA 1CS4B 4ECZA 1JKHB 2LCWA 1SJRA 1QTNB 3VR1A 2ZH5A 3T1YF 1WEYA 2AGPA 2YKOA 2AZ3A 1RT7B 5H9FK 1CLFA 2CJXB 1A6LA 3QGPA 4DR6J 3I31A 2W9AA 1RAIB 2KJVA 2E5HA 3TVKA 1UMJA 1KFSA 3DDNA 3W5YA 4MIBA 3CSKA 3G6XA 4UW2A 2OH2A 5DLFA 2QA4S 4CLTA 2HVDA 4ZP6A 3WC0A 3V5RA 2OPQB 3MMBA 4NEYA 3PYDA 1VC6A 4F0KA 4ANCA 2J7UA 2HNYA 1D0EA 1LFWA 1NH7A 2JHEA 5GAEI 4Q5VA 1SXLA 2W2OP 2RNEA 3AXMA 1UETA 2C22A 2VZ9A 1VRTB 4DR2F 4R8UB 3ZZRA 3DYAA 4WIIA 3GSIA 4MJKA 5JVGQ 1WG1A 4DV7J 2JEFA 3CMQA 1GXLA 1LWFA 2M5YA 3H0PA 4LSNA 2CKWA 1HL6A 4WPAA 3MM5B 3DLKB 3OXFA 4LF5F 2V2ZA 2JH3A 5D4OA 2B4UA 1QD1A 5A2QU 2MMYA 1T05A 4M5JA 1G4CA 3J81j 2HLUA 1IKXB 3C2PA 3HHLA 4ZHRA 3OFGA 3J7YI 1YJRA 4FDFA 2AJFE 2G0JA 1NJWA 1TK5A 1S48A 2OELA 1RWWB 2EPIA 1TMJA 3RW7A 3EMTA 3TVYA 4X84A 4DPXA 3CCUS 2C2EA 1Q8KA 1GAOA 2VC1A 2KRBA 1S1TB 3R27A 5F8MA 2RQKA 4NRTA 4YP3A 3VZIA 5A8WB 5G4DA 4F02A 2CYYA 1CQNA 5A76A 3MDFA 1FEHA 3OBIA 2YNIA 3R5JB 3MD3A 2ASDA 2YWEA 2B4OA 3VCDA 3K2YA 4IQMA 4PYAA 1B0VA 2BJ1A 2E66A 2DT9A 1P8GA 2KXFA 2R7WA 3G96A 4RKUC 3UVJA 2AKWB 2QJ3A 1HNZJ 2ZFHA 3BQ2A 4ES3A 4ZPWR 4OX8A 3OLBA 2OPRA 1T9WA 3DXBA 1WEXA 3I0SA 3NRBA 1EAYC 2OP5A 3ISZA 3BM7A 2M0GB 4J9KA 1E6VA 2I38A 3ILLA 1Y3KA 3IMQJ 3PYEA 2HNYB 1VGYA 2M88A 1FJGF 1D09B 1Z1ZA 3N79A 1VBKA 5C2CA 3FQKA 3PM9A 2B3TB 3M30A 3LGNA 2F40A 4AUKA 1SJFA 3DFEA 1R8AA 1D3WA 3OXLA 4QIFA 3DYAB 1WDTA 1TVRA 4X64F 4YB6A 4KHPJ 1C0TA 3A1YG 2Y1RI 1S4EA 4ZVQB 4WTOB 4NLOA 3V6KA 5HQ8A 2XI3A 3D1HA 2EFPA 4DJBA 1VQ4S 2ZH3A 3RUBL 3E2EA 2XB2D 1GNKA 1XNRF 1T05B 4DR1J 2W2PP 4IFVA 3KDNA 1Q8LA 1X5PA 2UV8A 1DLOA 1F5AA 1R6YA 5AJ3J 3BREA 3BDEA 1D9DA 3SQOP 3H42A 1YWXA 3BEGB 3PW7A 2HPUA 1TKDA 4F50A 1GK8A 4NX9A 1NEEA 5K8NA 1WI8A 1FDAA 2GIRA 2ZJQQ 3TAQA 1VQ8S 3EDRB 1Z4UA 3LOUA 3MM8A 4U7CA 1HBUA 3HVTA 4B3SF 1VS3A 2AYMA 3W61A 2AJ1A 4R0EA 3PW5A 4CLFA 3FSYA 3MMJA 3T6JA 4LF5J 2J6TA 1U1RA 4C3MA 1IBCB 1UVMA 2Q3PA 1EETB 2DHAA 1K73T 3CJ5A 2MEWA 3VAJA 2W4CA 4ZLNA 3SSSA 2OI2A 1EB0A 1ZPVA 2E1MC 4QIVA 3LPEA 3VGSA 3UNGC 5HATA 5KFYA 2ROPA 3MOJB 4ED8A 1KC8T 5CH7B 1UJ4A 5G0RA 2ACMA 2DRDA 1NZAA 5AE3A 4DBQA 4DV0J 3I0SB 3Q8QB 5BXIA 3ILJA 3IG1A 3OD2A 4G65A 3KLEA 4LF7J 1E6VB 2ZNYA 1OYDA 4FVCA 4OZ5A 2YQ1A 4O4RA 3K17A 2BJEA 4I68A 3TOQA 4MK9A 4C3KA 3G6VA 3HT3A 3NGKA 3PG9A 5E3AA 2V4JB 3PX0A 1FFSB 4DV4J 4I69A 3MMAA 1GMWA 2XLJA 4OHXA 3R5BA 4LF8F 1C1BA 3T9ZA 1C0TB 4ED1A 4DU8A 1SL2A 1EZZB 2ASJA 1C1CA 2YX4A 3KJVA 4PG4A 3M2VB 1TUVA 3C3LA 2KG1A 2U1AA 2W9CB 5KFKA 3H8YA 4P75A 3VALA 3CIZA 3P8BB 1RTZA 2IM3A 4WTYA 3AODA 1C0UA 4DR5F 2FVPA 2EBEA 1Y5NB 2BQUA 4MKYA 1FJCA 4QWAA 4KPYA 3OFHA 1LWCA 3C16A 2HGNA 1RTHB 1F9EB 5IQQA 3D1OA 3D6TB 3G71S 4JI3F 4WZMA 1YITS 3L4BC 3UN3A 4JV1A 4JI6J 2R8IA 1M1KT 2QIFA 2KO1A 1D1UA 2E9ZA 1Q4RA 2UUBF 4B3MJ 4LSLB 3BGFA 5E2QA 2PSZA 2VA3A 4EFAC 3MM8B 5T41A 4ERDA 2L41A 3HVTB 2XMUA 5CZXA 2GVZB 4RU2A 4J90A 1WKJA 4NLXA 4YFUA 3W9JA 4F7VA 5KT6A 3OT9A 1XNRJ 2JVOA 2WVEA 2VJUA 2A18A 1P9YA 4QYZJ 1YJWS 5AXNA 2AEFA 2ZM6J 4OI6A 2CDQA 5KG7A 3SEOA 1U49A 3IWXA 3MUMP 3PDNA 5SZTA 4NLYA 2RU3A 2QZ8A 3ELHA 4FYVB 2D9OA 2CPFA 1U7LA 3ZNJ1 5G0RB 2RUGA 4PPZA 4HDGA 3RB3A 3MPUB 1LXNA 4LFCJ 2MSTA 1QUVA 2N4CA 1NZ8A 5D3GB 2RS8A 1CC7A 4MK7A 3IS9A 3KLIA 4YR2A 3QGHA 5BYQA 2YXLA 1RDRA 5IT0A 2WB1D 4C7QA 3U27A 2Q6CA 1JNRB 4O3QA 3NOGA 2W25A 1I51B 1V9OA 2RAQA 3W63A 3MMAB 1AFIA 4X2BA 4WXOA 1VFJA 1PBAA 3CCES 5K14A 1SUQB 4PWDA 1U1KA 2WOMB 4PUOB 5FIIA 3NKYA 4Q44A 2SXLA 1X4AA 1SBRA 2JSXA 3ITHA 5GAGU 3VAGA 3PW4A 4RNHA 1BE4A 2DISA 1FKOB 1WTFA 3BBFA 3D54A 3Q2TC 2IY5B 2WZ1A 3C16B 2BOAA 4X66F 2Q79A 2JLEA 4UY8T 5KFRA 4FF4A 4O44B 5IFMA 2R7XA 2G1DA 2J0WA 1DFDA 1FESA 3L7OA 1SC4B 3EXCX 1UZHA 1FO1A 4CI0B 4FVMA 1FNXH 2DGQA 4CO3A 2MY8A 2HRYA 3W9HA 3KTQA 1KQFB 3N0VA 2ZH6A 2XGPA 1XC9A 3N6MA 4N77A 3O3LA 4ID5A 3IRXA 4I2QB 4I6WA 2GNKA 1KP6A 4LF2A 4OX9J 2CQ1A 1RAFB 2DHGA 5L1JA 1KVJA 5A8RB 2BA9A 1ZA2B 3ZC4A 4RL1A 2FYXA 1HQUA 4NZ7A 4KGKA 4ZVUB 2CIMA 4IG0A 4QWCA 1BQNA 3ZTSA 2DGTA 4F3MA 4RW4A 2YNGA 3N01A 4I7FA 3I55S 1SQFA 1AFJA 3DM2A 3EM1A 3BSOA 2UXCJ 1H2TZ 1RHQB 3EZUA 2I5JA 4XO0A 4LR8A 2CVIA 4M5GA 2D41A 1UPMB 2MQOA 1N88A 3CCMS 4WU2A 4CNZA 4KB7A 3QBCA 3SYZA 2GQQA 3IS9B 5B0DA 2YH1A 5SUHA 4ECXA 5HQMA 1ZM4A 3GONA 2EG2A 2J9CA 3NCPA 1KD1T 3FSXA 1HA1A 2LEPA 2W7AA 2F65A 4Y3CA 3HHEA 1GXUA 1RTIB 2ADCA 2HZCA 4LIWA 3CCJS 2D3OR 3GYXB 2JC1A 2I8EA 5KG1A 4JV5F 5K8MA 4F4YA 2CNKB 2V2VA 1JNZB 1H3DA 3KHLA 3DGVA 4CDIA 2QLXA 3HD1A 2Q66A 4NXNF 3SDEA 3ITHB 2CJYB 4ITSA 2LVWA 5B0BA 3HI9A 1JLFA 1KFDA 2N3OA 1TU0B 3PR4A 1EKSA 4PRFA 2AJQA 3N5FA 5HROA 2KFNA 1OPZA 4I1TA 2HQIA 1N6QA 2FB0A 4NOHA 4LBIA 3OQ2A 3T41A 4LRCA 5KFTA 1ZTTA 4D3GA 3MM7A 2JNJA 3T5LA 3D66A 1FWLA 2AU0A 1TL5A 1U24A 2BBEA 2MKIA 4F2SA 3MTJA 4MYUA 5HMYA 4ECYA 2ZDOA 3JTNA 4NLTA 3D9BA 2VBWA 1RSCA 1SL1A 1Q78A 4N56A 3NBPA 4X62F 2JEJA 1SC3B 2IA6A 3CJKA 4L73A 2FHJA 1NAQA 2HEKA 1D8YA 4H4MA 4ID5B 2J8SA 2RQCA 2GO9A 3Q23A 5D0EA 3BJYA 8RUCA 3BO3A 2W2NP 1YK9A 3QAUA 3TO8A 2ZKTA 1JB0C 2QN6B 3BO4A 8ATCB 1HNXF 3TANA 4O3OA 3R5DA 3O1LA 5EHHA 4C8MA 5EGYA 1F60B 5EWFA 4A8WA 1WKKA 3NEKA 1XWLA 5KFFA 4DV1J 1BQNB 4QW9A 3CGIA 1TL7A 1UL3A 2GV1A 1URNA 3NWRA 3EGZA 1Q1KA 3L7PA 1DARA 3G2XA 3LP1A 1K47A 1PIEA 2EWHA 3L7UA 4KC5A 5F41A 3KJQB 2KDOA 1HWUA 1DRZA 2ZHOA 2QMWA 2LKZA 2NZ4A 2FD2A 1FHTA 1FRMA 3TYTA 2BW7A 3Q8PB 4OYPA 4LF1A 4KRWA 1ZZNA 4P2MA 2YQ3A 1NB2A 2MQMA 2R8JA 3KK1A 1YJ7A 4DQPA 3MAAA 1RYRA 2XMAA 1HNVA 2MDAA 3RRKA 4WKRA 1V3RA 1LWXA 4A47A 4NCGA 3W66A 2LQJA 4LIRA 3DKDA 1WACA 2HZAA 3W2VB 4U67Q 4MYTA 3MURP 4ZK7M 4M5HA 4LF9J 3W2WB 4OYXA 3IWNC 4ELVA 2CWKA 4CO1A 4DV2F 4FNIA 1SH2A 3CO9A 3K58A 3QSYB 1FD8A 3J7AN 3KWMA 3RAQA 1ZH5A 3H4BA 2VKZG 2OSQA 4L3KA 3NGUA 2HMIA 2R7OA 3SDEB 1J5EJ 1BXNA 2B6AA 1F9FA 2NUHA 1LFPA 1JLFB 3T3FA 2HZVA 4X4SA 4USKA 4NL5A 3FC9A 4JI1J 3CT9A 2YVSA 1LK5A 1N6QB 2EFNA 4LQ9A 2DB1A 4DFJA 2KH9A 1NDCA 2JFDA 3MM7B 2QMXA 4CWBA 4KT0C 3DHWC 3VAHA 5A8KB 3KLFA 5J2QB 4WF9Q 3N4WA 4JI2J 2IYIA 1W25A 4ID8A 3A3NB 4Q0BA 1S72S 2OGUA 1JXLA 3QRQA 1HPZA 4CLPA 3HULA 4TYAA 3CJKB 1NLKL 2E5GA 4H4MB 3KK2A 3H2LA 1V6HA 2Y8YA 3D67A 3N28A 2Y1JA 4CLLA 3GSDA 2KM8C 1X4EA 3QIDA 1T02A 3THTA 5F8HA 5BJRA 1X5TA 2EFQA 2BKOA 2IJNA 2DCUB 2KVIA 1YBUA 1TL7B 2YWWA 1IKYB 2VG7A 2P5VA 2AT1B 1U8WA 1FKPA 2IMWP 2IC3B 2FY8A 4F4AA 1U2CA 5CQGA 1U0SA 1H72C 4C4WA 3CJ2A 1HFEL 1G7CB 4CO5A 4B3TJ 3KHGA 2DNPA 3RBEA 2QT7A 4DL6A 3KK1B 5LSLA 1RISA 3HHLC 3O5TB 4OV1A 5AE2A 2XM3A 4GMKA 4N5SA 1RWXB 4OZ2A 2WVFA 2DXEA 1NNDA 1HNXJ 2IJRA 1VQMS 1UEVA 2MLXA 2C28A 5HBMB 3KLGA 2AGQA 3QYYA 4KHMA 1N52B 3G86A 3FKBA 3MR5A 1KR4A 3OTOJ 1AXQA 2OLWA 4DR7J 2R7VA 1JLAB 1YJVA 1U2FA 4C0HA 5HMZA 2VPYB 1NDLA 2A2CA 3LGHA 5DDRC 3QSIA 3T1HF 4FYWB 3PNIA 2CQGA 2Z2LA 1DQ9A 2BJDA 2DGOA 1EX8A 3EICA 1CULA 4E8UA 2JVRA 4FYXB 2DNLA 2FLPA 2YNHA 3QIPB 1ITPA 1SQGA 4CTAA 2R7QA 3DLHA 4B9MA 4JI5F 3VAFA 2GO8A 1DBDA 5E3RA 3B8HA 2H4WB 2AGOA 3VQTA 4QBUA 2F9DA 1NUEA 4DPWA 1XR6A 4LRBA 1HPZB 1IM4A 3DU5A 2CJAA 4M5IA 3DGPA 1TL4A 5IXUA 2DR9A 2MHEA 1PAEX 3C6UA 1CSJA 4J9PA 3QGGA 3UR3C 1WNEA 4HI1A 5I3PA 3F0NA 4DUYF 4A8SA 3I5AA 4QW8A 1Y10A 2QA1A 2RQMA 3IC1A 2FZCB 3CCRS 3MPYA 4IUFA 4GKJJ 3FVYA 4UUXA 2Q1LA 2VG7B 5KT2A 1SJ4P 2MZJA 2HNDA 1FKPB 1PBUA 2ZC3A 3UN2A 3GZ7A 2ZUGA 3H5SA 4PZVA 2XCAA 2RDJA 5KG3A 2ZUAA 4J9SA 1VQ7S 1UJ5A 4X4UA 1F6TA 4PG8A 4B9SA 4OI0A 4YUDA 2VPZB 3PHEA 2G13A 4DOZA 1S9EB 5C42B 4K4YA 2B8PA 4MKAA 1S0MA 3C14B 2HFOA 2UUAF 1Q5VA 2VG5B 5CD4A 4XK8C 2E44A 3K5MA 3SV3A 3RB4A 1LOUA 5AT1B 3H98A 2APOA 4L75A 3DRPA 2QA4G 2OPSB 2OD6A 4QWDA 4DX8H 2AD9A 4RNMA 4OHYA 4Q7AA 1KQSR 4OIXA 4L3NA 1ZM2A 5HMXA 3NMAA 1BGXT 2HFSA 2BOPA 2FJEB 1IN0A 3HHLD 5LMUJ 3SQGA 2XULA 4URSA 4JI0J 3JYTA 3TZXA 3BO2A 2NXUA 2PT0A 3G82A 3VAIA 4Q43A 3O44A 4M5NA 5I4MA 2DO4A 4KPCA 1PC5A 4TN2A 2XHCA 1TKTB 2K1RB 1A9NB 1NHVA 1TAQA 2MZQA 2M7SA 4DL0C 5I42B 3E01A 1TL3A 1WD6A 3SMZA 4HT7A 3LGMA 2UXDF 1RWNB 2VFTA 3OTDA 3D5MA 4PYDA 3DGPB 3MUTP 2MKKA 2OD4A 4IKAA 4FF1A 3CO0P 2C3PA 3M7VA 1VQ6S 1VBXA 2ZC4A 2BYCA 1V5IB 2CJBA 1LNQA 3C6TA 4OYZA 1QUPA 2ZOGA 1UVNA 2IVFB 2V8HA 4A8KA 4NLDA 4Y28C 1NK4A 2F4VJ 3I82A 1HNIB 2HNDB 3GTYX 1ZAWA 3TZWA 4G1IA 2CNNB 1FF2A 4K4WA 3L3CA 3NAHA 2A2DA 2VH7A 1RJJA 4YB5A 2GCFA 1R43A 1LWEA 3DI6B 2VQEJ 4JBCA 1GQEA 2K06A 1UJ6A 3DMJA 3GIJA 4DUYJ 2JLGA 1S6PB 1MW7A 1TL1A 1AT1B 4USJC 1NJYA 2HVZA 1MNEA 3VWSA 1IQTA 2Z57B 4K4ZA 5E7OB 2L9WA 3CJ8A 3DRPB 2DXFA 1RT2A 1TV6A 4DV3J 3OTEA 3TAMA 2R9LA 3UCZP 1OQ6A 5KOWA 3M4XA 1GXTA 3MM9B 5EDWA 5K5MA 2DRBA 1OMSA 3KNGA 5DZ7A 1U47A 4IO1A 2HK3A 4UOFA 3JYTB 4HL9A 4RNNA 5RUBA 2CQBA 3CJSA 3PRVA 1KVKA 3I56S 2E5LF 1JLCB 1FXRA 4LFAF 2ZZTA 1BWVA 3ZTQA 1S97A 4MKBA 5AE1A 4HTJA 4OI1A 4A8YA 2J6SA 2XMKA 1UFWA 3IAS9 3DOMA 1RYSA 1TL3B 3OR2A 5CA5A 1I94F 4CH1A 2FVCA 1IVZA 4DF4A 1RHMB 2D1CA 5EWEA 1N34J 3K0JA 4QOTA 1Q5YA 2NUUG 2GGPB 3MECB 3O2IA 3GILA 3C19A 3RR8A 4ZVSB 3H4DA 2YKQA 1RAAB 3C6TB 2MKCA 5A6PA 1PCAA 2DJWA 4MFBA 2QL7B 4GVLA 1I3OB 2F3JA 5HVGA 1RCOB 2OSRA 1SI9A 3WIVA 4ECVA 1KTQA 4ZPTR 1RU1A 4I6YA 3FBBA 3CCSS 4J5OA 1SCJB 2CNLB 3VF0B 2P9EA 4KR0B 1G3OA 2DY9A 4AYBD 1T94A 1N5YA 2HS4A 5LJ5Y 5DDOC 2E29A 1D9FA 1KEKA 3IFEA 2UVVA 2BJ3A 4ED7A 2YX1A 3SFUA 3MTKA 3IM8A 1FVSA 1JJCB 5KFWA 4J9UE 1ULRA 1HI0P 2DGUA 2V67A 3Q22A 2AYEA 1OSDA 1RT4A 1TL1B 1IKVA 4ZVOB 4YEAA 3NAIA 3JXOA 4Y2IA 2W9BB 3I32A 2V2QA 2QSWA 3BKUA 1RT2B 1TUWA 1ZZFA 4KYZA 1C2PA 2MLZA 1VQ5S 4ZIWA 5KFUA 5CHCB 4ZCMA 2MKSA 2B4VA 4I6AA 3R6GB 2UUWA 1Y0HA 2R2RA 3ZZ0A 2PD1A 1N5QA 1KQKA 2BACA 2K7JA 2GJ2A 4RW9A 4I2PB 4ED3A 3KLHB 4IH6A 5CYJA 4QR1A 1ZM3A 1KRPA 2CQDA 2VQFF 4G1QA 2GQ2A 2XY7A 3RZAA 4C2MA 1IBMF 3HFZB 4J91A 5BR8J 3V6JA 2ZH8A 4C6AA 4LFBF 1L3VA 1AUDA 2MLYA 3CCWA 2XMMA 3EDQB 3HHNB 1X0FA 3ZZUA 3OR2B 3TA2A 2W2MP 1WC4A 3R7BB 4IFYA 3W1YC 2JEGA 3OFEA 1VRQC 3J7ZT 3BZQA 3EZOA 4C97A 2MHNA 4YB1P 1S59A 2HK2A 2YNFB 3P96A 4DL5A 1FWPA 2UVWA 1F1BB 3DLGA 4DPOA 3KFWX 4OYIA 5AXLA 2DH9A 3CJ0A 4HACA 1DJ0A 2ROEA 2H54B 3VGTA 3TUJC 2HW3A 2GIFA 4MFBB 2LQ8A 4FF3A 3OL9A 1FXLA 3RU0A 1RWVB 5KFZA 3HDSA 1AUSL 1HIYA 4O3NA 2M8DB 2C2DA 1LV5A 3AFGA 5L46A 1I94J 4CCHA 2KZMA 1S7IA 4ETZA 1N5YB 5KT3A 5I3UA 2M52A 2BJ8A 4YN3B 2CVEA 2VFSA 1HWKA 5L39A 1NXIA 3TUPA 4JI4J 1O6XA 1LW2B 4DPUA 3QLHB 3WX8A 3I4PA 1DTQA 1WOPA 2J9DA 3PKYA 3CCQS 4FKXA 1JLEA 3SV4A 3P4UB 1WJ9A 5C24A 3MM6B 4O23A 3R2DJ 1BUXA 4BDPA 4GC6A 4F3QA 1UEUA 2RKIA 1X0PA 1YJNS 2LYVA 2R42A 4RW6B 2FDNA 3D0GE 4CLZA 1OWXA 4NEZA 3TVZA 3S6EA 1S6QA 1Y7PA 1F2GA 3M8QA 1WG5A 2C3UA 5GAHI 4G1QB 2JFKA 3UQSA 2ADBA 1HWLA 1R6VA 4BC9A 2WAQD 4JI8F 7FDRA 1P6TA 3RYLA 5KT5A 3AD8C 3QJJA 3CD0A 1JLBA 1HHSA 3JSBA 4DV6F 1QE1A 6AT1B 2AZ1A 1KKHA 1NJZA 3SCJE 2B5JA 1XMOF 5D6GA 3OVSA 2HQCA 2JC0A 4B3OB 3H40A 3KUHA 3EWGA 2Q43A 2KXHA 4M5DB 2GVDB 1NJXA 2V94A 2W8KA 4JI7J 1XJWB 4W92B 4ZMMA 3QT6A 5HVHA 4DUZJ 4NLGA 2CZVC 1L3SA 4RW8B 5CYMA 1QSLA 1NHUA 4DX6A 1VIXA 4DG1A 1RT5B 4USIA 4R5PB 4WIQA 4DR3J 1VRUA 2G1HA 1VCTA 5L9XA 3KUGA 4OQJA 4B08A 2MGZB 3CIMA 5HLFB 5J1EA 3GV5B 2FQQB 1N36F 1IBLJ 2BE2A 3M32A 3LWMA 3TRGA 3MR7A 3SXLA 4LRFA 3GIKA 2OAUA 4DR4J 3BH7B 1YRXA 4NXMF 4Y65A 2J7WA 4BLGA 4WJBA 4TY8B 6FD1A 3JQMA 2AIRB 2PN6A 1S12A 1DTQB 3MD1A 4NLRA 4O3SA 3IWLA 3PW2A 3J7YU 4DUTA 2LXIA 2IRUA 2LLZA 1JLEB 4R25A 1HI8A 4KH1B 7FD1A 1E6YA 2LFVA 5J1PA 1Q53A 3ONQA 2DNMA 5C24B 3C8YA 2EK6A 2HURA 1Q7YT 1M5VC 3KKFA 2RIJA 2VUGA 4P73A 3EGVA 4BCAA 4DXLA 2RKIB 3X1LB 1CJTA 4I56A 3C15A 3QATA 2D3ZA 4WK3A 2GX8A 4Z2XA 2E9TA 2V8GA 1HNWJ 3QJLA 3CCLS 4FBTA 3M8QB 5JJBA 5DGAA 2VPXB 2FHOB 3D6HB 3EYZA 2PEHA 1RAOA 2XS2A 3W8GA 3B6BA 2PDAA 2NXEA 5LSOA 4DX5A 3GIMA 2GAHC 2BV3A 1T11A 1H7WA 1FNOA 2XWYA 1Y9OA 4TQSA 2W4PA 4OLPA 3DNCA 1O8BA 2B0GA 4HEA9 1CQMA 2FZKB 2JZ5A 2Z56B 4XDDA 3R97A 2BANB 3RBDA 3W64A 3I9V9 4OLOA 3TR5A 3MOZA 1UVJA 3I5BA 4G6VB 4O0NA 4PQUB 4KV8A 1F0XA 3PZPA 2HSEB 3THPA 1RE1B 4WE1B 2FZGB 4TXSA 3PCOB 4KGXB 3MXHP 2HVHA 2B9EA 5A0YB 4ED5A 2BW2A 1UWBB 4PWWA 3ISNC 3JQKA 2VJVA 1URRA 2IAJB 1QJHA 2ZBPA 3ZZYA 3R1LA 5CYMB 4Y2MA 2OO4A 1VRUB 2XC9A 1MMNA 2C1EB 5J1NA 3G8QA 4TNOA 4J7CA 3P5TL 1VQ9S 3CCZA 2WSFC 2WSEC 3OVBA 3ENQA 3K8VA 4DV6J 3F44A 4CH0S 1WC5A 3M32B 3TUZC 4NLPA 3ULHA 1PAUB 3RR7A 3A8IA 4E0DA 1VQKS 4ILLA 3VGUA 1ZAXA 5IT4A 5AXKA 1QAIA 2P2CB 1RWUA 1UVIA 4A4JA 1RP5A 3PTWA 2IBKA 2RHSB 4HHUA 4CRJA 3M8ZA 2OKQA 2MPUA 4KIAA 2PI5A 2MZ1A 1AB8A 4ANDA 3G8TA 5DM7Q 5LMNF 3AB2B 4BWJA 1HBNB 5IV4A 2Y1LB 1N5SA 3H5YA 5CCMA 1T9UA 3MMCA 2GFFA 1SKUB 1HR0F 2W4DA 3JTPA 3MAQA 3MF5A 5M2PA 2WVDA 4Q8FA 2ZOMA 3W60A 2JWNA 3C15B 3M8PB 2F4FA 4ALZA 4DHVA 1Q86T 1JJHA 1KQGB 2N3LA 1RI7A 3D7SB 4DSFA 5FDLA 2ZBRA 2XLKA 1VYAA 2BVZA 3BN4A 1RWPB 2FC8A 4RWXA 3M05A 2FVQA 2DR6A 5J2NA 3GE9A 1FDBA 5C25A 4M5MA 3K89A 1LEOA 1PYSB 4YHHJ 1FEEA 2L08A 2NYIA 1S76D 2V68A 2LU2A 4ER8A 1XNQJ 4U7UD 1UW9A 1X4CA 2CWXA 3EX7B 3IGVA 1S1XB 2YWGA 2AQ4A 3GWCA 2MQLA 3D28A 4Y2KA 1U0HA 4UUWA 1V3ZA 4ZA1A 1HD0A 1W2BR 3VV2B 4HKQA 3QAEA 3K8WA 3D0HE 2NPFA 4CLUA 8AT1B 4KGMA 2FC9A 4WYWA 2WCXA 4ZITA 2D69A 4X4TA 4K8RA 4LF4J 3GR1A 2HHHF 2EC2A 3JSRA 2GS8A 5DJBA 2IRXA 4DS4A 1GTHA 1NPPA 1U26A 2F8HA 3N6NA 4WXWA 4F67A 5KFOA 1G1XA 3HO1A 3HFKA 2B43A 1H6KX 2FJXA 4CLKA 3J81Y 4QCLA 4OI2A 3CJQA 1T8EA 4C98A 1YX2A 5DRKA 3ISND 1REVA 2C3OA 2ILYA 2N82B 1X9MA 4DQRA 1ZYQA 1L3UA 3AB4B 1UW4A 4F25A 3IO1A 2PFDA 1XEZA 3THVA 5B0FA 3K7RA 1FRIA 4NE9C 3ENAA 1F3FA 1X4HA 4F36A 1FTRA 5DETA 3BGRB 2G9OA 4L72B 3ZFVA 1UVLA 2YX7A 3H2UB 4TKTA 2HYIB 4ATNA 4GVBB 3IR7B 4LUBA 1U8SA 1RAGB 1B3TA 5FDLB 5IM0A 4CZCA 1KDNA 2BZ2A 3VVTA 3I96A 4GRSA 2X51A 3POTA 2C2OB 5J2NB 3M6UA 2MSSA 4MIAA 2MQPA 2MKHA 2BRLA 2KT5A 4PWUA 1CJKA 2PFFB 3CD5A 4DMZA 1XERA 4XIUA 2RE1A 1HARA 3BGLA 1FI4A 4A8MP 4ZN3A 5LOQA 2D9PA 1QVGR 3ZTRA 2HHTA 4FPRA 3HZGA 4YY3F 3R8YA 4FKYA 3GB0A 4PKDB 2XNRA 1U6FA 4JB8B 2KHDA 2CPXA 5CXTA 4ZVFA 4DU7A 3DRRA 3HF5A 3DU6A 4C11A 1UFKA 2ASLA 2KB2A 4ZP9A 4KSEB 2CPJA 1B4SA 2HBYB 2DNNA 1JK9B 1CG2A 2R2TA 4C8NA 2G0CA 4M95A 4F26A 2YKMA 5B09A 3OXGA 5DZ6A 4X65F 3NG8A 2E7WA 4EZ6A 3WHIA 3S7RA 2E5IA 4R0JA 1ZPWX 3QT8A 2L9DA 4EZ9A 3CDAA 3CDUA 3O6QA 3GP9A 4L6V3 2V4QA 3FCVA 2R2SA 5DDPC 4A8FA 2VFRA 5FD1A 3NNCA 2GHWA 1S57A 4O4GA 1SC1B 3OV7A 5IWAJ 2Y8WA 4QPXA 1KVIA 3D6FB 1T9XA 3BBBA 1XMQJ 2E1PA 1RAHB 1TQLA 2ZH4A 3GMGA 4YB7A 1M1HA 1N33F 5KFMA 3I87A 5J2PA 4DV5J 3K5PA 4P52A 3VZHA 4K59A 4J9MA 2R2UA 1Z2LA 3MFIA 3KG1A 3LALA 2LQ9A 1M5SA 5D4NA 4B9NA 1Y4ZB 2NSCA 5CCLA 1R0AA 4Q2MA 4KY3A 4B9LA 4ECUA 5D0GA 3AOCA 3LANA 2XSFA 5IM0B 1NK7A 3MMBB 3W5ZA 1YG0A 4MMOA 2XMVA 2ATLA 1MMLA 2VOOA 2LMIA 4BWMA 1DTTA 4NPOA 3ZZTA 1ACMB 4L74A 5LT5A 5DQGA 3UR0A 4LF6F 2D74B 5F0UA 4X4PA 4FF2A 2R7UA 5KFDA 3DHXA 3T1YJ 3EE3A 3RG6A 3GG0A 4S0MA 1SC6A 1WWHA 3NMRA 3FRYA 3V6DA 1RADB 1T9TA 1S9FA 3DDKA 4NZ0A 4P9SA 2FPHX 5CYQA 1SPBP 3Q86A 3CD6S 2VV5A 2LDIA 2OIHA 2CFXA 3BPSP 4QYRA 3FMWA 2OPPA 1LWFB 2VB6A 4LSNB 1GFWB 4EMDA 5DO2A 5IQ6A 1AZSA 3G8SA 5E33A 4UOGA 3DRRB 2V69A 2VC0A 3TX0A 1F5CA 3FEXB 3HHLB 4ZHRB 2KI2A 3MEGA 2AEMA 1Q95G 3BBCA 4ZLLA 2EKYA 3GJQB 4YR3A 5MAOA 4C8YA 5HI7A 4ZVTB 3RBZA 4IRCA 3RB6A 1WEZA 2XQCA 2CPZA 1OY8A 4KH0B 2EG1A 2DVIA 3QO9A 4OYOA 4DR2J 1TZ0A 3PX6A 2XY6A 3OVAA 3DXSX 3S8SA 3V4MA 1YJTA 5B7WA 2DR8A 1U45A 1M0SA 2CG8A 4MAKA 4OYAA 4IG3A 1J2VA 3CJRA 2YNIB 5GVQA 1Q8BA 4UZCA 3NS6A 2UUCF 3D3CJ 2L3MA 3EPIA 1FCAA 3H5XA 2BEFA 4FZVA 1M1GA 3MUVP 2PIIA 2CG4A 3UVJB 4OZ3A 2RS2A 2GHPA 3ETOA 2HAFA 5J2PB 2HHUA 1NU4A 4KKOA 1NK5A 3IXQA 2QRRA 4LR9A 2ZVSA 2DNGA 2ZE2A 2OPRB 4QR2A 1JXEA 2XBPA 4TQRA 3M2UA 3SSQA 2J76E 5HANA 5BYSA 3J7Z5 1IXKA 2PEBA 3TEGA 5B0AA 3M2RA 4HHJA 1GEHA 2FJVA 2CDRB 1DTTB 1N54B 3TW0A 4NMXA 1WI6A 3OLAA 1JJ4A 4WBFA 1XK8A 4OJGA 1JQGA 3M30B 2VHGA 4RUHA 4U8YA 2W01A 4LJMA 5E5NA 2GMJA 3HVAA 4QR0A 2DNRA 3V6DB 4YR0A 3HSJA 3HXMA 3LH2S 5KAKA 1TVRB 1YZ7A 3HHDA 2YPZA 5GMKa 3AXKA 4NRUA 4K0KF 5D78A 3LQVA 3G9CA 5KFPA 3HJVA 1R8CA 2JEIA 2PE8A 1SJQA 4F0HA 2FLOA 4Z7CA 5ETMA 4C9DA 2V63A 2P9CA 1XTZA 1YHQS 4HH1A 3C66A 4IFVB 4ZS6A 1DLOB 3MEGB 1NSAA 3JB9k 4URGA 3FEYB 1FJGJ 4Q8EA 3T9NA 4CLSA 5CD4H 1C4AA 5DG7A 4ZVHA 2X3GA 1KLMA 2B9WA 2HQDA 2GC8A 1WHWA 2C2MB 3DRXA 3IR6B 5AXMA 4URQU 4X64J 3KUEA 1HBUB 3CULA 1MN7A 4QQBA 2A6OA 4HR2A 2NXCA 1RA7A 5F8NA 3J81U 3QZ7A 1QSYA 1BC6A 1CPZA 4K4UA 5EX3A 3WDOA 2PMZD 4OHWA 1OO0B 1DY3A 2LU1A 3DOKA 2OTLS 4AL5A 5LM7E 2RT3A 3RRHA 1MU2A 4FYYB 1YRUA 3MEKA 1B7YB 2FVRA 3M6WA 1WHVA 1YRTA 4OYBA 2QLWA 1OY6A 2PMHA 1PGZA 1SH3A 2HS0A 1IBKF 1O0PA 1LK7A 2RJZA 3OL7A 1YTYA 2HIYA 2B9XA 5IZHA 2CUYA 1RUSA 3EGWB 4DQIA 1MSWD 3IG1B 2Y9HA 4B3SJ 3JSMA 3KLEB 4KE5A 4PXCA 3TNVA 3TJ8A 3UDLA 3LTOA 4ELTA 1U09A 4FN5A 3OJSA 4DZDA 2XTJP 4ZVGA 4QWEA 1JMTA 1S10A 1K8AT 1R89A 3IRWP 2UUCJ 4ZN1A 3CMES 5L1IA 3EVOA 4JP8A 2MZRA 2R4FA 3TJAA 2IJFA 1WSVA 1FX4A 1C1BB 1BLUA 3J7A1 1TKZA 3BF4A 1C1CB 3WC2A 2NYHA 3KJVB 5KOXA 4J9NA 1U6ZA 1AW0A 5HVFA 3IBFB 2VBYA 1P27B 1Q81T 2HFUA 4PEOA 1HHQA 2OEJA 4WFBQ 1HBMA 2CPDA 1C0UB 4CT9A 1IJFB 4USMA 4ED4A 1MWZA 3BYRA 1KN6A 1LWCB 4AQYF 2QX0A 4NI2A 2YBVA 3SCLE 4CLWA 1SJ3P 1NK0A 3CJ3A 1SQEA 1K44A 1N32F 1KLMB 5ETPA 2RDIA 3A12A 4U95A 4C0OC 4PPDA 2MXYA 2M4MA 2UXBF 5D8HB 2ALYB 4RUCA 1OSCA 1WC0A 4LF8J 3HP6A 2R8GA 4RR5A 2NPIA 4ECQA 2HWHA 5GADI 1M5PC 4NZ6A 2OHDA 3SFGA 1SJ1A 3P45B 2HS3A 3DOLA 2LQ5A 3DLEA 4DR6F 3DOKB 1Q79A 4IDKA 4IRKA 3UFCX 3P5BP 4N7TA 4P71A 4DR5J 2HHVA 3VHQA 3W9IA 3W65A 1YLXA 3SZ2A 3FSIA 3LUYA 5LJ3Y 2BQRA 2PA3A 1T0TV 1RHJB 2QLBB 1WF1A 3F73A 3OFFA 4JI3J 1SB6A 2DHHA 2EI5A 2LA4A 2OMLA 2WK4A 1YKWA 5KFHA 2HBRB 2I0XA 2DBBA 5E41A 4USUA 4UQGA 2UUBJ 3K59A 2XMJA 2HIQA 1VMBA 4OI4A 1CS4A 2J8AA 1M5HA 2F7VA 5C5JA 4U6PA 1AROP 3JSMB 3FZ2A 4PG7A 3QRRA 4P10A 3KHRA 3OR1A 3KLIB 3A8EA 3M6XA 1RT7A 3R7SB 1B7FA 1JJ2R 3KJFB 3K5OA 4DV7F 1NK9A 4ZIVA 2A1BA 4V19J 3CC4S 4QIGA 4H4KC 4DSIA 4RUBA 5K14B 4DEZA 3BQ1A 1YJ9S 2J9DE 4PWDB 3N5BA 1O51A 1TKZB 4F8RA 2OPQA 4ZOSA 5DM6Q 4P2FA 2DEIA 4YS2A 2OFHX 5D0HA 2HBZB 3DLJA 1X31C 1WC6A 2FVSA 4ES2A 5KG4A 1TK8A 4G1PA 3L9ZA 3RB0A 4Z7YA 6FDRA 2DNQA 2ZWPA 4NI2B 5HAOA 3ZZOA 2VIHA 4ZCLA 2RH3A 2UV8G 1IR2A 1Y3JA 1T3NA 4Y2CA 3J80Y 1VC0A 4PXDA 2E7XA 3DLKA 4EGLA 3RRGA 4NCBA 4QZVB 2K7KA 3NGDA 3O8WA 2Z2ZA 2R8HA 1IKXA 5KFJA 5B0CA 2M3DA 3IRXB 3L95X 2KFZA 2V2KA 2DK2A 3DOLB 3KDOA 3IP0A 3PJWA 1ZOTA 1WELA 1EQ0A 1HNZF 2J9EA 2PO4A 1HQUB 3FZBA 4OZJA 4IG0B 2H48B 3I9ZA 2IPOB 4C8LA 4X66J 4RW4B 1T95A 1S1TA 2YNGB 5DGBA 2FJBB 2HQ3A 1FNMA 4I7FB 3AAWB 3JAMU 2BKPA 3FEZA 3DM2B 2DXDA 2CQCA 1W2IA 2Z30B 3PYFA 2I5JB 3A3OB 4KHRA 1HWIA 2Q6BA 4LBPA 1FERA 4OJHA 4ES1A 1MMDA 3AD9C 2QV6A 3GFHA 2EKNA 4HHHA 3BKFA 3GJTB 1IWAA 2KTQA 3OR1B 3GIRA 1XQIA 5H9EJ 1REGX 1Z2ZA 2R3VA 3PO5A 4WFYA 2ZH7A 4KHPF 1I1GA 1HQ2A 4N47A 3W5XA 1TKXA 4P7VA 1SKWA 3R5GA 2E9RX 1OQ3A 4OL8A 3G6YA 4Z37A 3WBZA 1S0NA 4ZLPA 1RXOB 4DR1F 5IC6B 2R7SA 3IN5A 2DCLA 1S1VA 5AJ3F 5F3ZA 3FBCA 4CP5A 1R0BG 4Y34A 3PACA 2KG0A 2HNZA 4J9QA 5HJXA 2QFJA 2ZJPQ 3ILOA 1U1OA 1OY9A 5K8PA 5HROB 2VDIA 1QTMA 1FE4A 3PVXA 2ZEJA 3FDSA 2Z58B 3NY0A 1R8PA 4DSJA 2M70A 2VBXA 2AYBA 1OPIA 4M1KA 3RAMA 1BHNA 1IR0A 3DC2A 1HBOA 1TAUA 2BX6A 5D4PA 3U02A 3BKTA 2G2ZA 1S1UA 3NBPB 3UI3A 3AA9A 4EYHB 1Q8IA 3QT5A 4IOBA 1UAWA 4KQZA 4JV5J 5EN1A 4PXBA 1S6OA 2QGFB 1YQHA 3OL6A 4NXNJ 3D4JA 1RACB 4OMFG 5BYRA 3HD2A 1RKIA 5L8RC 1OIAA 3EPGA 2ZBCA 5F0WA 3GR0A 4ECWA 4IQXA 2QLJB 2M2BA 1R7IA 3V4IA 2D7SA 2XO7A 4DV0F 4B9UA 3LP1B 4FNHA 1H7XA 2RDDA 2XS7A 1FRLA 1HLWA 4LF7F 4ZVEA 2P9GA 3MEEA 3B4DA 4X62J 3D1QA 4RNFA 3KG4A 3HPOA 1U4BA 3MI7X 1GX5A 1EETA 3QPIA 1RU2A 4OFZA 2LEBA 4UT4A 3AJ2A 1S6UA 4DV4F 3MAAB 4DQSA 2BABA 2FLNA 1HNVB 2VBZA 1B99A 1KLNA 4NYZA 2XCPA 2E1CA 4K2JA 2I1RA 4NCGB 2LXFA 1TKXB 2D3UA 3BS9A 1NO8A 4EK2A 3FCWA 3M9NB 2Y1IA 3M8YA 3GV7B 2LXUA 4ZVPB 2COLA 3QT7A 3GJSB 1L5UA 4DLGA 2HMIB 1S1VB 3CJ4A 4I64A 2B6AB 1G2EA 5F8GA 1BD6A 3E3XA 2V4JA 2HNZB 4XTTA 1RAEB 1GMUA 4EI2A 1OS5A 1D8ZA 5EWGA 4Y00A 2DTJA 2UZAA 1NKCA 4LSZB 4JI6F 3CCTA 5ETRA 1U1LA 3LPYA 4DCPB 4B3RF 1WSRA 2DGXA 2E5JA 4B3MF 1YBAA 3PYGA 2HHQA 3KLFB 4K7QA 1NKEA 4F04B 1HBOB 2NLWA 4UOCA 3M2VA 4Q0BB 2MTLA 3BYPA 1K0VA 2W9CA 3IBCB 1S1UB 4DV2J 3QGIA 4UOHA 2C3MA 5HSPA 4DPYA 2XGQA 2EEYA 3GV8B 3MPVA 4WFZA 3G87A 3WZ0A 3KK2B 2ZM6F 3QZ8A 2QLFB 1VHIA 1HW8A 3PHTA 2VOPA 1RTHA 2DNZA 3NCQA 3LO3A 2C42A 4KGZB 2X1BA 3PY8A 1FRKA 3Q8YA 2H9ZA 4DQQA 3T5KA 2NXJA 3AD7C 1ZA1B 1RZMA 2BRKA 3M1VA 3HX9A 3V4IB 4LSLA 5LXRA 4F4ZA 2B8QA 3GFXA 5LL6d 1PC4A 1VI7A 1L3KA 2GVZA 2RSQA 4LFCF 2ZBQA 1EP4A 4WZQA 1GTEA 3U7JA 1ROFA 3DLLQ 1XBWA 2XMWA 3MEEB 1PJ7A 2AX0A 3BDPA 1UKUA 3NWGA 1HD1A 1VJQA 3BR8A 2Y0BB 3QMQA 4PR6A 5H9FJ 4M63A 2BR0A 2X7IA 3AQPA 4N41A 2DNOA 1RAJA 5C2GA 1UEKA 1FT8A 1R8HA 2VFUA 2KU7A 1DURA 1X5SA 4F4XA 4K4XA 3R5CA 3KLGB 3UW1A 5KFQA 2CQIA 1FFGB 2IM1A 3I6PA 5CAAA 1TK0A 3D68A 5D3GA 4QU7A 1RGVA 4ZPVR 3N9UC 3ADAC 4DSKA 3OPKA 3MR6A 3Q24A 5THWA 2O5DA 4LRAA 2J5AA 2CADA 3NS7B 3SCKE 1H2VZ 2OMOA 1CULB 4OX6A 1KHWA 4RO0A 2YNHB 5D0RA 5DG8A 4CTAB 1SUQA 3ZTOA 4PABA 2WOMA 4PUOA 2GIQA 1H0HB 1RB0A 1TFWA 5KG6A 1N5VA 5HK4A 1MWYA 1Q0NA 4P2SA 3EGNA 3A13A 4F2RA 4PCQA 4OX9F 2IIHA 5L1LA 1H73A 1XR7A 2XY5A 4ILMA 1TFYA 3J80U 1FKOA 3MCSA 2K3KA 2YPYA 3C6UB 5GAHU 2NZCA 2C2KB 2KT3A 3T1HJ 1M5OC 3W62A 1VISA 4O44A 3KYLA 2IBOA 2YWKA 1DAXA 1YJUA 9ATCB 2UXCF 2O66A 2PMWA 3M1VB 4B3RJ 4JI5J 1NBEB 4J9LA 4ZCIA 3M6VA 2B9YA 1EP4B 3CC2S 2Z4PA 2MKJA 4I2QA 2QMUB 2EC0A 2ABYA 1XN9A 3UO0A 2QEXS 2IYGA 4HH0A 5KFGA 1S0VA 3GCWP 5A8RA 3RTVA 2MKYA 3RJMB 4ZDNA 3ZXWA 4P2XA 3ILIA 2CXEA 3DRYA 2DNKA 1UP1A 4V1Ak 7AT1B 2H65B 4N8NA 2EFGA 2Z2MA 4K2XA 4X4QA 3C46A 3CD7A 2N7YA 1JLGA 2N4DA 2RHQB 4OYMA 4TLRA 4BC7A 2P6SA 4YDDB 1IR1A 4WU3A 1KTVA 3MFHA 5KG0A 4DX7A 4GC7A 5FJ4A 4RBUA 3KMQA 3OTBA 4ILRA 3PEHA 4YQWA 4DS5A 3CF5Q 3LP0A 4WFNQ 4CM2A 1UCNA 2F1FA 3AJ1A 1DQ8A 3SQGB 5M2RA 2V9KA 1VDHA 3HSDA 3G82B 1RTIA 4MTPA 2UUAJ 1U6BA 3MCOA 2V4RA 1KOOA 4HDHA 1TUGB 1FJEB 1NH8A 4ZVRB 5K8OA 1S4FA 4N8OA 3E01B 1PO6A 3ZNUA 1W26A 4FP9A 1NK8A 2W1BA 3U1MA 4P6QA 1NM2A 5IT9Y 1X7VA 3PV8A 1QAYA 3H5UA 2CQPA 1D9AA 3M9MB 2ZNZA 1X8DA 2BE9B 4DV1F 4XAKA 3EUNA 4WFXA 2AJ2A 2MJUA 1HMVA 2DPJA 3UD4P 5KFCA 4AL7A 4C8OA 3H20A 2VASA 2OEKA 4TVAB 2JJ4D 4F4KA 5F9NA 3MR3A 1N0VC 3GYNA 2C3YA 2NQPA 2J0XA 2XYGB 1SH0A 1L3TA 2MY7A 2QL5B 2UXDJ 5J2MA 3FUYA 4GO7X 4NMLA 4Y0FA 1T03A 2EVZA 2DH8A 4NA2A 2W8LA 1LWEB 2B7CB 4CLYA 1K0TA 2HKEA 2G0IA 2CPYA 3GPAA 4QPTA 4LF9F 4IH7A 2WTFA 3DMJB 4D3HA 1JLGB 1NPRA 1RK8A 3IM9A 3RAXA 2HQFA 3Q8RB 4RUAA 1XR5A 4M94A 1TV6B 2HHPA 2VPWB 1QDUB 3TAMB 3H7HB 1J5EF 3CEDA 1UTAA 3L09A 1BQXA 3OSPA 2BUNA 4J9RA 3UD3P 3OTCA 3BSCA 1QM9A 3LP0B 4NYOA 2FIUA 4X4NA 2ZHBA 4JI1F 2OJ3A 2H51B 4K50A 4IYQA 2HG4A 2DR5A 3R7NB 4RZRA 1I6JA 1MWQA 5F3TA 2GHVC 1PYTA 2KN4A 2YKAA 2FTRA 4J9OA 1T3OA 2AJ4A 3W2VA 4PG5A 1S49A 4JI2F 1FVQA 1RABB 1Y11A 1FD2A 3W2WA 1GX6A 5E3PA 3TA1A 1S9GA 4FBUA 3Q2SC 5KG2A 2QL9B 2K2PA 1N0UA 4EBEA 2V34A 2KKHA 3IAM9 3DOMB 3FCHA 4G3IA 2GA7A 1H74A 5HN0A 1RTDA 5KFAA 3UDVA 1N8RT 2XNQA 3BSNA 1M90T 1TTHB 5T7LA 2QE5A 2B7BB 4UF4A 4IOCQ 3VTIA 3KG0A 3I0RA 4DFPA 3FGVA 4U8VA 1HMVB 3JS9A 4P72A 2E5LJ 4OX7A 5A8KA 2DGWA 5ETQA 4LFAJ 5J2QA 3P3DA 4BHQA 1TELA 4L76A 3TZYA 2H3EB 5KFIA 4K4TA 4XDCA 2AWZA 3T6BA 2RUSA 1H98A 5C7PA 2AW0A 4B3TF 1P1TA 3JTOA 2BXJA 2H1YA 1FDNA 3TUIC 2G2OA 2OEMA 2HRTA 4B02A 3D6MB 2R7RA 2DHXA 5DS7A 1H2UX 3ENWA 2X3DA 3FMBA 3KK3A 5J2MB 1IM6A 4K4SA 1T03B 1B0PA 2VD3A 3TWZA 1WUUA 2YQ0A 2MQ8A 2F8MA 2MYFA 3SBMA 4DSLA 4WKYA 4AT1B 1F5BA 3ZZZA 4FXWA 2PI4A 3B54A 1IKYA 1FKAF 2GMHA 2WVCA 2VA2A 3CWJA 1RT4B 2DO0A 3OTOF 2XO6A 1IKVB 2QA2A 2KVQE 4ZPAA 2IC3A 5B0GA 2POKA 4RBVA 4DN9A 5KFNA 4DR7F 4A46A 3HCXA 4KO0A 2DHSA 2JX2A 3MGJA 2QO3A 2RQ4A 5FLXY 2BKNA 5EX0A 3CPWR 2B4PA 2DIVA 3VQSA 1EHWA 4CT8A 3T19A 2VF3A 2IMOA 3HFVA 2CZ4A 1VK3A 3QQCD 3M8RA 3D2WA 1ZS6A 2I2YA 5H1SV 1N4LA 3US5A 4RW9B 2ZITA 4LVNP 1VBYA 4LBHA 1YIJS 4UZBA 4DDFA 3FK4A 1VJWA 3CC7S 3TARA 5HBMA 5DDQC 3HZEA 2HRUA 1FE0A 4CO0A 2XLIA 1S9GB 4LT6A 3PO4A 4TU9A 1JLAA 3NL0A 5E3CA 2BM0A 1RTDB 2NXNA 5ETNA 2BJ9A 1QY7A 3BSAA 1VOMA 1P9QC 1UA1A 1WHYA 2WSCC 5T7LB 5I3QA 4IFYB 3FFIA 4WYLA 2ATCB 3I4HX 2ZOFA 3BQ0A 2CJQA 2F9JA 1Y00A 4UQTA 2WRMA 3QIPA 3I0RB 4ZP7A 1M5KC 5F8JA 3DLGB 4MH8A 2FY1A 4GKJF 1HI1A 4HACB 3NCRA 2VQFJ 4AXIA 3MCMA 1NJIT 1RHUB 1IBMJ 2FJWA 2YKPA 3SCIE 4RNOA 3K5NA 2GMLA 2NCKL 4LFBJ 4LREA 4WFAQ 3IGNA 4U9RA 3N6LA 3PFEA 1VHFA 2YH0A 4USHA 2MQQA 1UPPA 4DL4A 3KK3B 2D3O1 4EO8A 3UN5A 5I3UB 3CUNA 1PJ6A 3PFOA 1LKZA 1ZBTA 2N7CA 2HFVA 3AY0A 5B0EA 2K8GA 5IC4B 4LVOP 4K5RA 3RGIA 5HMWA 2UU9F 4WP9A 4JV2A 3ZO7A 5JMNA 4J37A 1WC1A 4WCEQ 2CJKA 5KG5A 4KO0B 2IRYA 5LMUF 4ZJOA 4RPFA 4JI0F 3TA0A 1W7WA 1JLQA 4HYKA 2CPHA 2DEJA 3DLBA 1S9EA 3D3BJ 5GAGI 5C42A 5ITHA 3FBEA 1BMQB 3TAPA 3EJMA 3C14A 2R8KA 2VG5A 2AYGA 1F3VA 3GQCA 1S6QB 4LRDA 5KFEA 5KT7A 3MZIA 5F9LA 3W8PA 3CXCR 2OPSA 5JVHQ 4LR7A 2KT2A 2AHOB 3U1LA 1IQZA 1JLBB 2XSJA 3KHHA 1QE1B 3KLVA 1VBZA 1WKLA 4ZP8A 2KL8A 2B5JB 1VLYA 2O3DA 1YI2S 4CQ1A 5KFXA 4OZ1A 3VAKA 4MIWA 3FFIB 3FRZA 3OW2R 4TY9A 1CBKA 5ADZA 1WOOA 1IKWA 4A8OA 1R31A 2BE7D 2IHR1 3OUYA 1TKTA 2K1RA 2EW9A 5IT9U 2F4VF 1MLAA 1Q82T 5I42A 4DG1B 4JI8J 3RW6A 4CYUA 3E8OA 4IH5A 4E98A 3OJUA 2G2YA 1NMEB 1YZ6A 2QG9B 3JSYA 1X60A 3CDEA 4H4KA 5J1EB 2KHCA 1U1PA 1OJ4A 1EARA 4NCAA 2BE2B 2WBMA 2ZBIA 2VQEF 1XMOJ 4P74A 4MKVA 2VONA 4QIEA 3T1AA 4USTA 3T5JA 2CJ9A 4WWSA 1BY9A 4AL6A 4W98A 4M8LA 4NWBA 3NXZA 3MPWA 4C0BA 1N5TA 2LECA 2V8VA 2HFZA 3P49B 1YGYA 2WW8A 2CQ0A 4DV3F 2WBRA 2VU5A 2RRAA 1CVJA 3B4MA 2PA8D 1MROA 1HNIA 2K3IA 3CVKA 3KMSA 4O3PA 1E6YB 2FHMA 4Q45A 4EBCA 2JOQA 4DWIA 2VFVA 4WP8A 5GMDA 2HAIA 4FXVA 2RMLA 3TJ9A 3TZZA 3A4TA 1RQ0A 2ALZA 2QSFA 2VL1A 3QWPA 4I0WA 3V81A 1JLQB 1KWMA 2FJDB 5E3QA 4V19X 1NKBA 1N36J 2ZH2A 3FQLA 1CJTB 3LAKA 3DI6A 2E1RA 3UDEA 1Y5LB 3GJRB 2IDLA 4E2FB 3SSRA 4FPIA 1FTCA 4EUVA 4X4RA 4NXMJ 1S6PA 1U02A 4NASA 2HWTA 1YSJA 1U2RA 5HP1A 1U1NA 1RWKB 2OFGX 4C3LA 5ETLA 2DR7A 1R0CB 1VIOA 1PJ5A 3A3PB 1S7HA 2A3JA 1RHRB 4RWWA 2UU9J 2J0QD 1RT6A 4ZJQA 2HVEA 2XSJB 3MM9A 5D15A 2FLLA 2HBQB 1FA0A 1WHXA 1N34F 3LF0A 3UE2A 4EO6A 4LMZA 4JOUA 5IOLA 1LW0A 4GO5X 4ED6A 5DLGA 3K5LA 4EBDA 4KBIA 2GW8A 4KV8B 2BDPA 1JX4A 2V9WA 2BM1A 2EK1A 1JLCA 4YMEA 1IKWB 4F3OA 1LXJA 4NA3A 3NS5A 2KYZA 3B78A 2CQ4A 2O1PA 1UWAA 1SIWB 4NLQA 4ZPDA 3R9LA 3OUYB 2CRLA 2MQNA 4TYBA 2RVJA 3Q8UA 3PRBA 3PRDA 2DRAA 4Y2AA 4CYUB 1N48A 4WP3A 2XG8A 3AOAA 5KFVA 1T7PA 1V3SA 4C48A 2GGPA 3MECA 5GMEA 1DQAA 3UCGA 1EKRA 4UTGA 3AA8A 3DRSA 4OV6A 3AH6A 1KNZA 3UDCA 4FS1A 2WHOA 2V6AA 2QYCA 4QIWD 2ZJRQ 2Z0GA 5U47A 1X5OA 2UUTA 3BB5A 2L9NA 4X4VA 1QAXA 3S1TA 4AFFA 3A8JA 2YTCA 2H4YB 1MROB 2DYAA 1U25A 5HQLA 4OHVA 3TEHB 2LQBA 1RLDA 5KTQA 2R7TA 4M5LA 2GAGC 3MHYA 4JYAF 3MMCB 3T5HA 2FGCA 1OYEA 1NSKL 5DQHA 3V81B 4RBTA 4EEYA 1VC5A 3QNWB 3ENVA 2F5GA 4JUZA 2HHWA 1ICEB 5FLXU 1FXDA 5BR8F 3QFHA 2A6MA 4P7TA 3TQEA 4DCJB 2DGVA 5L38A 3Q8SB 2W9BA 3V6HA 1S79A 1SKSA 5HP1B 3BGUA 3H2VE 2F63A 2XS5A 2HHXA 4RJVA 3JQJA 5C25B 3EZ5A 1RA6A 1F2HA 2NR0A 1K9MT 2AEJA 5LMNJ 1RT6B 2RB7A 5MLCV 3RBXA 1KBRA 2ILZA 3MAHA 2XI2A 4F0MA 1J5OA 1LW0B 1BWEA 5K20B 3I5CA 4I2PA 3TX8A 3KLHA 1HR0J 1MN9A 2NS1B 4EU0A 1U0HB 1A7GE 4DSEA 2C2ZB 1XIQA 2QC3A 4ENOA 2VKRA 1CJVA 1I5OB 3UPFA 3PKMA 2YKNA 4DCOB 4B9VA 1UZDA 2X1AA 3HM9A 2W7OA 2WVBA 3G6ES 4WK1A 1QSSA 1X9WA 1RT1A 4DLEA 2EXUA 4Y6IA 2HGLA 2LEAA 4ED2A 4RX6A 4JI4F 2YNFA 1NPKA 2X1GA 1S5ZA 3NGTA 4KJIA 4OZ0A 2YY3A 3DRSB 1RHKB 1REVB 1RKJA 1VQOS 4NLSA 3UWTA 3QJPA 3V2UC 3LW5C 4H54A 3TQ1A 2DITA 4NLVA 3HHKA 4KTQA 4CO4A 4ED0A 2ASYA 3QFWA 2FHKA 3F56A 1NSQA 5ETTA 5A6WA 4DPTA 2CPEA 3AOBA 3ET6A 4ZKAA 4MT1A 2J7KA 4RLEA 4QYZK 1APSA 3LWLA 2HHHJ 3IR5B 1B64A 5HO4A 1UVKA 3PR5B 1ZM9A 1GH8A 2AMCB 2GZOA 4A48A 4H4OA 2V0NA 2V8PA 4MK8A 1EJ7L 5GADU 1LW2A 3QLHA 2G4BA 5L1KA 2MB0B 1WOSA 1WTBA 5F8IA 1GMWD 3S01A 5KFSA 1KHVA 3KOAA 4ZPBA 3POTB 3BGOP 4UY85 1BQMA 3HSZA 2HLTA 2M8HA 4I4BA 3MM6A 2FUG9 3U1NA 1RT3A 2IVYA 2QYGA 2KM8B 4ZPCA 1G6BA 5KFLA 3W3SA 1T9VA 3EVMA 4U7UK 1CJKB 2C2RA 2EFVA 2OTJS 3HVRA 5ETVA 1J5OB 4YDXA 4RW6A 2ZH9A 4JI7F 4JYAJ 2W24A 5E0OA 2EFOA 2HHSA 4KFBA 4M5KA 4DUZF 2RU9A 4C8ZA 4BS2A 2H5EA 4TU8A 4CM0A 3BR9A 2BMBA 2PGCA 2YWHA 4ETXA 3AQOA 1S1WA 1H38A 4DR3F 3LAMA 1CJVB 1HYSA 5K9FA 2YKNB 2VICA 4C11B 4OJ1A 1R3NA 2VODA 2RF2A 1YVFA 2AP6A 2H5IB 5LXYA 5T14A 3FNNA 3W7BA 1NSPA 3KXDA 1IBLF 2XZDB 4ZCKA 5ETSA 4ICLA 2E1AA 1RT1B 2YKMB 4NLUA 1VK8A 2KYXA 2IM2A 5CABA 3X3UA 4DF8A 2B51A 4B3OA 2XZTB 4DR4F 5D77A 3K57A 1Q7LB 4AXJA 1HW9A 2P8IA 3VVUA 4CIOA 3AJDA 4M5DA 2GVDA 3PJXA 1X4FA 3NOCA 4I67A 2JDJA 1B70B 4K5SA 4YY3J 2UVUA 3CDWA 4AD6A 3GG1A 4RW8A 1U1MA 4O4GB 1RT5A 4R5PA 2IFXA 3Q89A 3Q83A 3KNAA 3UD5A 4USWA 3H59A 2A0FB 3JAMY 2MGZA 2DD8S 3ET6B 1YBTA 5HLFA 3NGRA 1RCXB 2Y0SD 5B08A 4ELUA 2CAJA 3PXGa 1IJEB 1NDPA 4X65J 2AJ0A 2HVIA 2JRSA 3UCUP 1HNWF 3TI0A 4H4OB 3GLJA 1VQNS 4TY8A 5ETOA 3AT1B 4Q2LA 1R0AB 1PILA 1SIZA 2OUGA 2CPIA 1AA1B 3FJ2A 3HKZD 3AHPA 1RWOB 1SKRA 2XWXA 3R5AA 1Y5IB 1NRKA 2P6TA 1BQMB 1WG4A 3CCVS 2EBGA 2JL9A 3A8KA 1RT3B 1F9HA 3GFYA 2DNHA 5L9NA 2XMTA 4PQAA 2LA6A 4OZNA 3HT0A 4N76A 2ZDPA 1CJUA 1FX2A 4DL2A 1FJ7A 3OHBA 5HL7Q 3HKWA 1N33J 5CYQB 4DI6A 2KXNB 1X4GA 4LQ3A 4W90B 2OPPB 4USVA 2CQ3A 4KFBB 1PSDA 2J0SD 5ETKA 1HQEA 2GJIA 2V8DA 1YDLA 1AZSB 1PYOB 1KONA 1S1WB 2Z8QA 4HI2A 3CE8A 1NCLA 2XEXA 1IWGA 1WF2A 1HYSB 1DHMA 2RF2B 3MEDA 3DDIA 3NLCA 4EYIB 4NYPA 1HKAA 1KOHA 2C2NA 4ICLB 1U48A 2BANA 2WW4A 4TU7A 4K4VA 2MZSA 4ECTA
chains in the Genus database with same CATH topology
3ZFVA 2RD5C 3CO9A 3K58A 1FD8A 5A2QY 4PQUA 1UVLA 3KWMA 2YX7A 3H2UB 2B9YA 3M6VA 4TKTA 3QO9B 3R1HA 3RAQA 1EP4B 1ZH5A 3CC2S 1RTJA 2B56A 3H4BA 2Z4PA 4ATNA 4DFKA 2HYIB 2WONA 2VKZG 2MKJA 2OSQA 3CTRA 4WE1A 5IS2A 2HMIA 4I2QA 3IR7B 2X1FA 2EC0A 2O01C 1VQPS 1NK6A 1FRJA 2R7OA 3SDEB 2J6UA 2ABYA 1XN9A 2B6AA 2KFYA 1F9FA 5A0YA 2NUHA 4LUBA 1U8SA 1LFPA 1R8BA 2IYGA 4HH0A 5KFGA 2QEXS 4HTIA 1S0VA 1JLFB 3T3FA 1UWBA 5FDLB 5A8RA 3RTVA 5IM0A 4X4SA 4CZCA 1X4DA 4ZDNA 2BZ2A 4NL5A 3I96A 2IAJA 5GAEU 4JV0A 2X51A 3POTA 3DRYA 1KSPA 2DNKA 1UP1A 3CT9A 2YVSA 4IG3B 1LK5A 1N6QB 4N8NA 2EFGA 2EFNA 4LQ9A 2Z2MA 4K2XA 4CH7A 4X4QA 1UFLA 5J2NB 2DB1A 3M6UA 2MSSA 4DFJA 3C46A 5D4LA 3CD7A 4MIAA 4IR1A 2KH9A 2N7YA 1JLGA 2N4DA 4TLRA 4BC7A 2MQPA 2JFDA 3MM7B 2QMXA 2P6SA 4KT0C 4YDDB 4FYDA 3DHWC 2MKHA 2BRLA 4YOEA 2KT5A 5KT4A 3VAHA 5A8KB 3KLFA 4PWUA 5J2QB 1WF0A 4WF9Q 2PFFB 3CD5A 3N4WA 4DMZA 4WU3A 1K1SA 2ACYA 1KTVA 2IYIA 3MFHA 1TR0A 1XERA 1W25A 4XIUA 2RE1A 1X9SA 5KG0A 4B17A 1HARA 4ID8A 3PIOQ 4GC7A 5FJ4A 4Q0BA 1S72S 3BGLA 1JXLA 4RBUA 4A8MP 1HPZA 3F41A 3KMQA 1B0TA 2D9PA 3OTBA 4ILRA 4KKOB 3PEHA 4TYAA 4YQWA 1QVGR 3CJKB 2M9KA 4DS5A 3CF5Q 2E5GA 2HHTA 2ZE2B 4OJ3A 3LP0A 4EWTA 4FPRA 4H4MB 4WFNQ 3HZGA 4YY3F 2F1FA 3KK2A 3AJ1A 3H2LA 3M2UB 1V6HA 3GB0A 4OHZA 1DQ8A 3SQGB 4PKDB 3N28A 2XNRA 1U6FA 3R3TA 2KHDA 2CPXA 5CXTA 5EUHA 4ZVFA 2Y1JA 3TP2A 1O5JA 3DRRA 3GSDA 3HF5A 2KM8C 4NA1A 5M2RA 3M2RB 1X4EA 2V9KA 3DU6A 4OZLA 3QIDA 4FS2A 4C11A 1T02A 3LP2A 2KB2A 3THTA 4YHHF 4ZP9A 5F8HA 2ASLA 4FXDA 5BJRA 4KSEB 3NNHA 1HBNA 2CPJA 2FGOA 1X5TA 2DNNA 2EFQA 1JK9B 1RTIA 1CG2A 2IJNA 2DCUB 2R2TA 4MTPA 1XNQF 2KVIA 4C8NA 2VG6A 1U6BA 2G0CA 2V4RA 4M95A 2LDYA 1GT8A 1IKYB 4F26A 5KFBA 3Q0AA 1KOOA 2YKMA 4HDHA 2VG7A 4IR9A 5B09A 3OXGA 1FJEB 4X65F 1NH8A 2P5VA 4HLBA 5K8OA 1FKPA 3NG8A 2L48A 2IC3B 3WX4A 2IMWP 2E7WA 4EZ6A 1S4FA 5CQGA 4HVZA 1ZAVA 4N8OA 3S7RA 3M8PA 2E5IA 3E01B 4R0JA 1PO6A 1ZPWX 4C4WA 4FP9A 1NK8A 3CJ2A 1HFEL 1G7CB 2L9DA 1S0OA 4EZ9A 3CDAA 3U1MA 3CDUA 3O6QA 4L6V3 5JXSA 4CO5A 4P6QA 2V4QA 2R2SA 3NP5A 4ECRA 5DDPC 4A8FA 3KHGA 5IT9Y 1X7VA 2VFRA 3PV8A 2DNPA 5FD1A 1QAYA 2W7PA 3RBEA 2ERRA 4IOAQ 3G4SS 2QT7A 2MZTA 4DL6A 3H5UA 2GQCA 3KK1B 5LSLA 1RISA 3MR2A 3NNCA 2GHWA 1HQEB 2CQPA 3HHLC 3O5TB 1D9AA 3M9MB 2ZNZA 4OV1A 1X8DA 5AE2A 2JLFA 4O4GA 3OV7A 4LF4F 2KRRA 1U1QA 4DV1F 4XAKA 3EUNA 4WFXA 4GMKA 1HWJA 4N5SA 5DQIA 1NNDA 2MJUA 1HMVA 2DPJA 4QPXA 3UD4P 1VQMS 1SL0A 1UEVA 5KFCA 1KVIA 4AL7A 4C8OA 3H20A 4O3RA 2UP1A 2NREA 2VASA 3MEDB 3M9OB 1VQSA 2C28A 2IM0A 5HBMB 4GKKF 2FHJD 3KLGA 2AGQA 2JJ4D 1TQLA 2ZD1A 3GMGA 3QYYA 2ZH4A 4KHMA 4YB7A 1N52B 3G86A 2PC6A 5F9NA 4F4KA 3MR3A 5DG9A 1N33F 5KFMA 3VAMA 1N0VC 3I87A 5J2PA 4RU9A 1KR4A 1S1XA 3GYNA 3K5PA 2C3YA 3MR5A 3VZHA 4XPEA 3SI8A 4K59A 2NQPA 5M2UA 4J9MA 2R2UA 1AXQA 1Z2LA 2U2FA 3MFIA 3DN9A 1X4BA 3KG1A 3LALA 4NLWA 1JWWA 2LQ9A 2OLWA 2J0XA 2R7VA 1JLAB 1SV5A 4OI3A 1YJVA 1U2FA 1M5SA 1RTJB 4XPCA 4C0HA 5HMZA 2WONB 5D4NA 4B9NA 1SH0A 1Y4ZB 1L3TA 2VPYB 2MY7A 2NSCA 5CCLA 3HK2A 1R0AA 4Q2MA 2A2CA 3B82A 5J2MA 4GO7X 4ECUA 4B9LA 4NMLA 2F8EX 3LANA 2XSFA 4Y0FA 1T03A 5DDRC 3T1HF 3PNIA 2KZZA 2EVZA 2CQGA 2DGSA 2Z2LA 5IM0B 1DQ9A 1QLNA 1NK7A 2WB4A 3MMBB 2DH8A 4NA2A 1YG0A 2W8LA 1LWEB 2B7CB 1K0TA 2BJDA 2DGOA 4MMOA 2XMVA 2DH7A 2ATLA 2CPYA 4C8KA 1MMLA 2VOOA 2LMIA 4BWMA 1DTTA 4E8UA 3HLUA 4NPOA 2JVRA 2DNLA 2FLPA 2YNHA 3QIPB 4QPTA 3HJFA 3ZZTA 4LF9F 1LQ9A 4IH7A 2WTFA 3DMJB 3QWUA 3CB4A 4D3HA 4CTAA 4QJVA 5LT5A 2R7QA 1JLGB 4DL3A 1N56A 5DQGA 3DLHA 4CO2A 4B9MA 4JI5F 1RK8A 3IA0A 3VAFA 3UR0A 2GO8A 1DBDA 4LF6F 5E3RA 2HGMA 3B8HA 3RAXA 2D74B 5F0UA 3OL8A 4X4PA 2AGOA 3VQTA 4FF2A 2R7UA 1TP7A 5KFDA 4QBUA 3DHXA 2F9DA 1MU2B 3Q8RB 4RUAA 3GG0A 4RW7A 2YWFA 1XR5A 4M94A 1SC6A 1WWHA 3NMRA 1HHTP 1TV6B 2HHPA 2VPWB 3FRYA 3V6DA 3MWBA 1XR6A 1S9FA 3DDKA 4NZ0A 3TAMB 3PX4A 2FPHX 1HPZB 5CYQA 1FRHA 4QWBA 1J5EF 1IM4A 3CEDA 3DU5A 2CJAA 4DN0A 3CD6S 2VV5A 2LDIA 3L09A 2OIHA 1BQXA 2CFXA 4QYRA 3OSPA 3FMWA 2BUNA 4J9RA 1FK9A 2OPPA 1CC8A 3UD3P 3OTCA 3BSCA 1QM9A 4CNYA 2RRNA 1LWFB 2XZWA 3DGPA 1TL4A 2VB6A 3LP0B 4LSNB 5IXUA 4NYOA 2DR9A 2FIUA 1VQLS 4X4NA 2MHEA 5DO2A 2ZHBA 1NB7A 4JI1F 2OJ3A 3C6UA 5IQ6A 4K50A 4IYQA 2HG4A 4BBYA 1CSJA 3G8SA 4J9PA 2DR5A 3QGGA 5E33A 3UR3C 4IRDA 1WNEA 4HI1A 5I3PA 2ZHAA 3DRRB 1JKHA 4RZRA 2VC0A 1I6JA 4DUYF 5F3TA 4A8SA 2DNYA 2GHVC 3I5AA 1F5CA 4HT5A 2KN4A 2YKAA 1P1LA 4A8XA 3FEXB 3HHLB 2FTRA 3LP2B 4QW8A 4ZHRB 4J9OA 1T3OA 2KI2A 2KJWA 3MEGA 2AJ4A 3W2VA 4PG5A 1S49A 2QA1A 4KAIA 4JI2F 2RQMA 2EKYA 3IC1A 1FVQA 3CCRS 4YR3A 1FD2A 2VG6B 3W2WA 1GX6A 5MAOA 3MPYA 4IUFA 4C8YA 5E3PA 5HI7A 3BGRA 3FVYA 4UUXA 4IRCA 2I9SA 2AF6A 2Q1LA 3RB6A 3TA1A 2RRBA 1S9GA 2VG7B 1WEZA 1XMBA 5KT2A 1SJ4P 2CPZA 4B9TA 3Q2SC 4FBUA 5KG2A 2XHWA 2CQ2A 2MZJA 2HNDA 1FKPB