2DGTA

Solution structure of the second rna binding domain in rna-binding protein 30
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
GSSGSSGKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 30
publication title Solution structure of the second RNA binding domain in RNA-binding protein 30
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dgtA01
2LEAA 4F02A 3B4DA 1DRZA 2VOPA 2B0GA 3OW2R 3UWTA 2DISA 4YB1P 2ZJRQ 5CXTA 2G0CA 3CXCR 1WHVA 2DGXA 5IQQA 2L41A 1VBXA 2MKJA 2MQPA 1YWXA 3VAIA 3VAMA 4TU8A 5LJ3Y 2RRAA 3U1LA 1U1LA 4LJMA 2RS8A 1K9MT 2N3OA 1M5OC 2J0QD 2CQCA 3CCJS 1VQ7S 1UP1A 1K73T 1P27B 2MGZA 3EX7B 2DNNA 3CPWR 2D3OR 2AD9A 2FC9A 1VQ6S 2K8GA 2FY1A 2KN4A 2MZRA 3CCSS 2FPHX 3TYTA 2KG1A 2AYBA 2J76E 2OTLS 2UP1A 1UFWA 3PIOQ 3J7ZT 1YITS 2N7CA 1X4FA 4BS2A 2MXYA 1YHQS 3S6EA 3S8SA 3VAFA 3B4MA 1VQ5S 1A9NB 2LKZA 1X4CA 2L9WA 1YTYA 1SXLA 1IQTA 2DB1A 2MSTA 2XS5A 2AYGA 2NLWA 2D9PA 1X4AA 2DNRA 2XNQA 4YOEA 4QU7A 5LJ5Y 3P6YC 2MQOA 1QVGR 2MMYA 2CQ1A 3CMES 3UE2A 2DIVA 2RS2A 2DHAA 4QQBA 2DNGA 2F3JA 4F25A 1KD1T 1JJ2R 2NZ4A 1KOOA 2JVOA 3CC2S 2HGNA 1P1TA 5BJRA 2KFYA 3MURP 2XB2D 3ULHA 2ERRA 2KM8B 1X5OA 3ZZYA 1WF2A 2HYIB 1SJ3P 2OJ3A 5JVHQ 5D78A 1X0FA 3EGNA 2DGOA 2CPFA 2MKCA 2G1DA 4WFNQ 3VAKA 2RQ4A 2RUGA 2CQDA 1VQ4S 4IUFA 3K0JA 3NNHA 1ZZNA 3VAJA 1FXLA 4F26A 1WG5A 3Q2TC 1Q7YT 5HL7Q 1JJ4A 3I55S 3CD6S 2QFJA 4Z2XA 4IO9Q 2X1FA 1O0PA 2DGSA 2N3LA 2DIUA 2DNYA 1WEZA 5DDPC 2EVZA 5LSOA 2CQPA 3P3DA 3TP2A 2J8AA 2DNZA 3VAHA 3HHNB 3SXLA 1M5PC 1U1KA 1X4EA 2YWKA 3EGZA 3IWNC 3VALA 1VQLS 5DM7Q 1DZ5A 1JMTA 2OTJS 1OWXA 2KRRA 1WG4A 3Q2SC 3MUVP 1D8ZA 2E5IA 1VC6A 3CF5Q 2JRSA 2MKSA 3UCZP 5GAEU 3VAGA 2MY8A 2QA4S 2M8DB 1URNA 1M5VC 3CTRA 1XN9A 1DHMA 1N88A 2U2FA 3SDEA 1U1QA 3G96A 2MZTA 3VF0B 3FEYB 2MYFA 1G2EA 1M5KC 4A8XA 4U67Q 2V94A 3DLLQ 2MZSA 2M0GB 1S79A 2DNPA 5LXRA 2JX2A 2KXFA 2E44A 1CVJA 3S7RA 1JJHA 1SJQA 4TLQA 3MUTP 2DHXA 1U1OA 4OZ0A 3CCQS 4ZKAA 1VC0A 4EGLA 3CCVS 1QVFR 1Q82T 2DITA 1YJ9S 5DETA 2I2YA 2WBRA 2O3DA 2XS7A 2OIHA 2DH8A 2KU7A 2CQGA 1N52B 2FHOB 2MQMA 3SDEB 2BOPA 3UCGA 2MQQA 2VONA 2DNQA 4PR6A 2DGQA 4LIRA 3J7YU 4FXWA 5DDOC 3UD3P 2ZJPQ 2M9KA 4WIIA 1OIAA 1WELA 1NJIT 2KT5A 3NS5A 2CPJA 3LPYA 5GVQA 2SXLA 2DNKA 2L08A 2AYMA 2CPIA 3UCUP 3NNCA 1WI6A 5GMKa 1F9FA 3MD1A 2MGZB 3NNAA 1A7GE 3FEXB 4C4WA 1X5PA 2LXUA 2HGMA 4ED5A 1KOHA 1H2VZ 1WWHA 2CQ0A 4YUDA 1X4DA 2JWNA 5CA5A 1RK8A 2DGVA 1VC5A 1HA1A 3R1LA 2HZCA 1FT8A 1WEYA 2MZ1A 3I56S 3BO3A 1AUDA 4WCEQ 2MHNA 2D9OA 2M7SA 3CCUS 1WHXA 1VQPS 1H6KX 2M70A 1FHTA 2DGTA 1HD1A 1FJ7A 1WHYA 3CCES 2LA4A 2LA6A 3G6ES 2ZJQQ 3CMAS 2CPYA 2JVRA 1VQKS 1VQOS 2KM8C 1WEXA 2KHCA 2QEXS 3L3CA 2M52A 1L3KA 3G8SA 1WF1A 2M88A 1M90T 3MXHP 2HVZA 2MSSA 2J0SD 1OPIA 3P49B 1VQ9S 3H2VE 1WTBA 1ZH5A 2VOOA 2YH0A 2F9DA 1Q86T 2GO9A 4CH1A 4M5DB 1X4BA 2CQHA 2E5HA 3UD4P 1U6BA 1S72S 2RT3A 2BZ2A 4ERDA 3CULA 1X4GA 2CQ4A 1HD0A 1U1NA 4PKDB 2MPUA 2KH9A 2CQIA 5GAGU 1VBYA 3IRWP 1FJEB 2RQCA 2MY7A 3R1HA 3CUNA 1DBDA 2N82B 2OSQA 2KRBA 2ADBA 2KXHA 4TU7A 2RU3A 3SMZA 2LQ5A 2KXNB 4UQTA 2M4MA 4QU6A 1VQNS 2XNRA 3NMRA 2PEHA 3U1MA 5DDQC 1PO6A 1X4HA 2X1AA 1YJWS 5DDRC 4CQ1A 2MB0B 1QM9A 3N9UC 3PIPQ 3BO2A 3CC4S 4QPTA 2ADCA 4WF9Q 4UY8T 3THPA 3G4SS 1WF0A 2M8HA 5IFMA 2MJNA 2RVJA 2EK1A 1B7FA 3D2WA 2YKAA 1SJ4P 2EK6A 1SJFA 5FJ4A 2E5JA 2I38A 1WHWA 2DNHA 3H2UB 2CQBA 1YJNS 5DM6Q 4Y0FA 2CQ3A 1H2UX 2RNEA 3LQVA 3MDFA 2DGWA 2DH9A 3V4MA 1X5TA 2CPDA 2OSRA 2DNOA 2YTCA 2DGUA 5IM0A 1Q81T 2MKHA 2MZQA 1VQ8S 5CYJA 4IOAQ 3THTA 3MI7X 2M2BA 5EN1A 2CPZA 1KQSR 2DNMA 4PRFA 3CCLS 1FO1A 3BEGB 1U1RA 1NO8A 4CIOA 1N54B 1UAWA 3BO4A 4CH0S 1U1PA 3CCRS 2DO0A 2GHPA 1N8RT 1PGZA 5D77A 4V19X 3G8TA 1X5SA 2X1GA 5GADU 5HO4A 5H1SV 4LMZA 1YI2S 3NS6A 3P5TL 1HL6A 1OO0B 2F9JA 3R27A 2LECA 4W92B 2MQLA 1WI8A 1SJRA 3DXBA 4RU2A 3MOJB 2DK2A 2MQNA 4IOCQ 2DHSA 3BS9A 1VQMS 2CPEA 5LXYA 2CQ2A 3MD3A 1UW4A 1U2FA 2X1BA 5IM0B 1W2BR 2U1AA 2LYVA 1FNXH 4Y00A 2MJUA 4TU9A 3ZZZA 1NU4A 2MZJA 2XSFA 3US5A 2DHGA 2LMIA 2YH1A 2DO4A 5ITHA 2KYXA 3HI9A 4WFBQ 1M1KT 2CJKA 2CPHA 2HGLA 4FXVA 4J5OA 4OZ1A 2MKIA 2Q79A 4P6QA 2DNLA 1H2TZ 2A3JA 3RW7A 2MKKA 2PE8A 2DH7A 3S01A 5GAHU 1WG1A 2FC8A 1KC8T 5LSLA 2KVIA 1D9AA 2RRBA 4WFAQ 2VODA 1YIJS 2KI2A 2KG0A 4C0OC 2K3KA 1R8PA 2LXIA 2LCWA 3MUMP 2E5GA 2XS2A 5JVGQ 1VBZA 3JB9k 3G71S 1BY9A 1R8HA 2CPXA 2G4BA 3CC7S 3RW6A 2AYEA 1K8AT 3CCMS 4C7QA 1ZZFA 3G9CA 4W90B 1U6FA 1U1MA 1RKJA 5MLCV 3TO8A 4WKRA 1FJCA 2LEBA
chains in the Genus database with same CATH superfamily
3CGIA 1H7WA 5K8NA 1TR0A 4O44A 2UU9F 2O01C 2N4CA 1Q8KA 4MAKA 1JB0C 4M5IA 3TWZA 4KHPJ 2Y1LB 1NK5A 4XDCA 2YNGA 1YJRA 3CO0P 2Y1RI 3RB4A 4A4JA 3AJ2A 3DOKA 1P27B 1BE4A 1HWIA 1PYSB 2OTLS 2YBVA 3PIOQ 4C8OA 3L7PA 3VVTA 3S8SA 2LKZA 2QC3A 3ETOA 3HHLD 4HEA9 1S1UA 2AYGA 2MMYA 4MKBA 2K3IA 2PFDA 4IH6A 1B99A 3BGOP 3N4WA 2JVOA 3CC2S 5J2PB 5J2MA 4JYAJ 1SKRA 3IG1B 2CFXA 2XB2D 4U95A 4IDKA 3HSJA 4O3QA 1SJ3P 5KFXA 3TX8A 1RTJA 3GCWP 4FKXA 1F2HA 3EGNA 1AA1B 3MM7A 1WC1A 2AQ4A 5K14A 3K0JA 3VAJA 4IG3B 1QUPA 4RW6A 4PPZA 3LUYA 4WU3A 1Y11A 2RDJA 2YXLA 4BCAA 4NZ0A 3QGHA 5A6PA 4ECSA 5GMDA 8AT1B 2O66A 2F4FA 4LRFA 4P71A 1VQLS 5KFTA 4LQ9A 4LBPA 3IA0A 3VZIA 1QLNA 3NBPA 1VK3A 5EHHA 2E9TA 4G1QA 1DTQB 1NAQA 3J7Z5 2MYFA 3RYLA 4DLGA 2EG1A 1JLCA 4PXEA 4OZJA 3MPVA 4HACA 4DCOB 4WKYA 4YS2A 4Q2LA 4ZCKA 1KP6A 4XTTA 3H40A 4CLZA 3AH6A 5AXMA 2O5DA 3LP2B 3NMAA 3DLBA 3BQ0A 3CCWA 2VONA 2H51B 1I5OB 4WIIA 5GVQA 2HHXA 1RAAB 3UCUP 2HIQA 4DL5A 1RU1A 1IN0A 1FKPA 4ZCMA 3MM6B 4DR5F 5JMNA 3HZGA 2KJWA 1H2VZ 1SC3B 2IM1A 4RNHA 3GJQB 4LREA 2B3TB 3GWCA 4DV5F 3PRDA 2EFVA 3DRPB 2M70A 3ZZOA 4H4OB 5DG9A 4OYOA 5LOQA 3UVJA 2QLFB 2JVRA 1JLEB 4HDGA 1VQKS 3M2RB 4CDIA 4LVNP 3WDOA 3IM9A 5IWAJ 2VBWA 4LBHA 2FGCA 3T1YJ 2KTQA 1S72S 2BZ2A 3ILIA 3BDEA 2KH9A 1SQEA 2BX6A 3IRWP 1YQHA 3QZ7A 4LF1A 2KRBA 4K7QA 3ITHA 4TU7A 2B56A 2BJ1A 2GMJA 2AJ1A 1F5AA 1P8GA 1RHRB 4QPTA 4A47A 1D1UA 4USUA 4ZVUB 2HS3A 1WDTA 1JLAB 1NRKA 3I6PA 3NWRA 4QR2A 3VWSA 2DEIA 5LL6d 1VQ8S 2XYHB 5SZTA 1PAEX 4ZP8A 2DNMA 1R7IA 3VHQA 4DPXA 1F3VA 4TY8B 2RQMA 2NXJA 1C0UA 3CCRS 3LF0A 1URRA 4LR9A 3GJRB 4R8UB 1PIEA 4ANCA 3FQKA 4LSNA 3M7VA 1C1CB 5D4PA 2WZ1A 3FRYA 2C2OB 2LMIA 3GG0A 2CJKA 1RT4B 4DUZF 2Q79A 2G2ZA 2MKKA 5HAOA 5E3QA 2D69A 1SCJB 3AJDA 2KG0A 2LXIA 3Q8SB 4ES3A 2ZD1A 4DFJA 4RW8A 2YQ3A 4RNNA 3PEHA 3UWTA 2W1BA 3V6DA 1DJ0A 1VOMA 1MROB 1U25A 2FVPA 4AE5A 2VG5B 4DFKA 3DNCA 3K5MA 1S5ZA 1F60B 4JV1A 2H65B 1VQ7S 3EZ5A 2JJ4D 4GO5X 2NSBA 1B0VA 2D3ZA 5F41A 3O2IA 1RT6B 3VQSA 4AL7A 3NP5A 5ADZA 2MLYA 2FJVA 3S6EA 1CJVB 1A9NB 1FRLA 4Q7AA 2ZH6A 3IC1A 1XJWB 4YOEA 1SV5A 4X65J 3UE2A 2DIVA 3CJ5A 5FIIA 1ZS6A 2DRAA 2BM1A 1FWKA 5HVGA 3HP6A 1I1GA 2UVUA 2GGPA 2AGQA 1EAYC 2LQ8A 2V34A 3H5YA 3NWGA 4DZ6A 4R5PA 2RUGA 5AXKA 1TUVA 3F41A 2FQQB 4K2XA 5IT4A 5HL7Q 3I55S 2UXCF 4O4GB 3IBFB 3D28A 2DGSA 1XIQA 4WFXA 2G2YA 4ZPDA 1IKYA 2DNZA 4NL5A 4XIUA 2Z57B 3DXSX 2HMIA 3RJMB 1UTAA 4N8NA 2RU9A 2E5IA 2D41A 3I5CA 4LT6A 1FRIA 1N32J 2YNFA 2H48B 4ZHRB 1UL3A 4M5JA 4DSEA 3FEYB 2HZVA 2B4UA 6FDRA 1YLXA 1OMSA 1TL7B 2E9RX 3KUHA 2YKPA 1OSDA 2QMUB 4OFZA 1M0SA 2E44A 4X84A 1U47A 2VD3A 4ZA1A 5A8WB 2CNOB 2FYXA 5CHCB 1IJEB 1F3FA 4RU9A 4ZVHA 1KWMA 2FD2A 5C24A 1YJ9S 3IN5A 3MR5A 2MQQA 3QLHA 1FNOA 1F9HA 4B3TJ 4NX9A 2BW7A 3OJUA 4EUVA 2EW9A 3OSPA 3DI6A 3R7BB 3V4IB 2JEGA 3BYPA 3GTYX 4K4SA 3W65A 1FESA 5LMUF 4I2PA 3I56S 3V81B 3A8KA 3U27A 1WC3A 3M9NB 5KG3A 2DGTA 3A8EA 1RT1A 2X51A 1V6HA 1B70B 3AD8C 2OI2A 1TELA 4PG5A 3POTA 1RZMA 3CMAS 4DV2J 2YVSA 4PYDA 5DGBA 3UNGC 3QT6A 3TNVA 2M52A 5CZXA 4PZVA 2XWYA 4QW8A 1NPKA 1JXLA 2NXEA 4O3PA 2BE7D 5D4NA 4L73A 1S6UA 2V5HG 4XPCA 3M1VB 5DG8A 3HHKA 5ETSA 4LSLB 4IH7A 2HNYB 3ADAC 4QWBA 3X1LB 1VBYA 4C8ZA 2B4OA 2Z30B 1S6OA 1MMDA 2AGPA 3K5NA 3R1HA 2MEWA 4DL6A 5GAHI 2RF2A 3PHTA 2ZHAA 2VBYA 2VUGA 4DCJB 1Q78A 2AJ2A 2LQ5A 3VGTA 1YRUA 4GVLA 3TJAA 3NCQA 3IBWA 3U1MA 4CQ1A 1BC6A 2W9BA 4CO5A 1WF0A 1GNKA 2M8HA 2WB1D 1RAIB 2W4DA 5J2QA 1H72C 2E66A 3H2UB 1MN7A 4U8YA 1WSVA 2UVVA 4CCHA 3DLGA 1ZAWA 2DGUA 2C3PA 2MZQA 1S77D 3GMGA 2R2UA 1IUJA 4FYWB 4QIWD 4DHVA 4RNFA 5IS2A 4LMZA 4EMDA 3P5TL 1LWXA 2BKPA 3HFVA 3J7YI 1Y5LB 4KGZB 4DR1F 5C2GA 1UW4A 1HKAA 3HVWA 5CABA 1U26A 2DT9A 1K1SA 2YQ1A 1HNWF 3TQEA 4KTQA 3BKTA 4FF4A 3QQCD 1C4CA 3QGGA 2ASJA 1TL3B 4PG8A 4OZ1A 2CNNB 2LFVA 4TYBA 1S59A 4C0BA 3RW7A 1HHSA 1TAUA 2KVIA 2KI2A 4WJBA 1SH3A 2HFSA 2KHDA 3G71S 2C1EB 3MEGB 3D1OA 3CCMS 2J5AA 1R0BG 4OX9F 3V6KA 3HHLC 1S0NA 3B4DA 1T05A 4CLSA 1H0HB 5L39A 2YWEA 2HHHF 1FRKA 5ETQA 2PGCA 1FFSB 1E6YA 3JQMA 3NEKA 2ZBPA 3MCNA 2RS8A 1U8SA 1JQGA 2DNNA 4RJVA 2XO6A 4ES1A 2HHWA 2HBRB 3QJPA 3CCSS 4YEAA 4UW2A 2HNZA 3BGRB 1BQNA 4CYUA 1PCAA 1X4FA 3JSMA 1Z2LA 4OYMA 2XWXA 3QATA 1EIYB 4XDDA 5LJ5Y 1T9TA 2MQOA 2DYAA 1NK8A 4QQBA 2Z4PA 3I5BA 4WZQA 3DOKB 3ULHA 3ZC4A 1U2CA 1WF2A 1RTDA 4M5LA 1PJ5A 2Z2LA 1X0FA 1JXEA 3UNYA 5DQGA 2NR0A 2WSEC 1JJ4A 1S1UB 4OHZA 1IM4A 2QA4G 4KY3A 3H0PA 4K0KF 1VRQC 1OWXA 4FPIA 2AW0A 4F4XA 1TL1A 4YHHJ 5JUMA 4X62F 3JS9A 3VAGA 3PVXA 3MM7B 4ECRA 5K14B 4RW6B 2RKIA 4I6AA 5HI7A 3CMQA 3ZZPA 2BRLA 4J9VA 2FVRA 3SQOP 4DR1J 4EO8A 1XMOF 1VLOA 1ZAVA 4C2MA 2R3VA 2C2DA 2X7IA 1JJHA 1SJQA 3KKFA 4TLQA 4WK3A 1NHUA 2HVHA 5D4OA 3CCQS 4CO4A 3IR6B 4LRAA 2JEIA 3CCVS 3NBPB 4TKTA 4G1QB 5KT6A 3M9OB 4OZ2A 4M1KA 2HLUA 2MQMA 4OJHA 4K4ZA 1K0VA 1QE1A 5DDOC 1FJGF 2ZJPQ 2HFUA 1JLCB 1NJIT 4J9RA 4DR2F 4HACB 4OJ3A 1LOUA 5A8KA 2LDIA 3OUYB 3CJ0A 3HM9A 2Y8YA 5GMKa 3JSRA 3IP0A 4NCGA 2ZBRA 3DN9A 4P2SA 4QWDA 4O4RA 3EVMA 2HHHJ 1PC5A 2DGVA 2YPZA 2BRKA 2HZCA 1FT8A 1RT5A 1WHXA 2OPPA 2CNKB 1TK0A 2BABA 1WHYA 4QYZJ 4DI6A 2HHUA 2CPYA 3HSGA 4GRSA 2K2PA 4EI2A 4DV4F 3I82A 1FKPB 1FRMA 4LRBA 5A2QY 2HQGA 1B4SA 1Q4RA 4A8QA 5KFOA 4UOGA 3DHXA 1OPIA 5LT5A 2ASYA 4ED2A 1R0CB 4KE5A 1EZZB 2UUAF 1TVRA 3TVYA 1MG7A 4IR1A 1NMEB 2NZCA 2ZUAA 3MZIA 3NL0A 1Y3KA 3D66A 3KMSA 2BQRA 4C3MA 4OYXA 3BV8A 3KFWX 1XK8A 1IXKA 5L46A 3ZTQA 1HIYA 3PO5A 3ZTOA 1O5JA 2R4FA 2ZEJA 3OVBA 2CQ3A 4DUTA 1K0TA 3FDSA 5KG2A 5DS7A 4ILLA 2RRNA 4DV7F 2MKHA 3LP0A 3BZQA 3I32A 2MLXA 4ZVQB 2DJWA 1HI0P 1NJWA 4EU0A 3QYYA 5ETOA 1RT2B 3OHAA 1U1PA 1DQ9A 1RTHA 3IFEA 1TV6A 3IWLA 4ZP9A 4TQSA 2DHSA 3GE9A 3TQ1A 4PPDA 3R7NB 2VHGA 1WOPA 4QZVB 4N76A 2W4CA 3ZZZA 4J9PA 4TN2A 5ITHA 2YKNA 1RE1B 2HGLA 3ELHA 3GFHA 2DH7A 4F0KA 1P1LA 5GAHU 1O8BA 2BMBA 4LFCF 4LSNB 1ACMB 3TA0A 4DR2J 5T14A 3C66A 3G2XA 2BEFA 2UXDJ 2A1BA 5BR8F 4XPEA 3MM8A 1IBLF 1ZZFA 5I3PA 1NHVA 4RNMA 3I4HX 1N4LA 3CJ4A 3OW2R 2VOPA 2DR7A 2OPRA 4YB1P 1FVSA 3M8PA 1N56A 4ZS6A 1VBXA 1YX2A 3AAWB 1S0MA 4ED7A 4KGXB 2FUG9 4TU8A 3KJVA 3R7SB 4LJMA 5GAGI 1OS5A 2EFGA 1YJ7A 4OI2A 4A8OA 2B6AA 3CPWR 5CD4H 2AGOA 2G2OA 2JLFA 2B8QA 1GEHA 2UP1A 3OXGA 3MR2A 4J7CA 4DR3J 2A18A 2YQ0A 3W2VB 4PQAA 5JXSA 1HQEA 4Y2AA 1HBNB 3PZPA 3AOBA 1YTYA 4DR7J 5HMYA 2D9PA 1LWEB 1X4AA 1RGVA 4IQMA 1ZM2A 4O3RA 4JI4F 2X3DA 2IAJB 1BD6A 2W2OP 3UR3C 1N5TA 2Y1IA 5CAAA 4CZCA 3PR5B 3ZZYA 2BQUA 3EDQB 4FF3A 1CJTA 2YWFA 3CW2C 3NOCA 4CRJA 2RQKA 3DM2A 1EJ7L 1G4CA 2QLBB 3N28A 1HHTP 3T9NA 3KK1A 1WG5A 2R8KA 4IO9Q 4FS1A 2JEJA 4LF4J 2DPIA 1SV5B 5DDPC 1RHJB 4N56A 3TP2A 4P2MA 3H7HB 4NXNF 4CM2A 1OY9A 3CNQP 3L7UA 2HAIA 4JI5F 3LP1A 3IR5B 5M2UA 2DD8S 4DQSA 1VC6A 1JWWA 4PXBA 4R5PB 2IJFA 3SDEA 4J9LA 4ZPWR 3R5JB 3VF0B 1XMQF 4DV0F 1N34F 3JTOA 3BF4A 3OPKA 3CJKA 3V2UC 1IKYB 2GJFA 3LTOA 1SL0A 3CCZA 1S79A 1DFDA 3CDWA 2JX2A 4DEZA 2GIFA 3EWGA 5D0HA 3GR1A 2OFGX 5BYRA 1F9EB 1X8DA 4L72B 2JC1A 5HMZA 2YNFB 4DL4A 5CCMA 3CJQA 5EUHA 2DH8A 1FDDA 2E1PA 2ASDA 2LU1A 1N5YA 2YWHA 2B5JA 3KDOA 4L74A 3UO0A 3HT3A 4WYWA 3R2CJ 4O3NA 5ETTA 1NKEA 4B9VA 1ZM3A 1DLOA 5KFMA 2HBYB 1WI6A 1IBLJ 1XBWA 1F9FA 3F0NA 1SC4B 4P9SA 4C4WA 1RTIA 4CM0A 3SV3A 2JWNA 5C24B 2QA2A 5FDLA 1WEYA 1VI7A 4WCEQ 3QLHB 2D9OA 2QN6B 4RWXA 1BWEA 2XY6A 4OZ5A 4LF6F 3MM5A 4P2XA 3DRSA 2LA6A 3FBEA 1HWUA 1P9YA 2YKMA 1FKOA 4ECXA 2PMWA 4EO6A 4K4VA 5CZVA 2W2NP 4FBTA 2JFKA 1NPPA 4DV6F 1I3OB 4LFAF 1VQYA 2VF3A 1KVKA 3KUGA 1MMNA 4DPOA 3Q8QB 3MM9A 3E01A 2R8IA 1S48A 3UDLA 4JI4J 4I68A 3QWPA 2VC0A 1FF2A 1V3ZA 4ZK7M 1LFPA 3M2UA 1VQNS 4X4VA 1TFYA 4O0NA 2F63A 4OLPA 3CJTA 1UEUA 4FP9A 1TKXA 3KHLA 4FYVB 4I1TA 4RR5A 5DM6Q 2RNEA 3LQVA 3R5DA 4Z7CA 2RF2B 2DNOA 4OHVA 2NS1B 3TRGA 1Y00A 1RDRA 4UF4A 5KG6A 3BEGB 4PUOB 2W9BB 5EDWA 2EFPA 4PG4A 4Y28C 2GA7A 2Z2ZA 1WI8A 3QIPA 4V1Ak 1VQMS 4HL9A 3W3SA 1IM6A 1U2FA 5HP1A 4WFZA 3NCPA 4ZP6A 2ALYB 5ETNA 2FHJD 2OO4A 2PIIA 1IBCB 2DHGA 2W2MP 2WAQD 3FSIA 1HMVA 1DQ8A 2HHSA 1KFSA 1HBOA 5BYQA 2OEMA 2L3MA 1FTRA 4OYPA 2A3JA 4ZVFA 3S01A 1LXJA 2ZH9A 3KG4A 3AOAA 4J9QA 1SUQA 1IBMF 5JVGQ 4NZ7A 1G1XA 1BHNA 4F0MA 4NLTA 4JI8F 2VDIA 3IM8A 1V5VA 1RHUB 1WHVA 1AFIA 4ECWA 3QRQA 5I42B 3C6TB 2MQPA 4NLOA 1FX2A 2BYCA 4JI0F 4PCQA 3W63A 4X4UA 3J7AN 2D74B 3W66A 1D9DA 2A2DA 2B43A 5B08A 3R3TA 1U45A 4ED4A 1YITS 3L95X 1YHQS 3B4MA 1T05B 2L9WA 3D1QA 3UN2A 1CS4A 1E6YB 1RAEB 1JJ2R 5DQIA 1VGYA 4OV6A 3TUIC 5T7LA 2ZE2A 3GB0A 4K4XA 1DTTB 4DQQA 1N36J 2FJAB 4NCAA 1BQNB 4CYUB 1NEEA 2FVQA 4U7CA 3JSMB 2E9ZA 1XQIA 2AMCB 4ZDNA 4BC7A 3CD6S 1F2GA 2V67A 5B09A 3IS9B 2F8MA 4IFYA 3KLHB 1TMMA 2XSJA 3HD1A 2YWKA 2B9YA 4M5MA 5J1NA 2OKQA 3CTRA 4RL1A 1C0TB 2YX4A 4NLUA 4XO0A 1GK8A 2LXFA 1FI4A 2V2KA 4PWDA 4K5RA 2BBEA 3FBFA 2MZSA 2M0GB 2V0NA 4DSIA 2VA3A 2GMLA 4U8VA 4LIWA 4FYDA 2HRYA 1U24A 1HNVB 3PACA 2OIHA 2BOPA 1FWPA 2H5JB 3T41A 2M9KA 3I87A 4ECYA 4LF8J 3HHDA 4LFBJ 2KT5A 4ETZA 3M6WA 2LP4A 4QR1A 4JI3F 3PW5A 4YDDB 4E8UA 5EGYA 2P9EA 4P52A 1X4DA 1U0SA 4M5DA 5KFRA 4IG0B 5F8HA 4KPCA 2IHR1 1QTMA 3JYTA 2F40A 3DU6A 3UQSA 1TKTA 1IQZA 4NLXA 1U4BA 1GMWA 4KO0B 5A8KB 3PW2A 2KM8C 4PQUB 3HHLB 2E1AA 3OVAA 4OJGA 1HBUB 4A8KA 4ALZA 4LF7F 2HWTA 2VOOA 1MWQA 3D5MA 3RBDA 1X9SA 1RT5B 3FQLA 2OPPB 1FXRA 4WBFA 2MLZA 4Z7YA 1CQMA 4AYBD 1S7IA 2NYHA 2E1RA 4F4AA 5EX3A 1AW0A 1S4FA 4NYOA 3NMRA 1QTNB 3DC2A 3SQGA 3ENWA 2EK1A 4NMLA 2J8SA 1TVRB 3BGUA 4IO1A 4OX6A 3IG1A 1B0PA 3G6XA 3DRYA 3N6LA 1X5TA 5KFLA 5IM0A 3W5ZA 2FLNA 3H98A 3K7RA 5I3QA 4IG3A 1OJ4A 2YNIB 3GU0A 2OEJA 1NO8A 1RACB 1N8RT 1U7LA 1MW7A 1GMWD 3VGVA 3R5GA 4FNIA 3J81Y 5IT9U 4B9UA 4K59A 3M8QB 2DR5A 1MU2A 4RU2A 2K1RA 1XEZA 2BR0A 3GIKA 3LP0B 3A4TA 2CPHA 1NCLA 4J5OA 3CSKA 3K89A 4I6WA 3O8WA 5KFBA 2FC8A 1RTHB 4B3OA 3N0VA 5F8MA 4KJIA 1TV6B 5KT5A 3HJVA 4L75A 4CLYA 2VQFJ 1LK7A 2IDEA 3DLHA 1X9MA 3OFFA 4J91A 4F02A 3C6UA 2EI5A 3JSYA 2UUCJ 2HEKA 3SSSA 2WB4A 3EZOA 4DLEA 3HHEA 1N0VC 1H7XA 1SIZA 2EFOA 3VZHA 1NDPA 4RW9A 3MM6A 1UP1A 4KPYA 1KRPA 3CJ2A 3EX7B 2VPYB 1U48A 3PCOB 3QGIA 3L4BC 1R6YA 2FJEB 4I4BA 2MXYA 4RW4B 9RUBA 2EG2A 1RA6A 2OPRB 1SXLA 3FEZA 4H4OA 5A0YA 3M8PB 5B0BA 3OR2A 3PTWA 1B0TA 1W7WA 4B3MJ 3TAQA 4ICLB 5BJRA 3Q8VA 2PT0A 5C42A 3TAMB 4GKKJ 3SSRA 2B6AB 2MDAA 2ATLA 2HBQB 2WSFC 2YWWA 1JNRB 1VISA 3TZZA 3I5AA 2C3UA 4Q8EA 1Y4ZB 1FXLA 1F5BA 4X2BA 2W2PP 3TAPA 3PJ9A 2HQDA 1WOOA 3OFEA 4C8YA 2X3GA 4LBIA 2I0XA 5ETVA 5HQ8A 2J8AA 1HNIA 2ZH1A 3NRBA 4YB5A 4RNOA 4I0WA 1JLGB 1UWAA 4JV5F 1HBMA 3CF5Q 1LWFA 5GAEU 3DM2B 2QA4S 3T5JA 1GT8A 4FPRA 2A0FB 2KVQE 4C8NA 2WW8A 1JLAA 2KZZA 4ELVA 3DLLQ 1RWWB 2DNPA 1KR4A 4X64F 2ZC3A 3KOAA 3LGHA 4JI1J 3NY0A 4TY8A 1Q95G 4OZ0A 5LM7E 3WIUA 2DITA 1JK9B 1RT7A 2C2RA 3SDEB 3A3PB 2QLJB 1C1CA 1WC0A 3T19A 2DNKA 1CLFA 4M5KA 1IKWB 2D3UA 1XWLA 1RB0A 1GH8A 2YX1A 4F36A 3KHGA 1X5PA 2XMAA 3G86A 1X9WA 1RK8A 1SB6A 5AT1B 3JQJA 1AUDA 1N5YB 4ZLLA 3L09A 2B5JB 3RTVA 1LK5A 1TK8A 3K17A 1Q8LA 2P2CB 3PY8A 1M1HA 1NK7A 3BSNA 2KHCA 4DBQA 1SI9A 5E3RA 4M94A 2DRDA 4WK1A 1RTIB 3P4UB 1MROA 1UVMA 2W8KA 3GYNA 5E33A 2KT2A 3BB5A 5A8RB 1AROP 2JDJA 1RWNB 1KLNA 2AKWB 3UD4P 4ERDA 2H5IB 3C15B 5HSPA 3M2VB 4USVA 1X0PA 5HMWA 5CYQA 1UFKA 5AE2A 3MM5B 1T9VA 3DRSB 3BM7A 3GV7B 2YKMB 2XLIA 4GKJF 2KXNB 3OL6A 1OY8A 4UUWA 2ZH7A 4QU6A 5F8NA 2FZCB 2QZ8A 3CC4S 2QV6A 4CTAA 1QSYA 3E01B 5F8JA 2C42A 4DX5A 1ZA2B 3W2WB 3HX9A 1BMQB 1FFGB 2NSCA 2QGFB 4RUCA 1U09A 4DV3F 5C25B 3HVAA 5CYMB 2ACYA 2CWKA 5KFAA 3M2UB 1UA1A 3GIJA 1UKUA 1MMLA 2V8VA 4F4KA 2ZHOA 5M2RA 4DZDA 3OL7A 1ZTTA 3MCMA 1TKXB 2HRUA 4ZPTR 3KK2B 2F1FA 4ZPBA 2HHPA 4X64J 5DRKA 1EQ0A 1W2BR 2LYVA 1FEHA 4Y00A 4ZIVA 3OV7A 3ISND 2HHQA 1KSPA 1UJ4A 3GPAA 2YNHA 2V8DA 2LDYA 2V9KA 5HMXA 1TL7A 4P6QA 5IOLA 1H2TZ 1HNZF 2G0IA 2PE8A 4MFBB 7FDRA 1R8PA 1N5SA 3MUMP 5A8WA 3Q8YA 1FRXA 3EXYA 3BQ2A 1PKUA 3RW6A 2AYEA 2AWZA 2IFXA 2PDAA 4HI2A 4J37A 2V9WA 3HZEA 1HMVB 2EWHA 1HBOB 3KXDA 2GHWA 4M5HA 1S1VA 4DR6F 3VR1A 1NDKA 2F4VJ 5KFVA 3U1LA 3B6BA 1U02A 4HHUA 3TA1A 2JH3A 1KBRA 3OSNA 3V4IA 3A13A 1SUQB 3T6BA 2AYBA 1LW2A 4LF9J 2RILA 1S99A 3KJQB 1RLDA 5ETLA 3GONA 4UOFA 2ASLA 1Y5NB 2DNRA 3RBXA 4CI0B 4B3SF 2RS2A 2DNGA 2VPWB 4B9LA 2ERRA 2BE9B 2OELA 4GKJJ 2B4VA 2CPFA 2E7WA 2QTWA 5F3TA 2Q66A 4LSLA 4KRWA 3Q2TC 1C1BA 3EYZA 2VICA 4H54A 1AXQA 4FZVA 1RT3A 2X1FA 2ZVIA 1CS4B 1WEZA 1GAOA 2Q1LA 4K4TA 5D4LA 4Y2MA 3WC0A 5J1PA 3DDIA 5T7LB 2ZE2B 2KRRA 1O51A 3L9ZA 3MAAB 3MEEA 2V69A 3WBZA 1VDHA 1K1QA 2M8DB 1TMJA 3FCVA 3P96A 4G1PA 2W7OA 1YSJA 1XN9A 3GIMA 4KH1B 1Q8IA 3H42A 3AB2B 4QBUA 2XMJA 4TNOA 3KLEB 2RSQA 2FHKA 3Q24A 4IFYB 1S7HA 4QCLA 2V94A 4A46A 2XSJB 3A8JA 3RG6A 3DCAA 1U1OA 3EE3A 4ZKAA 4F4YA 3G6YA 1Q82T 1BXNA 5KFDA 2GHVC 4U96A 3UCGA 1HNZJ 1R89A 5HLFB 1PBAA 1NJZA 3QNWB 5HVHA 1N6QA 1FVQA 3W64A 3LO3A 4DV1J 4QYRA 3IMQJ 1Y9OA 4DDFA 3NNCA 5KG5A 4WXOA 1A7GE 5E0OA 3EM1A 5C2CA 5CA5A 1FCAA 4NMXA 3FCHA 2M7SA 2WVCA 1TTHB 5KG7A 3K58A 4FNHA 2WK4A 3MEGA 2GVDB 1YZ7A 1TFWA 1JXVA 1TL5A 4M95A 2OPSB 4ITSA 4C8MA 1HQ2A 4HHJA 4U7UK 1WF1A 5K5MA 2MSSA 3M6UA 2B9WA 4IYQA 2G0JA 4M5DB 1X4BA 2KJVA 4FVMA 9ATCB 4B3SJ 1G3OA 1OQ3A 4KSEB 3SCIE 1YG0A 3JYTB 3UDVA 2HSEB 1TKTB 4DPUA 4USIA 2OSQA 1L5UA 3OFHA 2QE5A 2B8PA 2FVSA 2V4RA 4FXDA 3NAIA 4OYZA 3PIPQ 3D3CJ 2DXDA 5KG1A 2VJUA 1KQGB 2HWHA 3UW1A 4F3MA 4WF9Q 4Q5VA 4UY8T 3G4SS 2RVJA 1Y3JA 3ILLA 1SJFA 2B7BB 4UOHA 5AXLA 3IR7B 2WW4A 3D6FB 2CQBA 2YX7A 4Y0FA 2ILYA 1GXTA 4KHMA 3MDFA 5ETRA 1FXDA 2MTLA 3BKFA 1XC9A 4YR0A 1SVDA 4PRFA 1GTHA 3SEOA 1R8BA 4W98A 1N54B 3SQGB 3S1TA 4ZCIA 2GHPA 4V19X 1S9EB 3HD2A 3RR7A 2IMWP 1HL6A 4MIWA 1EKSA 2PI4A 3DLKA 4OHXA 3MOZA 3NGRA 5I4MA 2CPEA 1YGYA 4C6AA 1LFWA 2CQ2A 4YP3A 5IM0B 1RYRA 3RAXA 3GJTB 2BJDA 1XNRF 4AD6A 2XMKA 2KDOA 2DTJA 3I0SB 4A8MP 3QT5A 2PSZA 4WP8A 2CA9A 1UZDA 2ZM6F 1MU2B 1OYEA 2K1RB 3B54A 2CPXA 4OMFG 2M5YA 1U6FA 2AF6A 4YMEA 3C19A 2J7WA 4X66F 5KFYA 1DRZA 1CQNA 1R8AA 4YR2A 4WU2A 2WOMB 1HWJA 1RWPB 2L41A 5GMEA 3VAMA 1KVIA 4B08A 4B9TA 4B3OB 3OUYA 2Y9HA 1WC4A 2AZ1A 2H1YA 2D3OR 3OTOJ 3MPDA 3TJ8A 1S1TA 2V2QA 2FY1A 5LMNJ 2FY8A 2IA0A 3OXFA 3R8YA 5HANA 2HFNA 2R2SA 5KT7A 1UJ5A 4NA3A 3OTDA 3C6UB 4DR4J 4K4YA 3DU5A 1T9WA 2V2VA 1QVGR 5KFEA 2DCUB 1S6PA 1VFJA 4ECTA 5E3PA 4IRKA 4IOBA 1BWVA 4RW9B 3D54A 5K20B 4GC7A 4H4MB 2KM8B 2CZ4A 2PN6A 4MH8A 4OZNA 1T95A 1CEZA 2UU9J 4JOUA 4RO0A 4WP3A 2VG6B 1G6BA 3ZFVA 4DUYF 3LPEA 4CO0A 4F26A 5RUBA 1MNEA 4TQRA 1EQMA 3MEDA 4EBEA 1KVJA 2RHQB 1O0PA 5A0YB 5L1KA 7AT1B 2N3LA 4O23A 3JTNA 4P73A 2WHOA 5LSOA 3PW0A 3OR2B 1RAJA 1LWCA 1UJ6A 1Q8BA 5BXIA 4IR9A 3LWLA 5C42B 3Q2SC 3GV5B 1S0OA 4YY3F 2OPQA 3FGVA 1S6QA 2CJBA 5G0RA 2UXBF 5F0UA 4DL2A 3K5LA 4K4UA 3PM9A 2KT3A 1CJUA 4DF4A 2CAJA 4U67Q 1HNIB 1BUXA 2V4JB 4AFFA 1RT2A 1XTZA 1RAFB 2IRYA 5G4DA 1HBMB 3CCTA 3Q8RB 4NXMF 1LWFB 4NASA 3GYGA 4A48A 3Q23A 4LQ3A 5B0GA 2VFRA 1XNRJ 2KU7A 4X4TA 2FHMA 2CDQA 4OI4A 4LIRA 4FXWA 5L38A 2AJFE 4UZCA 3LPYA 4C0HA 2L08A 2C2NA 2AYMA 2IRXA 3GR0A 5HROA 2ZBQA 4WPAA 2ROPA 2ZVSA 3NGSA 3SI8A 3THVA 1R27B 2ZNYA 2GMHA 2UV8G 4RBTA 4KIAA 1RT7B 4ID5A 2A10A 3QAEA 1VCTA 3FZBA 2EKYA 4CT9A 4ED0A 3LW5C 1LEOA 4RBVA 2ZJQQ 2QFIA 3HLUA 2HS0A 5EX0A 3ENQA 3MXHP 2JZ5A 4BHQA 3C14B 5U47A 1JKHA 3H2VE 5H9FK 3EUNA 1U6BA 1OQ6A 2ACMA 3CULA 4DS5A 3EMTA 2HRTA 2EKNA 2QL9B 1N0UA 4Q45A 1EETA 2IM2A 3RRKA 3PRVA 2RQCA 2GO8A 2MY7A 3M30A 4ETXA 4DR5J 3SZ2A 1KTVA 2KXHA 3T1HF 3W2VA 2QX0A 3SMZA 1HBNA 1GMVA 3HPOA 3VVUA 2PEHA 4DV5J 1LWEA 5DDQC 2X1AA 1QM9A 4MYTA 3THPA 3PFEA 4DCPB 2IAJA 3MF5A 2IVFB 3G87A 2XLJA 4DN9A 5CYQB 2AHOB 4J9SA 3PKMA 1SKWA 4HHHA 3WX8A 3PJWA 4ECQA 4L3KA 1RHKB 4OQJA 1UAWA 5HBMB 5IT0A 4CTAB 4KGVB 1OO0B 1FE0A 2V8GA 3R27A 4W92B 2E7XA 3FMBA 2APOA 1T03B 2A2CA 1H73A 5LXYA 1V3RA 1CC8A 2JL9A 3MMCB 1PJ6A 1AZSA 1T0TV 4YQWA 3UN5A 4A8WA 3W62A 2MZJA 1RLCL 3NKYA 1KFDA 2H9ZA 4Y3CA 2EPIA 5ETPA 2ZH3A 4X4PA 2YWGA 2VODA 2RRBA 4WFAQ 3QIDA 2O67A 3BBCA 2ZDOA 1FD2A 1NUEA 1U1MA 4WKRA 2CJQA 3AODA 3G8QA 2LEAA 4JI2F 3PXGa 2WCXA 2YNHB 2B0GA 5I3UA 5ETKA 1C2PA 2I6WA 2AZ3A 5L1LA 3TZWA 4ED3A 2H5EA 1AYEA 4LRCA 2KB2A 2CQCA 1ZOTA 4PXCA 3G82B 2H3EB 3PYGA 4QPXA 2J76E 5D3GB 1J27A 3FK4A 4DUZJ 1J5EF 1TU0B 3NAHA 2JNJA 4AXIA 2QLXA 5HJXA 1VHFA 3IXQA 3CJ8A 1K44A 2NYIA 4ZJQA 2RD5C 4P74A 1S1VB 4OX7A 2DRBA 3BKUA 2HLTA 1ICEB 1HNXF 1OY6A 3HVTA 2HK3A 5DQHA 3T5LA 2B4PA 1LW2B 3GCXP 4HH0A 1VQ4S 2RUSA 1VK8A 2W01A 1KHWA 1TKZA 3GG1A 5A76A 3DLJA 1UVIA 2M3DA 4YFUA 3CIMA 3UD5A 4JV2A 3SXLA 3EGZA 3EGWB 5HVFA 1Q5VA 1GX5A 3J80U 4CNYA 3DFEA 2HNDA 4OYWA 4B3RF 1HR0F 2K7KA 2E7VA 2WONA 3GP9A 4ZVOB 1C1BB 2MZTA 5D8HB 4MTPA 1RT3B 4PYAA 1YZ6A 3CB4A 3CIZA 3FVYA 2P9GA 5D0GA 2XZDB 3I4PA 4A8XA 1Q1KA 1RP5A 3DMJA 4B9SA 1E6VB 2HZAA 2RMLA 3S7RA 1CVJA 4DSKA 3MEEB 3VCDA 3KTQA 4PUOA 1PC4A 1JLFA 4JBCA 3FSYA 1VC0A 4EGLA 2UXCJ 1D09B 2WBRA 4DX8H 1RABB 1N33F 2DNQA 4PR6A 1WELA 4CLWA 5KFJA 2SXLA 1L3SA 1V5IB 4ZMMA 5L1IA 3EVWA 3I96A 3KDNA 5E7OB 4JI2J 1NKBA 2GCFA 3MMJA 3CWJA 4NA2A 2OGUA 4HTIA 2C22A 4N41A 4A8YA 3GSDA 2GV1A 2GFFA 3TZYA 3RB6A 1H6KX 1KQFB 1V9OA 2DBBA 1N6QB 4ANDA 3RR8A 2QYCA 3AT1B 1WD6A 3M32A 1WC6A 1WEXA 2NXUA 2FLPA 3IGVA 1OYDA 3UFCX 3BH7B 4EK2A 5AJ3F 1J5EJ 2M88A 3KG1A 2HVZA 4WTOB 5I42A 3C6TA 5IV4A 4CLUA 1RBOB 2I9SA 4RX6A 1Y0HA 2XGPA 2Y8WA 3BGFA 3V5RA 1X4GA 4B9MA 3JQKA 3SBMA 2IBKA 1PAUB 3DGVA 2N82B 1ITPA 1D8YA 1FDAA 1D3WA 4E2FB 4AL5A 2ZFHA 4KHRA 3Q86A 5LMUJ 3RAMA 3MPWA 3MFHA 5C5JA 1FERA 5FJ4A 4AQYF 3QFWA 2ZWOA 1YJNS 1DTTA 2N7YA 2V6AA 1T9XA 2DH9A 3V4MA 2OSRA 1VQSA 1WOSA 1Q81T 3ILJA 3THTA 3W7BA 3SV4A 5KTQA 4OV1A 3IS9A 3I0RA 1PGZA 3KLHA 4UQGA 5GADU 4C48A 4QW9A 3N6MA 1VJWA 3O5TB 3M8WA 3FFIB 4I7FA 2FGOA 1QAJA 1YRXA 4ELTA 1GTEA 2WVEA 3RZAA 1OSCA 4NLDA 5KFWA 1C0TA 2HQIA 2Z0GA 3NCRA 3QPIA 1JX4A 2MKIA 4F7VA 1RAHB 4ZP7A 1AFJA 4WYLA 3D0HE 3TUJC 5LSLA 1D9AA 1YIJS 3DLKB 3CDAA 1ZBTA 3GIIA 4USJC 5KT2A 3T5HA 3MR3A 2R7XA 4FDFA 3DRRB 3CC7S 4Q8FA 1HNVA 4ZN3A 4JYAF 4C7QA 4KFBB 2JFDA 1YKWA 5CXTA 3GIRA 2XQCA 1U2RA 3RB3A 1K9MT 1TL4A 1FEEA 4B17A 3H25A 1HNWJ 2Y0BB 1VRTA 2FC9A 1VQ6S 2CVIA 2IM0A 3RBEA 3OHBA 4JP8A 1UFWA 3M6VA 5AJ3J 2N7CA 1R3NA 3M05A 3OD2A 4IG0A 3C2PA 3VAFA 1X4CA 1A6LA 2MSTA 3OTBA 2XS5A 4LR7A 3HK2A 3PRBA 2G13A 4QU7A 2XMMA 1HPZB 4KO0A 1KD1T 4U9RA 2NZ4A 4I56A 4PQUA 1RBLA 2IYIA 3HHLA 4OX9J 1YJTA 1HBUA 1S1TB 5IXUA 2H4YB 3SCJE 5J1EA 2RQ4A 4ED8A 2VB6A 4DN0A 4UTGA 1UMJA 3I9ZA 2XZTB 2HBZB 4IFVA 4Z2XA 1SJ1A 3BGLA 5DJBA 4DOZA 1RI7A 4EYIB 1RWOB 1VIOA 4KH0B 2CQPA 3R6LB 4KT0C 1S6PB 1S97A 1I51B 1FA0A 3CJRA 1TAQA 3D3BJ 3RBZA 1W25A 2B9XA 4K50A 5M2PA 3MUVP 4RUAA 3EZUA 2MKSA 2XG8A 2GX8A 1NDCA 1DHMA 3A1YG 3MEDB 1NK6A 2DXEA 2A6MA 4ID8A 4ED1A 1P9QC 1LWCB 4USTA 1WC5A 2R9LA 4YB7A 1Q7LB 1KQKA 1UPPA 2GQCA 3GJSB 2KXFA 4BBYA 3ZO7A 2YNIA 3MUTP 2OPQB 1S6QB 5G0RB 5IWAF 5DETA 3T1YF 1N52B 1LW0B 3M8QA 2DGQA 3KLFA 2ZKTA 1NPRA 1CJUB 3W61A 4K0KJ 1BQXA 1EP4A 4P7VA 5F0WA 5F9NA 2CPIA 2E29A 1UEVA 4DU7A 4X62J 1L3VA 3PNIA 3MD1A 2QIFA 4OZ3A 1RQ0A 2XYPB 2RB7A 2HGMA 3W9HA 4QIFA 1LXNA 3AA9A 5J2NA 1WUUA 3HMJG 1NJXA 3Q8UA 4JB8B 4UUXA 5KFSA 2MHNA 2YKOA 1ZPVA 4HT7A 1T9YA 2BV3A 1XMOJ 1HD1A 1NSQA 1FJ7A 2CWXA 3BN7A 4NLSA 5HROB 3O6QA 1Y7PA 1MWZA 1S12A 2IVYA 4CP5A 4ZJOA 3DLEA 1HWKA 3G8SA 4LF5F 2J0SD 5H9EJ 3EICA 1FJGJ 1CJKA 1LNQA 2E5HA 4OYAA 1PSDA 5HATA 5MAOA 1S1XA 1RKIA 4ID5B 2FJXA 1HD0A 4PKDB 4QIGA 2MQ8A 2L9NA 2R7WA 3CD0A 3TVKA 4DXLA 2C2ZB 3AA8A 2RE1A 3QRRA 3DOMA 4RW4A 3A12A 1SL2A 3NGKA 2C28A 5DDRC 1NH7A 1JKHB 3CEDA 4K5SA 2PI5A 3H90A 2EK6A 4ICLA 5HJYA 4X4QA 3TAMA 1EETB 3HFKA 3DYAB 3UR0A 4DV4J 3M30B 2IIHA 3W5XA 1U0HA 3M6XA 2AX1A 3SSQA 3TX0A 5EN1A 2GZOA 4R0JA 1REVA 2XI2A 1MLAA 1NK0A 1FO1A 2UUAJ 2BANA 3BO4A 1F1BB 1WACA 3KNAA 1YI2S 3NS6A 2HWIA 4RPFA 1R6VA 2BDPA 4YDXA 1SJRA 4EBCA 5JJBA 1JLGA 2DK2A 4ZPCA 5D0RA 3AQPA 1ZM4A 3D4JA 3FMWA 1YBUA 2X1BA 1B7YB 3RU0A 4IQXA 3KMQA 4F04B 3WQPA 1U6ZA 1SC6A 2W24A 4ZVTB 3HI9A 4WFBQ 4M5GA 2Z58B 1KN6A 4NI2A 3DGPB 3TZXA 4DV7J 4UY85 1CULA 4J9NA 1S10A 4X65F 1NXIA 1JNZB 4J9UE 3VV2B 4DS4A 1AZSB 1WTFA 2HW3A 2HVIA 5KFUA 1IWAA 2DISA 2CDRB 3MR6A 3CXCR 1SQGA 2MKJA 2R7RA 1NLKL 2RRAA 3PW7A 1RBAA 1IKWA 2N3OA 2NPIA 4QR0A 2F65A 1QAIA 1K73T 2AD9A 5KG4A 4LUBA 3RB0A 5KFFA 5D6GA 4LSZB 2CRLA 4LF5J 2HFVA 5AXNA 1RA7A 4QJVA 3R2DJ 4LF2A 5I3UB 3K2YA 2R2RA 4LFCJ 1N32F 4CO1A 3R6GB 2I5JB 3E3XA 3PO4A 1D9FA 2HAFA 1RJJA 1H38A 4F25A 2J0XA 5BR8J 4PXDA 4C3KA 3ILOA 4NYZA 1GFWB 2D1CA 1X5OA 2OJ3A 3C16B 5A8RA 2FJBB 3OLBA 4F2RA 1DARA 3E2EA 2CQDA 2Z56B 3C15A 2KFNA 3KHRA 3LGNA 4CO2A 3M2VA 3OR1A 2BUNA 3HSZA 4P2FA 2HPUA 3CD7A 3VAHA 8RUCA 1X4EA 4B3TF 1DZ5A 2IJRA 3HVTB 1T9UA 1NB2A 3QSIA 2Q6CA 1IVZA 2BM0A 2ROGA 1URNA 2V68A 1M5VC 3M8YA 4ECZA 3H5SA 1R31A 1SIWB 3W2WA 1TKZB 3QBCA 5HK4A 2CIMA 3LGMA 1M1GA 2COLA 3FBCA 2FLOA 1VYAA 2Z2MA 5C25A 2VJVA 5CYMA 1S9GB 3DOLB 4ZVRB 1A0OB 4EFAC 2ZWPA 2XC9A 2UUWA 4DV2F 2PMZD 2BJEA 2HNDB 3ET6B 1FK9B 2J7KA 4WE1A 2BE2B 5DGAA 3W9IA 5KOXA 3BQ1A 4Y65A 2WONB 3K5PA 1KTQA 2G9OA 3E8OA 2XHCA 3KK2A 4NXNJ 2GJ2A 4Q2MA 2C3MA 4EZ9A 4JI5J 4ZLPA 3U02A 2AT1B 4MK9A 1ELOA 3DMJB 4M5NA 2ZC4A 3H5UA 2YY3A 3C3LA 2BJ3A 2IVMA 3AJ1A 3PHEA 2MGZB 4CO3A 1UW9A 1JLFB 1HARA 1XMQJ 4DV0J 2XMWA 4A8FA 4DWIA 1N34J 4GVBB 4MKAA 4MFBA 2ZOFA 4DMZA 5AE3A 3CCUS 1NZ8A 4GC6A 4PG6A 5CQGA 1XNQF 3VTIA 1F6TA 2ZH2A 4G1IA 4AUKA 3GFZA 4IH5A 2XLKA 4TXSA 2NXNA 2P9CA 4MMOA 4Y34A 1AT1B 4RWWA 5HN0A 1M90T 3PKYA 3HFZB 5B0FA 4C98A 3BSOA 4NLWA 3SFUA 1IR1A 4ILRA 1IKXA 3EVOA 5KFCA 4U7UD 4HDHA 2VQEF 1SBRA 3M32B 2M4MA 3AQOA 3OQ2A 4DSFA 1XMBA 4E98A 4FBUA 5GAEI 2VH7A 2DR9A 1FX4A 4N77A 2MJNA 4LF6J 2IPOB 4WFYA 3CD5A 2YKAA 1W26A 4PEOA 2XYGB 4ECUA 4Y2CA 3CO9A 1M5SA 3HVRA 4DV6J 1S9FA 4LFAJ 2R8JA 3MI7X 4KKOB 4LVOP 3WX4A 4DG1A 1ZM9A 2EBGA 5KFKA 5SUHA 2AV5A 3P8BB 5A6WA 5FLXY 3G8TA 4NLPA 3PV8A 2NQPA 1QDUB 2LECA 3BBBA 3C46A 1NB7A 3QMQA 2QSWA 3MOJB 4C11A 3MAAA 1UVNA 1YDLA 4ZVPB 2C3YA 2MJUA 3GV8B 5F8LA 2BJ8A 1VBKA 3W1YC 2KYXA 1HQUA 1OPZA 3KLEA 3I0RB 2BVZA 3AD9C 5K9FA 2QYGA 4DJBA 3OTCA 3B82A 4I7FB 2LCWA 3LH2S 3C8YA 2HG4A 4L3NA 5F9LA 1S49A 2L9DA 1XR7A 2JEFA 3HXMA 2H4WB 4JV0A 1U49A 2OAUA 2VFSA 3GZ7A 2G0CA 1PJ7A 5HLFA 3O1LA 4PWWA 4ZITA 1T7PA 1XNQJ 3CE8A 5LJ3Y 4CLLA 2W25A 2XGQA 1U1LA 4TY9A 1Y5IB 2GAGC 1M5OC 1Z1ZA 4BDPA 4RW7B 3WZ0A 1Y10A 2KN4A 4X4NA 2FPHX 3ZNUA 2JLGA 4BS2A 3O44A 2MKYA 2J6UA 5KT3A 1P6TA 2W4PA 3IO1A 4YHHF 1VQ5S 3PR4A 2DB1A 3IWXA 3M9MB 3P6YC 2L48A 3AHPA 2GVDA 2KZMA 1CG2A 1SL1A 1IBMJ 4EWTA 5IT9Y 1KOOA 2OPSA 3IAM9 3MAHA 1ZPWX 1UWBB 1SQFA 4JI8J 2VQEJ 1VRTB 2UUTA 5JVHQ 2J6SA 3IGNA 6FD1A 2ROEA 3V6JA 4IRCA 2G1DA 4WFNQ 5D0EA 5IV3A 2H54B 3TUZC 1RWVB 3Q89A 1Q7YT 3N5FA 3D9BA 4JI0J 3UDCA 2DIUA 2DNYA 1SH0A 2W9AA 1S76D 1WKKA 3LOUA 1VJQA 3HO1A 4I67A 1RISA 1Z4UA 3HKZD 3VALA 1WDDA 5DM7Q 4MIAA 1RU2A 2ALZA 2HQFA 5E5NA 4S0MA 1FTCA 5J1EB 2VG7A 4O3OA 4DSJA 1IKVA 1N88A 1NM2A 4E0DA 2ZHBA 1EB0A 4IFVB 3HJFA 1G2EA 2G1HA 3V6HA 1YBTA 5CH7B 5H9EK 1H3DA 1VHIA 1M5KC 3KWMA 3GILA 1PYTA 3AXKA 4HKQA 1IR0A 3PG9A 4K8RA 2DHXA 2ATCB 3VGUA 2N4DA 4MK8A 3MPUB 3AXMA 2FVCA 1S9EA 2HHVA 4B9NA 4G6VB 2FHOB 3R5AA 3WIVA 1NHKL 4O44B 3ZZRA 2XO7A 1FD8A 3TANA 3A3NB 4RBUA 1OIAA 3T3FA 2YNGB 3MGJA 4MKVA 1ZYQA 4DQPA 4NEYA 4DPTA 3AOCA 1RAGB 1J5OA 5LSRA 2KO1A 2BKOA 3FEXB 4ED5A 2B7CB 3KLIA 2CQ0A 5FD1A 1JJCB 3I0SA 3KLGA 2IMOA 2CADA 3KLFB 1U8WA 2HFOA 4Q43A 2LQBA 1EP4B 2VV5A 2XEXA 3GSIA 3PDNA 5J2MB 3OTEA 4IDKB 3FBBA 3MWBA 1F5CA 1RTZA 1FE4A 2WOMA 1RTJB 4KR0B 2LQJA 2F8HA 2GQ2A 5J2NB 1ZH5A 2YH0A 2F9DA 2AIRB 1HW9A 2CQHA 5B0DA 2CQ4A 3W8PA 2MPUA 3JAMY 4JI3J 2XBPA 1KNZA 4MYUA 1NSKL 1XR5A 2A6OA 3QAUA 2QG9B 3DLEB 2VFVA 4ER8A 2MB0B 3BO2A 2FLLA 3SCKE 1CJKB 4I2QA 1B7FA 1S1XB 2XMUA 3GFYA 1JIHA 2E5JA 2KFZA 1IR2A 3NG8A 3RRHA 4H4MA 1QSLA 4OYIA 3D6TB 2IJNA 3KJFB 1ZTWA 1QD1A 2VG6A 2R7TA 3DOMB 4LF7J 2UXDF 4OZLA 4CIOA 4CH0S 2R42A 4R25A 5D77A 4EYHB 1VR6A 5EWEA 4AT1B 3DXBA 3BS9A 1FDNA 3B8HA 3PEJA 2FJWA 2DEJA 1U0HB 3LA0A 1F0XA 3US5A 1REVB 2YH1A 1J2VA 4CH7A 1QUVA 4DR3F 4WIQA 4FXVA 2BANB 2PFFB 3WHIA 2VIHA 2DNLA 1FFWB 2ZH5A 3FRZA 4DR7F 2QA1A 1APSA 2K3KA 2V4JA 4N47A 1ZAXA 3MPYA 2XS2A 2D3O1 3JXOA 1RUSA 6AT1B 3UVJB 1S1WA 2J9DA 3SFGA 2CNLB 4KB7A 3SCLE 3DHWC 1KLMA 2DGXA 3OBIA 4N7TA 4NI2B 1V3SA 2Q3PA 1NDLA 1JLQA 2KKHA 2WTFA 1DAXA 4LF4F 1GMUA 4ELUA 3CCJS 1CULB 3BR8A 2DHHA 1CBKA 5T41A 4QWEA 3EJMA 4FVCA 3ITHB 2LLZA 2FIUA 7FD1A 2C3OA 2R8HA 5THWA 2NUHA 4NLRA 3QO9A 2XNQA 4OI3A 3D0IE 1AB8A 3ENAA 3CMES 2AP6A 2FTRA 5BYSA 2HGNA 3CDEA 2KFYA 3ETMA 2CKWA 1KHVA 2WVDA 3QFHA 4F3OA 3C14A 4ZJLA 4ZPAA 2AX0A 3D68A 3VAKA 2UUBF 3NNHA 1WKLA 4OJ1A 2VL1A 4BWMA 4OHWA 1C0UB 1T02A 1SH2A 2B51A 2VKZG 3HHNB 3IWNC 1VIXA 1UZHA 1X60A 3K8WA 2AU0A 3KG0A 5A2QU 3DDNA 3KK3A 4ZN1A 4DX6A 1LKZA 2CUYA 4DSLA 4YB6A 5E41A 3NS7B 2E5LF 3FUYA 2JSXA 4P10A 2W7PA 1HHQA 3OR1B 2Z8QA 1R0AA 1B3TA 2XCAA 1YJVA 4J9OA 1X7VA 2VDHA 1UETA 4P72A 4CWBA 3HSDA 4LRDA 1HLWA 2ZD1B 2DR6A 4USMA 3MECA 5HBMA 2PEBA 3IRXA 3N79A 4URQU 4RW8B 2VA2A 2CZ9A 4FS2A 1FKAF 2VPXB 3J7YU 3V6DB 1T03A 1H74A 4LR8A 2CJYB 4CLFA 1YK9A 3U1NA 3MMCA 4ILMA 5K8MA 4USKA 4Z37A 4JV5J 4N8OA 4F4ZA 3T5KA 2VKRA 2XI3A 1GXUA 1PG5B 5KOWA 1K47A 1TUWA 3DKDA 4YUDA 3MMBA 4WE1B 1VC5A 1HA1A 3CJSA 3CVKA 4GMKA 1TZ0A 1FHTA 3N6NA 4H4KC 2RHSB 3OL8A 1RHQB 4RUBA 5KFZA 2RIJA 5E3AA 1T8EA 2XY7A 5H9FJ 1VQOS 3MFIA 2GVZA 3D0GE 3GYXB 3GLJA 4DQIA 2CJXB 2GGPB 3D6MB 5KFIA 3NOGA 1SC1B 2IRUA 3P49B 4ANEA 3R9LA 2XULA 3PJXA 4ZLNA 5KFNA 1YBAA 2RT3A 1RHMB 4RKUC 4TLRA 1L3UA 1T11A 2POKA 4C9DA 3G82A 4KBIA 2XY5A 1GQEA 3W9JA 1DBDA 3FJ2A 4JI7F 3MEKA 2QSFA 2ADBA 5D3GA 1HYSA 3H4DA 1DQAA 4G3IA 2KYZA 2FZGB 4P7TA 2QT7A 2HMIB 3TEGA 1T3OA 4NE9C 2XNRA 2UUBJ 4MKYA 3FKBA 1WORA 1SJ4P 1WHWA 1IWGA 4F0HA 2YTCA 1IKXB 2R7OA 1WNEA 4O3SA 2XZWA 1RYSA 4UT4A 3CDBA 2ZZMA 4J90A 2E5LJ 4ZLJA 1WJ9A 4K4WA 2RJZA 5HO4A 1DY3A 2IY5B 2OH2A 3OXLA 1RWKB 2MQNA 4HTJA 3TOQA 1S0VA 5B7WA 3U7JA 3UDEA 1HW8A 3Q8PB 1FNXH 3DI6B 4F4WA 4OI1A 4DG1B 2UVRA 4NPOA 2P8IA 4MT1A 1UPMB 3F73A 4HVZA 2AJQA 2FHJA 4I2PB 1KC8T 4ATNA 1FDBA 4DV3J 2P6TA 1E6VA 4P75A 3CJ3A 2BKNA 2GC8A 4C11B 4CLTA 1RT1B 2P6SA 2OD4A 1VBZA 3TEHB 4KC5A 3POTB 4FF2A 3G9CA 3LAKA 2CJAA 3TO8A 2ZBCA 4MJKA 2QL5B 1N36F 2P5VA 4G65A 4HYKA 1HQUB 1ROFA 2ZJRQ 1EKRA 2HQCA 2VPZB 4H4KA 1YWXA 3VAIA 2R7VA 2HURA 3Q0AA 1T94A 2J9DE 2ZZNA 2K8GA 3TYTA 1KDNA 3J7ZT 2BW2A 3IBCB 1Z2ZA 3SIPB 2DPJA 3E51A 4DF8A 3GFXA 4YN3B 3M8RA 2RDIA 4AL6A 5L9XA 5L1JA 4X4RA 4EBDA 1CSJA 1NH8A 2HVDA 3PX0A 4F67A 4ZOSA 1P1TA 5J2QB 5C7PA 4JI7J 2Y0SD 2FZKB 1KS2A 3ZTPA 2HYIB 2ZBIA 3DLGB 4USHA 1SKSA 4FF1A 2DGOA 2MKCA 3OFGA 1ZZNA 3I31A 1W2IA 4DR6J 2PA3A 3W8GA 3N01A 2CG8A 5B0AA 2QFJA 2VBZA 1ZA1B 2NREA 4NLGA 5IQ6A 2EVZA 3P5BP 4NRTA 2WVBA 3P3DA 3GQCA 1VRUA 4HR2A 1UVKA 4OIXA 4CLKA 4XAKA 1B64A 4LF8F 4LFBF 3TVZA 1NBEB 1FRHA 2F7VA 3HDSA 3CT9A 1I94F 2MY8A 3P45B 5L8RC 3T9ZA 3ZZ0A 4A8SA 3NGTA 5K8PA 2FB0A 4L6V3 3PFOA 4EEYA 3MCSA 4DFPA 1YJUA 1SKUB 1NK9A 2ZITA 1BQMA 4RUHA 4JI6F 4QWCA 5DZ7A 3N5BA 1CC7A 3OT9A 2JHEA 4V19J 1FRJA 2BQ3A 3K59A 3KHHA 2VG7B 4NLVA 2O3DA 1IKVB 2XS7A 1N5VA 2CQGA 3FFIA 2GIQA 2DVIA 1S57A 3NS5A 2AEFA 5KG0A 4DU8A 2DY9A 1IJFB 2QO3A 3W60A 1YRTA 2EEYA 3DDKA 2LXUA 5D15A 2HNZB 2PA8D 1MN9A 1UFLA 3A3OB 2OLWA 4YR3A 4DL7A 3I9V9 4HLBA 3LWMA 1VQPS 2FJDB 3Q83A 4PAAA 3LANA 2LA4A 2I1RA 3DRRA 5B0CA 4KFBA 4KAIA 4NRUA 2HHTA 2EC2A 3F56A 3QJLA 2QEXS 1J5OB 1L3KA 2V8HA 2UZAA 4QYZK 3AY0A 2UV8A 1JLBA 3ISZA 3KLIB 1RTDB 4X4SA 1NSPA 2GO9A 2RH3A 5F3ZA 3KLGB 1RXOB 4ED6A 4B02A 2IC3A 1NJYA 5GAGU 2ZKUA 1QAXA 1FJEB 3CUNA 2W9CA 1VS3A 3HCXA 1RCXB 3FNNA 5K8OA 2WSCC 4UQTA 1EHWA 1ULRA 1VLYA 3NGUA 1TL1B 2V2ZA 4ZIWA 2V50A 4UZBA 1HPZA 2ZH8A 5IFMA 3OL9A 1TKDA 2RKIB 4KGKA 1H2UX 4RLEA 2DGWA 2HQ3A 2OEKA 1N48A 3MMAA 4NEZA 4Q0BA 4IOAQ 3VQTA 2M2BA 2CJ9A 1I94J 3HKWA 2VQFF 2IM3A 1EX8A 5HQMA 2CVEA 3RUBL 1GX6A 2Y3YA 5CD4A 3AFGA 4MK7A 5FLXU 4I2QB 1REGX 4KV8A 5E3CA 2UUCF 3R97A 2MQLA 1HFEL 1RAOA 4IKAA 3M8SA 2J0WA 4JI6J 1QE1B 4U6PA 4L76A 3TR5A 2U1AA 4TU9A 2OMOA 2DO4A 1C4AA 1M1KT 2AEMA 4NCGB 3MTKA 3BJYA 1G7CB 1LV5A 1L3TA 2V8PA 1WG1A 4PABA 2EBEA 1UCNA 5ETMA 4OX8A 2Q6BA 1Q0NA 4B3MF 3JB9k 1K8AT 4J9MA 4F50A 2JLEA 4GKKF 1FJCA 4C3LA 2FDNA 1LW0A 5IQQA 4KQZA 4C8LA 2HS4A 3T6JA 4OLOA 3QGPA 5J2PA 2J0QD 2J7UA 3BSCA 3ENVA 1KONA 4WTYA 4F3QA 1FNMA 2QRRA 2KG1A 1S1WB 2R2TA 2BJ7A 2ZOGA 1IQTA 1DURA 4MIBA 2NLWA 1KLMB 4WWSA 4OI0A 2ZM6J 2HFZA 1JLQB 3RGIA 2DHAA 2F3JA 4TYAA 4CNZA 4FN5A 1R43A 3MURP 3LALA 2C2EA 1Q53A 3BH6B 4X66J 1X31C 4DPYA 2VC1A 4KYZA 4JI1F 2LVWA 1DTQA 1KEKA 3MAQA 2EXUA 4CT8A 3QO9B 3BYRA 2NCKL 5GADI 1T3NA 5F8IA 1PBUA 4C97A 1M5PC 2DXFA 2GAHC 2W8LA 2OTJS 3R5BA 1WG4A 2BACA 4Q44A 2R7QA 1D8ZA 2GQQA 2JRSA 5KT4A 3LP2A 3H8YA 2K7JA 5DG7A 3FC9A 4PWUA 2W7AA 1TP7A 2YKNB 3BDPA 3DYAA 3K57A 3BPSP 3QRPA 5F8GA 3PYFA 1XERA 3UN3A 2XHWA 3L7OA 1RCOB 4DUYJ 4OL8A 2PO4A 4N5SA 8ATCB 2HKEA 2R7UA 1CPZA 3KK3B 1SPBP 3MM8B 3B78A 3FCWA 2KL8A 4M8LA 3DRPA 1R0AB 4J9KA 3PYEA 3M8ZA 3ISNC 4YY3J 2CPJA 5CCLA 2DKOB 2LEPA 1NNDA 1AUSL 3ZZUA 3RAQA 3FSXA 3KJVB 2UXBJ 1JLEA 3M2RA 2K06A 1PILA 1HI8A 5E2QA 1KOHA 2AJ4A 3DGPA 3MECB 2OD6A 1QY7A 2XMVA 3IRXB 4QIVA 1IBKF 3J81U 1HQEB 3ICLA 3BO3A 5KFHA 3ZNJ1 2VZ9A 3D7SB 5KFGA 3F44A 3PW4A 4NLYA 1GXLA 1EARA 3JTPA 3CCES 1Q16B 1KKHA 3D67A 4ENOA 3KJNB 2HIYA 4TVAB 4NXMJ 4HH1A 3J80Y 3L3CA 3K8VA 3BR9A 1CJTB 3H59A 5IZHA 1WTBA 3MMBB 2ZH4A 4CH1A 2OHDA 3KK1B 3ZXWA 2ZUGA 3OLAA 3JAMU 3QWUA 3H20A 3EDRB 2DY1A 4ZVGA 2GVZB 4ZVEA 3LP1B 4IRDA 3TUPA 2I5JA 1X4HA 3TARA 2ADCA 1XR6A 4ZVSB 2BOAA 2E1MC 4R8UA 3D2WA 3TI0A 4WP9A 2I38A 1TQLA 2DNHA 4NYPA 3CJKB 3C16A 3W5YA 1HYSB 4DFMA 1QAYA 2CPZA 3QSYB 1U1RA 1RT4A 5KAKA 1VMBA 3H5XA 2WBMA 4PG7A 1X5SA 1MSWD 2GJIA 2XMTA 2F9JA 2QMWA 3EPGA 1UVJA 2ZDPA 3T1HJ 4IOCQ 2F4VF 2WVFA 1UA0A 3MR7A 3MCOA 2BA9A 3MD3A 2CYYA 1DLOB 2CXEA 1RADB 2XSFA 3M4XA 3PX6A 2IA6A 2YPYA 4ZCLA 5B0EA 3AD7C 4LF9F 2DR8A 3MTJA 1QJHA 2VG5A 3UI3A 2NXCA 1S9GA 5FDLB 3DOLA 1O6XA 4OHYA 4I6YA 1S4EA 4C0OC 3KNGA 2E5GA 2ZOMA 3BSAA 1RT6A 2G4BA 2PC6A 4DX7A 2RAQA 1NK4A 4W90B 3ET6A 1FK9A 1RKJA 2BE2A 5MLCV 3D6HB 2OMLA 2LEBA 1FKOB 1CJVA 1WKJA 3BPDA 2GIRA 4QOTA 1IBKJ 1HI1A 2OUGA 5KFPA 3MM9B 2IDLA 2LU2A 4K2JA 2QLWA 2PMHA 1Q5YA 2MGZA 2GW8A 3H4BA 2W2QP 1D0EA 2MZRA 1BLUA 3X3UA 2RDDA 4I69A 5DLFA 3G6VA 4HT5A 4GVBA 1PYOB 2C2KB 2BJ9A 3MHYA 4O4GA 3K5OA 2JC0A 2CQ1A 1LQ9A 3PX4A 3QJJA 4USWA 2BXJA 2D7SA 2VFUA 2B9EA 2NUUG 4I64A 3HF5A 5DZ6A 4QIEA 5D78A 1Q79A 2ZZTA 4ZHRA 4IUFA 3OVSA 2R8GA 5HQLA 3KYLA 2HK2A 3ONQA 5IC6B 4OI6A 3LAMA 3NGDA 3KUEA 3NXZA 2CG4A 1U1KA 3SYZA 1ZETA 4NOHA 1JMTA 2ZNZA 4DV1F 3EXCX 3QIPB 2DCLA 2WRMA 5HP1B 3UPFA 3UCZP 3JSBA 2ABYA 2HVEA 2F8EX 2J9EA 4AXJA 2U2FA 1U1QA 3G96A 5IC4B 4FKYA 4QWAA 1HNXJ 1RWXB 1I6JA 2YKQA 3BREA 4WXWA 1VRUB 3TJ9A 1RWMB 5LXRA 2MHEA 4BLGA 2CZVC 3AB4B 4KKOA 4WZMA 2XTJP 4Y6IA 2V63A 4Y2KA 1QVFR 1H98A 4NCBA 4DL3A 3H2LA 2I2YA 3CDUA 4RZRA 3V81A 2IBOA 2Y1JA 3BBFA 3BN4A 4ES2A 2NPFA 1R8CA 3UD3P 1NZAA 2VU5A 3Q22A 1RWUA 4FYYB 1BQMB 3QZ8A 2VBXA 2O1PA 1BGXT 1TUGB 2XCPA 1RSCA 1HR0J 4B3RJ 3D1HA 4NWBA 2Q43A 3NNAA 1N5QA 1WWHA 2QMXA 2VASA 3ZTRA 2LQ9A 3NLCA 3M1VA 3R1LA 4JUZA 4C8KA 4W4MA 2MZ1A 4KHPF 2J9CA 2C2MB 2J6TA 2HNYA 4HI1A 3A8IA 4D3HA 1NKCA 3G6ES 3ZTSA 3DRXA 3FZ2A 1YVFA 5KFQA 1N33J 1UVLA 1VQ9S 2AJ0A 1Q86T 2XM3A 4DL0C 5DLGA 1TK5A 1U1NA 2CQIA 5AE1A 4RW7A 1HWLA 2OP5A 2I8EA 3QT8A 2Z2YB 2UVWA 4O0IA 2RU3A 4EZ6A 5EWFA 4M63A 3WC2A 3HT0A 2R7SA 1PO6A 2ILZA 1YJWS 1JLBB 4UOCA 3N9UC 2E1CA 2EC0A 3R5CA 4CLPA 4OYBA 1FWLA 3EPIA 3RRGA 1MWYA 4FYXB 2QL7B 2QJ3A 2IC3B 1UWBA 4F8RA 2GS8A 4XK8C 2CPDA 3J81j 4PWDB 2W9CB 5EWGA 4X4OA 2OFHX 5CYJA 2V4QA 1NSAA 4D3GA 5L9NA 1KQSR 4R0EA 3CCLS 4ZPVR 1TL3A 3HULA 3OJSA 2GNKA 4DQRA 3PYDA 2DO0A 4DPWA 1WSRA 2X1GA 3KLVA 5H1SV 4F2SA 1UEKA 2IYGA 4NA1A 3QT7A 4BWJA 2VFTA 2EFNA 2F5GA 2JOQA 3MMAB 4Q0BB 1NU4A 3OTOF 4NLQA 3ZZTA 5LMNF 4BC9A 3O3LA 3J7A1 2PD1A 3VGSA 1M5HA 4KGMA 4GO7X 4AQYJ 2EFQA 3TW0A 3T1AA 4KV8B 1QSSA 4DR4F 3IAS9 4NZ6A 3EGVA 2AEJA 4ECVA 4URGA 3TA2A 1BY9A 1R8HA 4URSA 5DO2A 3BGRA 4Y2IA
chains in the Genus database with same CATH topology
2LEAA 4JI2F 3PXGa 2WCXA 2YNHB 3CGIA 1H7WA 2B0GA 5K8NA 1TR0A 4O44A 5I3UA 2UU9F 2O01C 2N4CA 4KB7A 4MAKA 3SCLE 3DHWC 1JB0C 1KLMA 1WHVA 2DGXA 3OBIA 1AFIA 4ECWA 1V3SA 5I42B 1NK5A 3C6TB 4XDCA 2Q3PA 2MQPA 1JLQA 1C2PA 4NLOA 5L1LA 2YNGA 1YJRA 2KKHA 2WTFA 4ED3A 2H5EA 2BYCA 1DAXA 4JI0F 4PCQA 4LF4F 2KB2A 2Y1RI 3RB4A 4ELUA 2CQCA 3CCJS 1ZOTA 4A4JA 3AJ2A 4X4UA 2D74B 4PXCA 3DOKA 1P27B 1D9DA 2A2DA 3BR8A 1HWIA 2B43A 5B08A 5T41A 3R3TA 4QPXA 2J76E 4QWEA 1U45A 3PIOQ 2OTLS 1YITS 4FVCA 5D3GB 4C8OA 3ITHB 3L7PA 2LLZA 2FIUA 7FD1A 2C3OA 1J5EF 3NAHA 3L95X 4AXIA 2QLXA 3S8SA 1YHQS 3B4MA 2LKZA 1T05B 2L9WA 1VHFA 3IXQA 3ETOA 3HHLD 2R8HA 3D1QA 4HEA9 5THWA 2NUHA 1S1UA 2AYGA 4NLRA 3QO9A 2XNQA 2NYIA 2RD5C 3D0IE 4OI3A 1S1VB 4OX7A 2MMYA 3CMES 4MKBA 1E6YB 2K3IA 4IH6A 2DRBA 2AP6A 3N4WA 1JJ2R 2HLTA 2FTRA 2JVOA 5BYSA 5DQIA 2HGNA 3CC2S 1VGYA 5J2PB 3TUIC 1HNXF 3CDEA 2ZE2A 5T7LA 2KFYA 5J2MA 1SKRA 3IG1B 2CFXA 3GB0A 2XB2D 2CKWA 1KHVA 4IDKA 3HVTA 4K4XA 1DTTB 4O3QA 5DQHA 4F3OA 1SJ3P 5KFXA 3TX8A 1RTJA 4DQQA 2FJAB 3T5LA 4NCAA 2B4PA 4ZPAA 3EGNA 1LW2B 1BQNB 2AX0A 1NEEA 2FVQA 3VAKA 3MM7A 4U7CA 4HH0A 2AQ4A 3JSMB 5K14A 1VQ4S 2UUBF 3NNHA 3K0JA 1VK8A 2E9ZA 3VAJA 4IG3B 1KHWA 1QUPA 4ZDNA 4RW6A 4BC7A 1TKZA 4PPZA 3GG1A 3CD6S 3LUYA 4WU3A 4OJ1A 1F2GA 3DLJA 2VL1A 5B09A 2RDJA 4BWMA 4OHWA 1UVIA 1C0UB 4BCAA 3IS9B 2F8MA 4NZ0A 1T02A 2M3DA 4YFUA 4IFYA 1SH2A 3CIMA 3QGHA 3KLHB 2B51A 5A6PA 4ECSA 2XSJA 2VKZG 3HHNB 4JV2A 2O66A 3SXLA 2YWKA 3EGZA 3IWNC 1VQLS 1VIXA 5KFTA 2B9YA 3EGWB 3K8WA 4LQ9A 1GX5A 4CNYA 2AU0A 3KG0A 3DFEA 3DDNA 2HNDA 3KK3A 5J1NA 3IA0A 3VZIA 1QLNA 4B3RF 1HR0F 2OKQA 3NBPA 1LKZA 4DSLA 1VK3A 4YB6A 2K7KA 5EHHA 5E41A 2E5LF 2E9TA 4G1QA 3CTRA 2JSXA 2WONA 1DTQB 1C1BB 2W7PA 1NAQA 2MZTA 5D8HB 3J7Z5 4MTPA 1C0TB 2YX4A 4NLUA 1RT3B 2MYFA 4XO0A 3OR1B 3RYLA 4DLGA 2Z8QA 1R0AA 3CB4A 2EG1A 3CIZA 2LXFA 1JLCA 2XCAA 1YJVA 4PXEA 4J9OA 3FVYA 4OZJA 2P9GA 1X7VA 2V2KA 4PWDA 3I4PA 3MPVA 4K5RA 4A8XA 2BBEA 4WKYA 2MZSA 1Q1KA 2M0GB 1UETA 1RP5A 3DMJA 4Q2LA 2V0NA 4ZCKA 4DSIA 4B9SA 1E6VB 2VA3A 2RMLA 3S7RA 1CVJA 2GMLA 4DSKA 3MEEB 2ZD1B 4LIWA 3VCDA 3H40A 3KTQA 4PUOA 4FYDA 2HRYA 1PC4A 1JLFA 1U24A 4JBCA 3FSYA 1VC0A 4EGLA 3AH6A 5AXMA 1HNVB 2O5DA 3MECA 3LP2B 3NMAA 3DLBA 3PACA 5HBMA 3IRXA 3BQ0A 3N79A 2WBRA 4URQU 4RW8B 2OIHA 2VA2A 4DX8H 2BOPA 3CCWA 1N33F 2VONA 2DNQA 4PR6A 4FS2A 1FKAF 2VPXB 3J7YU 3V6DB 1T03A 2M9KA 3I87A 4ECYA 3HHDA 4WIIA 1WELA 2KT5A 3U1NA 3MMCA 4ETZA 4ILMA 5GVQA 5K8MA 2HHXA 5KFJA 2SXLA 4Z37A 3M6WA 4N8OA 1L3SA 3UCUP 4F4ZA 2HIQA 4DL5A 3T5KA 4ZMMA 2VKRA 2XI3A 4QR1A 4JI3F 3PW5A 1GXUA 1IN0A 1FKPA 4YDDB 4ZCMA 3MM6B 5L1IA 4DR5F 4E8UA 5KOWA 4Y2IA 3I96A 5EGYA 2P9EA 5E7OB 1NKBA 3HZGA 2KJWA 1H2VZ 2GCFA 3MMJA 3CWJA 4NA2A 4YUDA 1X4DA 2IM1A 4HTIA 4RNHA 2C22A 3MMBA 4WE1B 1VC5A 4M5DA 2B3TB 3GWCA 1HA1A 5KFRA 4IG0B 5F8HA 4DV5F 4N41A 3PRDA 3CVKA 4A8YA 4GMKA 2IHR1 3GSDA 2EFVA 2GV1A 3DRPB 2GFFA 1TZ0A 3RB6A 1H6KX 1QTMA 1KQFB 2M70A 3ZZOA 3N6NA 1FHTA 1V9OA 2DBBA 4H4KC 4H4OB 3JYTA 5DG9A 2F40A 3OL8A 1N6QB 3DU6A 3UQSA 3RR8A 1TKTA 1IQZA 2QYCA 4NLXA 2RIJA 5E3AA 2JVRA 4KO0B 5KFZA 1U4BA 1T8EA 2XY7A 5H9FJ 1JLEB 4HDGA 1VQKS 1WD6A 3M2RB 5A8KB 3MFIA 1VQOS 3M32A 3PW2A 2KM8C 3D0GE 3GYXB 1WEXA 4DQIA 4PQUB 2NXUA 4LVNP 3WDOA 3HHLB 2FLPA 3IGVA 2E1AA 2GGPB 3UFCX 3OVAA 2VBWA 4OJGA 5KFIA 5AJ3F 2FGCA 1HBUB 2M88A 2IRUA 3KG1A 2HVZA 4A8KA 2KTQA 4ALZA 5I42A 4LF7F 3C6TA 3P49B 2HWTA 2VOOA 2XULA 3PJXA 2I9SA 4RX6A 3D5MA 1Y0HA 5KFNA 2XGPA 1YBAA 3RBDA 1S72S 3BGFA 2RT3A 2BZ2A 1X9SA 3V5RA 1X4GA 1RT5B 4RKUC 4B9MA 3FQLA 4TLRA 3BDEA 1L3UA 2KH9A 2OPPB 2POKA 4C9DA 1SQEA 1FXRA 2IBKA 4KBIA 2XY5A 3IRWP 1YQHA 1GQEA 3QZ7A 1DBDA 3FJ2A 2N82B 1CQMA 4JI7F 4AYBD 3MEKA 1FDAA 1D8YA 2QSFA 2KRBA 2ADBA 5D3GA 3ITHA 4TU7A 1HYSA 1D3WA 3H4DA 1DQAA 4G3IA 2KYZA 4P7TA 2E1RA 2QT7A 4AL5A 2HMIB 2B56A 2ZFHA 5EX3A 1T3OA 4KHRA 1AW0A 1S4FA 2GMJA 2AJ1A 4NYOA 2XNRA 3NMRA 3DC2A 3RAMA 3SQGA 1F5AA 1P8GA 3MPWA 3ENWA 4MKYA 4QPTA 4A47A 1D1UA 2ALZA 3MFHA 5C5JA 2EK1A 1FERA 1SJ4P 4NMLA 5FJ4A 2HS3A 4AQYF 1TVRB 3BGUA 4IO1A 4OX6A 3IG1A 1JLAB 1WHWA 1B0PA 1YJNS 3G6XA 1DTTA 1NRKA 2N7YA 3DRYA 3I6PA 3N6LA 4QR2A 2DH9A 3V4MA 1X5TA 3VWSA 2OSRA 5KFLA 1VQSA 1IKXB 2R7OA 2YTCA 5LL6d 5IM0A 1Q81T 1VQ8S 5SZTA 2FLNA 1WNEA 4O3SA 3THTA 2XZWA 1RYSA 3W7BA 3H98A 4ZP8A 3K7RA 2DNMA 1R7IA 3CDBA 4IG3A 5I3QA 2ZZMA 2YNIB 3SV4A 4TY8B 2RQMA 5KTQA 1NO8A 4OV1A 1C0UA 3IS9A 4K4WA 3CCRS 3I0RA 3LF0A 1N8RT 1U7LA 1URRA 1PGZA 3KLHA 2RJZA 1MW7A 4UQGA 5GADU 5HO4A 4FNIA 3J81Y 4R8UB 4QW9A 3N6MA 1VJWA 3O5TB 4B9UA 3FQKA 4K59A 4LSNA 3FFIB 2OH2A 4I7FA 3M8QB 2DR5A 1MU2A 2FGOA 3OXLA 4RU2A 1QAJA 1YRXA 2MQNA 4HTJA 2K1RA 3TOQA 1S0VA 4ELTA 1C1CB 1XEZA 5B7WA 3U7JA 2BR0A 1GTEA 3GIKA 1HW8A 5D4PA 3LP0B 3RZAA 3Q8PB 3FRYA 1FNXH 1OSCA