2DGYA

Solution structure of the eukaryotic initiation factor 1a in mgc11102 protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
111
Chain Sequence
GSSGSSGEHIVPSNQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the eukaryotic initiation factor 1A in MGC11102 protein
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords MGC11102 protein
total genus 10
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.180 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2dgyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2dgyA01
4JI3Q 4HIOA 3IRBA 4X6AH 4DR2Q 1VQ6A 4A3KG 1WCMG 5LMNW 3E0EA 2ZTDA 2AMCB 2D62A 2WFWA 1VQDA 5HY6A 4A93H 1Q1BA 1W3SA 4UPAA 3UE1A 3U58A 2B63H 2JA6H 2D0OA 1WJJA 2BA0A 1SLJA 4LF5L 1KRSA 1EWIA 3CMEA 1L2FA 1FJGQ 1YHAA 3AYHB 4YY3Q 3RLNA 4QQBX 4RMFA 4DV7L 1WCMH 3KOJA 4JI5Q 1CKMA 2F4VL 4YWKA 1M1KC 1ASYA 1VQ5A 4AYBE 1OXSC 1XPUA 1JE5A 1O7IA 3T1HQ 1IYJB 2HHHQ 3M3YH 3UE0A 2R7ZH 1QZGA 4DR7L 1N32Q 1YBYA 3S1MH 4PZ8A 1YEZA 3KLWA 4X65Q 4LFCQ 4TVAB 4C3IH 1N34L 4YWMA 4DR1L 4DR1Q 1BVSA 4DV5L 2VY3A 1Q82C 1YI2A 3GTPH 3ICEA 1GM5A 2YTVA 4X66Q 2K52A 3STBD 3M85A 1W2BA 1PH9A 1XNQQ 3RLFA 1E3PA 1PHJA 4BA2I 2R6GA 3PUYA 2V1CC 1BKBA 2ZJRA 4GNXA 3BU2A 5IP7H 3HOXH 3RNUA 3HOYG 5LMNQ 3H0GG 1IBKQ 4L5SA 2E8GA 2CKZB 4DR5L 4DR5Q 3KDFB 2JA7G 4P72A 3J7ZC 4DR4Q 1E1OA 3F2DA 4OX9L 2UXBL 3UDGA 1FJGL 4DV6Q 1K0RA 3UDFA 5EAYA 4IJHA 1PH1A 4B3TL 1N33L 3GTLH 2PQAA 2B63G 5IWAL 4IO9A 3RR5A 2CQOA 2LXJA 3PUXA 4IPHA 3S15H 1C0AA 4P75A 3I4NG 4R1JA 4BBRG 4GKJQ 1S3OA 1X3FA 4YHHQ 4YCUA 1JJ2A 4DV4L 1A8VA 1YZ6A 2MQHA 1AE3A 4DK3C 5GAGC 4DV4Q 1N34Q 3E9IA 3L2PA 1HNXQ 2E2IH 4DR7Q 1N32L 1VQ7A 4L5RC 1NMGA 3FP9A 1WYDA 5GADC 2Z6KA 1Q8KA 4ALPA 2KBNA 3J80i 3AFPA 1I94Q 5LMUL 3CPFA 2WP8J 3LGJA 4HJ7A 1VCIA 1D8LA 4DKAC 2Y0SE 4A3EG 2AWOA 3UDIA 1LTLA 2JQOA 2B3GA 3S14H 1XTDA 3EN2A 2K50A 4YCVA 1X9NA 5C3EG 1E7ZA 2ZM6Q 1VQFA 2CWAA 1Q81C 1N33Q 3MXNB 4IPGA 1TWHH 4YCWA 1YHBA 2K5HA 1KHIA 3PO3G 4XTCS 4X62Q 4X62L 2YV5A 3NBHB 4PZ6A 5GAEC 3ER0A 3TEHB 3DM3A 1L1OA 2F52A 4A3KH 1N36Q 1HH2P 4P73A 4JV5Q 3L0OA 1NE3A 2Q2UA 3HOWH 4KHPQ 2YTYA 2FXQA 4KHZA 1XNRQ 4KHPL 4A4IA 1PH6A 1Q1EA 4R4TA 4A3IH 5C4XH 3RN5A 4GLXA 1GD7A 4AQYL 4X64L 3NENA 3GTMH 2NVXH 2KCMA 4HJ8A 2OTJA 1U5KA 2KHIA 2RF4A 2Y0SG 3U4VA 1CSPA 1HNZQ 4JI6L 1IBML 1EQRA 4BXXH 3J81i 4MZ9A 1OXVA 2K4KA 1KQSA 4AYBG 2VUMH 4JC0A 2WB1G 4GNXC 3I7FA 4JYAQ 4B3RL 1A0IA 2NVQH 1QVFA 2MFIA 1Z9FA 4RG1A 1SFOH 2WAQE 4A75A 1WI5A 5M3FH 5J3BA 4BA1I 3CC4A 1VQEA 4BBSG 4JI1Q 1IBLL 3T1HL 4DUYL 4EX5A 4A3FG 4JI4Q 2PQAB 3EBEA 2UUAQ 2UUAL 1HZBA 2QGQA 4IJLA 2OCEA 4TQUS 4X64Q 4JOIC 2NZOA 4GN5A 3RLOA 4DV1Q 3J81j 1HR0W 3M4PA 2MO0A 4X65L 4NXNQ 5JJLA 1NY4A 2JK8A 5M3FG 2Q2HA 2NZHA 4R4IA 2IX1A 2KCTA 2K14A 2VS1A 3NEMA 4XIGS 5FLMG 4JI8Q 3DLLA 2N78A 4JI8L 4B3SL 2YYZA 1VQMA 2I5MX 4HJ5A 3AFQA 1JB7A 4A3EH 1YVCA 4BXXG 3W5OA 4GKKQ 2MO1A 1L1OB 3CC2A 2IHFA 1HZAA 2PMZE 2F4VQ 3U50C 2H5XA 4JI1L 2EIFA 1VQBA 3KF6A 4DUYQ 3A74A 4HIKA 3OYYA 4JG2A 4B3ML 4LF8Q 4K0KL 5FLXc 1K8AC 1EUJA 3D0FA 1VQ4A 4A3BG 5C44H 3HOVH 1MJEA 3ULJA 1WOCA 4DUZL 1UE5A 4DV0L 4H02A 4DV1L 2ZTCA 3ERSX 4DAYB 3NELA 1EOVA 4R4QA 2QA4A 1I5FA 4DV5Q 1OTCA 4JI0Q 4OO1G 1L0WA 5GAHC 1YJ9A 3S2DH 2YTXA 3PO3H 2I5HA 1TWCH 4QY7A 1PH2A 2R93G 1KIXA 3I4MH 2N49A 3RN2A 1PFSA 5IP7G 3HOYH 3M9BA 2VQFQ 1OXTA 5IYBG 1MIUA 5M5WH 4A3DH 2R92H 3PUWA 5ELNA 4JI5L 1IL2A 4DR4L 2UXBQ 4OX9Q 4YY3L 3KFUA 1Y1VG 4LF7Q 2RHQB 4L5TA 1K3RA 3KJOA 3J80c 5IWAQ 4OWTB 1JJCB 4IPDA 2VZAA 1FGUA 3KF6B 3CC7A 4ME3A 1XMQL 3K81C 1BBWA 3K7AH 4GOPB 3FKIH 4LF4Q 3CCLA 3CCMA 2K5NA 4DV2L 2ZJPA 4DV2Q 4OO1I 4OXPA 1TWFH 2RHSB 2HIVA 1HNWQ 1PH7A 2GVAA 2EQSA 1GKHA 4JI0L 2PI2A 4A3JH 1VQLA 1TWGH 2JEBI 1X3EA 2C35B 5FJ8G 1Y14B 3F8TA 4O2DA 1BBUA 3RZOH 4A3BH 4WJ3M 3CCSA 4AQYQ 3JAMc 1X56A 1KAWA 3CXCA 2I5LX 2JA6G 1EFWA 1K9MC 3J81c 1V9PA 4JI7L 1KRTA 2VW9A 1K8GA 4L5QA 1IBKL 4A93G 2K75A 3CCRA 3GTGH 1X65A 1SE8A 2JE6I 2HT1A 4JBKA 1X54A 3FHWA 1B70B 4OWXB 4C3HH 3H15A 1A62A 1KL9A 1Q46A 2CFMA 2UU9L 4BY1H 3CD6A 4JYAL 4B3RQ 1JJGA 1UE7A 5IYCG 2GVBA 2JA5G 2EXDA 1SRUA 3ULLA 4R4CA 2NN6I 4A3CH 5IT9c 3ZJYC 3S1RH 2BH8A 1XNRL 2UXCQ 3A0JA 4DR6Q 3E9HA 5IP9G 2AWNA 4LUZA 3HKZG 3OTOL 3GTOH 3T1YL 4X66L 1XNQL 3PF5A 3HOZG 3CCEA 4HIMA 1EYGA 1E1TA 2XGTA 4A3FH 1XMOQ 1Q86C 2XTIA 1I94L 2BA1A 3HFZB 4DR2L 3PGZA 1H95A 1P8LA 4C2MH 3J7A5 3CCJA 3AEVA 3B6YA 4J15A 3S1QH 4KI0A 4C3JH 3S1NH 2ATWA 1TWAH 1HR0L 3D31A 2YU9H 3I2ZA 1EQQA 5IY0A 2Z6KC 2WAQG 3G48A 3BZCA 1CKNA 2NN6G 1VQCA 4DV7Q 1E24A 4GKJL 1LM0A 3S24A 3PUVA 3RZDH 4HJAA 4IFDG 4DR6L 1LUZA 1I50H 1QVGA 3PO2G 4Y52H 3M7NA 4QL5A 1V1QA 3A5UA 5E7NA 4BBRH 3G4SA 4A3IG 2HIXA 1KC8C 2UUBL 2JJQA 2K5VA 2NVTH 2N8NA 3S2HH 3S17H 5LMUQ 5GQOA 3G6EA 3CCUA 1XJVA 1OXUA 1VQHA 2VL6A 3CQZH 1G6PA 1Y1VH 5M3MG 4IFDI 4IFDJ 1X55A 1FVIA 3I56A 2PI2E 2Q2IA 4NB3A 4BY7H 3K0XA 4AIMA 2JA7H 4GS3A 1UEBA 4A3DG 3H0GH 3M4QA 4HJ9A 4JI6Q 5LMNL 3G71A 3HOXG 1VS0A 3GTQH 3W1BA 3CCQA 2R93H 2KENA 2ES2A 1DGSA 2N3SA 2OQ0A 3KF8B 3CF5A 2AHOB 1PH4A 1MJCA 4Y7NH 4OWWB 4DV6L 4JBMA 1AH9A 4B3TQ 2UUCL 5IP9H 1SROA 4LF7L 1TXYA 5ELOA 2I0QA 4A3GH 3KJPA 2LSSA 4A3CG 3HOVG 2RCNA 5FJ8H 4DR3Q 2JA5H 2OTLA 1CKOA 2GN5A 1PYBA 4O0AA 4A3JG 2L15A 2ASBA 2R7ZG 3K8AA 1MKHA 4GKKL 2PNHA 2CCZA 4A76A 3PO2H 3TREA 1EIFA 5IYDG 4LNQA 2UUBQ 1HNWL 1NTGA 1KD1C 3MEFA 1X3GA 4LF6L 4LF6Q 2UXDQ 2KHJA 1I3QH 3F1ZA 4YWLA 1GO3E 3WWVA 3I4NH 4DPGA 4B3SQ 4QJFA 1IXRA 4DNIA 1YIJA 1IBMQ 3JC66 1Z47A 3BJUA 2VQFL 4LF5Q 1CKNB 1K73C 2OQKA 4DK6C 3PIPA 1VQJA 4OONA 5JEAJ 1IZ6A 5FLMH 4A3MG 4JI7Q 1VQPA 4PMWA 5C0XG 2Z0SA 4GLAC 2UUCQ 1HZCA 2IHEA 3I4MG 3K7UC 3OW2A 2D0PA 1XMQQ 3PV0A 3JAMi 4B3MQ 1M90C 4LF8L 2AKWB 3H3VI 2ZJQA 4JV5L 2DGYA 1R9TH 2MNAA 4P74A 2ALYB 1SN8A 4DR3L 1G291 1PH3A 1C7YA 3U4ZA 1HNXL 2JA8G 3PF4A 4JBJA 4HIDA 4DV0Q 1YJWA 4GOPC 1GVPA 2Q2TA 2UXDL 3OTOQ 4FDBA 3AQQA 3T1YQ 5IYCH 1VQ9A 5AJ3L 1LYLA 5AJ3Q 3CCVA 4A3MH 3PUZA 2R92G 4BY1G 1ASZA 5IYBH 3TRZA 1L1OC 3I55A 3GTKH 4GN3B 1UE1A 3GO5A 2A1AA 4NPSA 3L7ZC 3VDYA 1VQKA 2LXKA 5C0XI 5C0XJ 1Y1WH 5M5YH 1U0LA 1CUKA 1G51A 5GROA 4UY8C 4P71A 5JJIA 1UE6A 1NBWA 5HGQA 3CW2C 1HR0Q 1XPRA 4LW1A 4LF9Q 4LF9L 3CAMA 1Q7YC 1WFQA 1RIPA 4DV3Q 1PVOA 2HQLA 1VQIA 1PH5A 1RL2A 4LFAQ 1SR3A 1C9OA 1PV4A 5C44G 5C4XG 3W1GA 4QIWE 5DLQE 4GNXB 2ID0A 4YHHL 3PCOB 1N36L 4LFCL 1EIYB 3I4OA 3HOUG 4A3GG 2F3IA 4DUZQ 1QUQB 1IBLQ 1CSQA 5C4JH 2IT1A 4MNOA 3Q8DA 4EQ5A 1YJNA 3FKIG 3HKZE 3A5ZB 3H3VH 1FL0A 1T9HA 1HZ9A 5K36G 1PYSB 4BBSH 4UP7A 5JJKA 3TQYA 1VQGA 1UWVA 1QVCA 1VQ8A 3CP0A 4JBWA 2E2JH 4LFBL 4A3LH 2E5LL 4BY7G 1HNZL 4LUVA 1AE2A 3CMAA 1XPOA 3KDFA 4DV3L 2B29A 3S16H 3PIOA 5JEAG 2NVYH 1JT8A 1VQAA 3GTJH 2WB1E 1NJIC 2UU9Q 4LFAL 4AH6A 4IOAA 2A8VA 4JI2Q 5BR8Q 4GOPA 4KLKA 2JEAI 1Q12A 2DUDA 2OWOA 5IYDH 4PZ7A 4DAMA 1QZHA 2QEXA 1SMXA 4GN4B 1YHQA 2UXCL 4K0KQ 3HOUH 1N9WA 1OXXK 4QGUA 3TS0A 1S72A 4LWCA 4IOCA 1VQNA 3M4OH 3EIVA 1X6OA 3UDXA 2ZTEA 1B8AA 5M5XH 4UP9A 4POGA 1XMOL 2VUMG 1PA6A 4IPCA 1S40A 2IX0A 2R7DA 3SGIA 4JI3L 4NXNL 4LFBQ 1J5EQ 2E5LQ 1J5EL 3K80C 3F2BA 3F2CA 1K83H 4LUOA 1A63A 1B7YB 2ZM6L 1Y1WG 3TS2A 4WJ4A 3KYHC 4APVA 3ULPA 3HKSA 1VQOA 1PH8A 4GLVB 3GDEA 5IE8A 2R7FA 4PG3A 1P16A 2JA9A 5C3EH 1YITA 2VNUD 3HOZH 2E2HH 1J6QA 4MTNA 1D7QA 1NMFA 4JCVE 4A3LG 1QUQA 4JOIA 5M3MH 1V43A 2IY5B 3BZKA 5BR8L 2HHHL 4JI2L 3HOWG 1I6HH 2BH2A 4NXML 1N8RC 4NXMQ 1KXLA 4R4OA 4UP8A 2JA8H 2VQEQ 2A19A 2VQEL 4JI4L 4LF4L 1E22A 1HJPA 4POFA 5H1SE 1YNXA 3STBC 1JMCA 3PSIA 3GD7A 2CWPA 3CPWA
chains in the Genus database with same CATH superfamily
5I2XA 1K3BC 4A3DB 3HOUB 5LMNW 5FO7B 4ZKBB 2MD9A 4L8JA 2AUKA 1FD7D 3NPPA 1M4VA 1EZ6A 2BA0A 1SLJA 1NCVA 1IL8A 2K0YA 3E5SA 1LACA 2RDFA 1L2FA 4CDFC 4YY3Q 4TRDA 1WCMH 4JI5Q 1CKMA 2F4VL 2EHSA 4YWKA 4MRTC 4AYBE 1OXSC 2EXZA 5CORA 1GUWA 2IWHA 3T1HQ 1RODA 1BR9A 3UE0A 1QZGA 5EJWA 4GZYC 3I4NB 1M90Q 1BOSA 1YEZA 2HCCA 2K5QA 3KLWA 1T5EA 4Y7NB 4DA2A 3AMUA 3JAML 3FPPA 4DR1L 1NSNS 2M00A 1Q82C 3M4YA 3GTPH 1GM5A 2E74C 2YTVA 2K52A 3STBD 4A3EB 2R6GA 2LKVA 4H0LC 2E1MA 3H0GB 2ZJRA 3BU2A 2CKZB 4DR5L 1WTHA 3J7ZC 1Q90A 1QJOA 1PDQA 2PQAA 4IO9A 2KEEA 3J81E 3S15H 4ZLTF 1C0AA 2KOQA 1WTPA 4ZCKA 4GKJQ 1S3OA 1X3FA 2P5ZX 2NB0A 4U0FA 4DV4L 1A8VA 1YZ6A 4DK3C 1HNXQ 3GTQB 1VQ7A 2N6YA 3LX0A 1GOZA 4HKGA 1IKMA 4PH0A 1Q8KA 4A3FB 1HPCA 1O7LA 4ALPA 3HOYB 3AFPA 2NWGA 3HS0C 3LGJA 1VCIA 1D8LA 4HJ7A 2Z44A 5C3WA 3S15B 3S14H 2B3GA 1XTDA 3EN2A 2WPTA 1RTNA 4RCOA 4YCVA 1VQMP 4FF2A 5CR3A 5C3EG 2ZM6Q 3GTJB 4IPGA 1TWHH 1PZJD 1D1DA 1KHIA 4XTCS 4X62Q 1GJXA 2YV5A 4PZ6A 4A3KH 1G91A 3I8ZA 4P73A 3L0OA 2GZJA 1TU2B 2K32A 2YTYA 3SXHA 2LMLA 4KHZA 4KHPL 1Q1EA 2TSSA 4R4TA 2SEBD 1HUNA 1X3QA 2JN4A 5CV8A 4X64L 1ILQA 3V05A 3GTMH 3G1GA 2GZIA 4KHVA 4DK0A 4J8QA 1S5ED 4Z9CB 2EVBA 3KLRA 1EYAA 2ZXOA 1VQKP 2AVAA 4OEMB 2Z46A 1CSPA 1EQRA 4C1NI 3G6EP 5HGTA 2Q8TA 1KQSA 3DS5A 1F9PA 4JYAQ 1YJWP 4DNRB 2NBFA 5IGDA 1QNUA 2F1MA 1HQBA 2CH4W 4CA3A 2FVAA 1SE3A 4EX5A 4DUYL 4JI4Q 3SE0A 2PQAB 1FNVA 2NYZD 2RQXA 3EBEA 5KRUA 3MXNA 4A3KG 1STEA 1JQYD 1F9RA 1HR0W 3CKIB 5DM63 4X65L 1STBA 3G28A 1DM0B 4BBRB 2IX1A 1F9QA 2FHSC 3NWTA 2K14A 3NEMA 2K1BA 3I56P 5FLMG 4JI8Q 4CJ2C 2D5DA 2YYZA 3GTMB 3KLSA 4A3EH 3D3RA 1M6EX 3W5OA 4BXXG 1KTKA 2WACA 3N52A 1KLPA 3CC2A 1MGSA 1XWEA 4KY7A 2R93B 1DZ1A 3I3CA 3S1QB 4JI1L 2EIFA 4QMGA 4DUYQ 4C3JB 5I4DA 4LF8Q 4PH1A 5KP8B 1AUMA 1EUJA 3HOVH 3I70A 4DUZL 1HTLD 1UE5A 2KOOA 2DNCA 3K57A 3ERSX 1OTCA 4JI0Q 2YTXA 3PO3H 5C4HA 1IMPA 3I4MH 1PFSA 5BN4A 3UI2A 5IP7G 3HOYH 1A3VA 5M5WH 4C3HB 2EIAA 2JYLA 5ELNA 4OX9Q 1BXIA 1DOKA 1Y1VG 3C1FA 2RHQB 2L11A 2L5TA 5IWAQ 3J80c 1JJCB 1DD2A 2CW0C 4IURA 4S3SA 3MFGA 2ZJPA 2XRQD 2CQ8A 1PXUA 1PH7A 2GYKA 4JI0L 3I4LA 4A3JH 2K05A 2JEBI 3RZOH 1Y14B 4O2DA 2A68C 5JOBA 4EVOA 4WJ3M 3CCSA 1S4ZA 3CXCA 4QF4A 2EY6A 1DYQA 4ME5A 3VR6A 2CQAA 5EQ0A 2F0PA 1PLFA 1X65A 4DGZA 1SE8A 2HT1A 2E76C 5A2QL 1Y1WB 4C3HH 2XIWA 1KL9A 4B9XA 1Q46A 2CFMA 4KV6A 2FACA 1I50B 1JOOA 1AN8A 3X3MA 3GKLC 2EXDA 2HDLA 3ULLA 4A3CH 4K5VA 2EYJA 3TN2A 1KLGD 4OIKA 2JXMB 3A0JA 4PMBA 3HKZG 3Q22A 3GTOH 2KGAA 4X66L 3CCEA 2SDFA 1XMOQ 1B3AA 3TP5A 1Q3LA 4J15A 2WB1B 4KI0A 1Z7TA 1HR0L 3D6WA 3CMAP 1PFMA 3D31A 5T1GA 2FMCA 3GV3A 3VR4A 3GTOB 2RSOA 3CCVP 3BZCA 2BCOA 4TKOB 3HRZC 4H13C 3RZDH 4HJAA 1I50H 3HOZB 4Y52H 4DG9A 1R4PB 3G4SA 2K5VA 3S17H 3R93A 2E2DC 5LMUQ 3E2DA 1ZEQX 1HTPA 1VQHA 1G6PA 4IFDI 1X55A 3NBIA 1FVIA 5IOCA 1TS2A 5C3XA 4AIMA 2JA7H 2LS01 3RZDB 2WIIB 5LMNL 3G71A 4ZKCB 1SNMA 3R3OA 3CCQA 2KENA 5L37A 4L6TB 1EWHA 3KF8B 3CF5A 2VUMB 2AHOB 1PH4A 3Q20A 1L0YB 3I90A 5J39A 5M5WB 4OWWB 2NO8A 4DV6L 1U4RA 1AH9A 3AU7A 1ML0D 4B3TQ 1TXYA 3HEJA 2L9FA 3KJPA 5C6AA 3DEPA 4DR3Q 2ASBA 4A3JG 3DWAA 4PWVB 1Y8PB 2KGCA 1MKHA 2LIUA 1FYCA 2UUBQ 3PIO3 1X3GA 1MBYA 3F1ZA 1GO3E 1K9MQ 1PTOF 3TP7A 4B3SQ 1F2ZA 3BJUA 4XYQA 2VQFL 3PIPA 4OONA 5JEAJ 4JI7Q 1EYDA 4PMWA 2NVQB 2Z0SA 5ELDA 2PZTA 3M1MA 3I4MG 3DS3A 1HA6A 2DN8A 4ULLA 1H9RA 5EPKA 2EYPA 4UDUC 3PV0A 4LF8L 2PEJA 1EIAA 3H94A 1MHWC 1R9TH 2MNAA 4P74A 1KDBA 4DR3L 1C7YA 2JA8G 3PF4A 2MJ8A 1SEBD 4JBJA 4HIDA 5EPJA 3TSSA 4IUQA 4A3MH 1CA5A 3CCVA 1FGBD 2R92G 4BY1G 1WTVA 1ASZA 4C3HG 4ZK9B 2B2VC 1L1OC 4N8FA 3I55A 3E3XA 2LXKA 1RTOA 4FF4A 1U0LA 1EOQA 4COCA 4P71A 2E2HB 1HR0Q 3SK8A 4LF9Q 3CAMA 1PVOA 2BE5C 1KQSO 1VQIA 1PH5A 1RL2A 3IKJA 1LTSD 1SR3A 1K8AQ 2PO4A 5C44G 5C4XG 4FO2A 5BN3A 4FXDA 4CHTB 1K8OA 2NVXB 1IYVA 4XFYA 1QUQB 1JE4A 1PRTF 2Z6BA 3NP8A 5JPNC 3BVGA 1PYWD 5C4JH 3BYTB 4EQ5A 1YJNA 1BDOA 3RG2A 3SVMA 1JWUD 1PYSB 3DS4A 3FKIB 1QVCA 4V0BA 2A69D 1WTWA 1J8IA 3B5IA 1CM9A 4DXGA 1A15A 1ILPA 3NSWA 4DV3L 3LWUA 2NVYH 4NMZA 3JAME 1DXMA 1JT8A 2A6HD 1VQAA 3GTJH 2WB1E 2K28A 1NJIC 2A6HC 4IOAA 1SAPA 1S5BD 1ONLA 2KUMA 4KLKA 1Q12A 2CWOA 1LABA 2KODA 4DAMA 2QEXA 1QZHA 4GN4B 4CJ1B 4K0KQ 1PTOH 1HY8A 1TY0A 3G26A 3EIVA 5M5XB 1X6OA 1B8AA 3H6MA 3LMOA 3MVVA 3A8IE 2K7VA 1PA6A 3J7AV 1JJ2O 2IX0A 5EKLA 1J5EQ 3CCLP 3F2CA 4LUOA 1A63A 1B7YB 4K14A 2ZM6L 1SYCA 4WJ4A 4HN7A 2VNUD 1P16A 4IN3A 1YITA 3H0DA 1D7QA 3C2PA 1GXGA 5LL6S 1V43A 5JPMC 5BR8L 4JI2L 2GDYA 5EGTA 1X3OA 1LTAD 4NP5A 2XRSD 3CQZB 4KTAA 2A19A 4CKEA 2VQEL 3STBC 2DY8A 4KY6A 3CPWA 1M74A 4X6AH 4LJZC 1GUGA 1XYIA 3E0EA 2D62A 2R7ZB 1Q1BA 1W3SA 4X3KA 1GUNA 4MN3A 5EKIA 1Z6HA 1ZMBA 4LF5L 2OARA 3GTLB 3DEOA 3CMEA 1EQTA 1FJGQ 5LHY1 4QQBX 3RLNA 2Q8RE 4RMFA 3KOJA 2Q8IB 2KOSA 5CV9A 5IIFA 5DEHA 5IGFA 1XPUA 2E2IB 1O7IA 3HOXB 2QCPX 4OIJA 2FVEA 1JCKB 3PO3B 3M3YH 3QIAA 2R7ZH 2B2VA 4U68A 4K8JA 5CBEE 1N32Q 1YBYA 4HSPA 4PZ8A 5K5PA 2L22A 3PIP3 4XQNA 3HGBA 1N34L 4PMCA 5I9PA 1TWHB 1U4MA 4U0CA 4DV5L 3TMEA 1YI2A 1RHPA 2F0WA 3ICEA 1XNQQ 4M0IA 1FNUA 3M85A 3HOVB 1E0BA 5C4JB 3T13A 5IGCA 1ET6A 3HOXH 3RNUA 3H0GG 2E8GA 2JA7G 1QOHA 4P72A 1BO0A 1E1OA 2VLNA 2PW5A 1FJGL 1M6NA 5EAYA 3GTLH 1JWMD 2CQOA 3PUXA 4ZQ3A 1J9OA 2K5XA 3I4NG 4R1JA 2QEJC 2XN9C 4YHHQ 4YCUA 3T56B 1JJ2A 2K94A 2L1BA 5JJZA 2E2IH 1LTRD 1TWCB 1D5ZC 4IFDH 1UAPA 2SNSA 2Z6KA 4G7ZC 3D4DA 2BOSA 3J80i 5M5YB 1I94Q 1IW7C 5ISRA 4DKAC 2L0CA 4QCLA 1W2BO 1YNND 2EZVA 2O2LD 1K8MA 1SNPA 1IKLA 1QNKA 1E7ZA 1BCPB 1VQFA 2CWAA 1Q81C 1N33Q 3MXNB 1X32A 4CKCA 2Y0SB 3PO3G 4XDXA 4KD3A 4X62L 5GAEC 5IT9E 5KNDA 4F37A 3DM3A 2V4DA 3GQBA 2RSNA 2O5IC 1NE3A 1WD1A 4ZAIA 2Q2UA 3HOWH 4KHPQ 2WKDA 1PH6A 4A3IH 3RN5A 1NQ4A 1ZNVA 1STHA 5E3FA 4RHSA 3URYA 4AQYL 4XT3B 3PO2B 1ESFA 2OTJA 1YIJP 2KHIA 4RGNA 4JI6L 1HNZQ 2P9XA 3J81i 1MSHA 2L4BA 3MC0B 2K4KA 4MZ9A 2WB1G 4GNXC 4B3RL 3A7AB 2GDXA 1Z9FA 1CHPD 2QILA 1WI5A 5M3FH 2EYLA 5CZDB 1W6JA 1PTOD 2GZEA 5J3BA 2A73B 3QOJA 3CC4A 3GTKB 2MF4A 4BBSG 4JI1Q 5KEEA 2SOBA 1A8OA 3G6JB 2OCEA 3CCMP 4JOIC 4B08A 5KP6B 3VYRA 4NXNQ 1KAAA 2JK8A 1YNJD 4R4IA 5C0XH 1OO9B 1I6HB 2K33A 5IT9L 4RFBA 2JU2A 4JI8L 3DLLA 3KK7A 3VYUA 1VQMA 2I5MX 3R2IA 1A2TA 1JB7A 3G7LA 2MGSA 1CA6A 5KIXA 4HCEA 1EY9A 1ZYRD 1HZAA 2PMZE 5CV5A 4CGYB 4Q5VA 1WTRA 2KHSA 4OO1H 1EWCA 4ID6A 5F2OA 4EQOA 1LTGD 4K2LA 1EZ8A 1SYDA 4FNFA 1VQ4P 1TS5A 4JG2A 3DHQA 1F9SA 4K0KL 4A3BG 1K8AC 3D0FA 1EY5A 2K2QA 4XROA 2AQ3B 3NELA 1ENFA 2PNGA 2FFKB 2PCFB 3TDQA 1KABA 1L0WA 5GAHC 1YJ9A 4K5WA 2I5HA 4QY7A 4XQQA 5HGOA 4QB4A 1KIXA 4A93B 1EQVA 2N49A 5C5MA 1H9SA 1F80D 5HGMA 2VQFQ 3D6CA 1D1IA 1LT4D 3PUWA 3MTSA 1IL2A 2R92H 4DR4L 2UXBQ 4FP5D 3IAYA 4ILWA 3KJOA 1K3RA 4OWTB 1QRJA 1K30A 2JA5B 3S1RB 3KF6B 2JU1A 3K81C 3K7AH 4GOPB 4O42A 1QVGO 2EE1A 3NTKA 3CCLA 4DV2Q 4OO1I 1TWFH 3I72A 2EQSA 1GKHA 4FVMA 3S17B 5C3EB 2PI2A 3FDTA 1VQLA 3RZOB 1TWGH 1PZID 1BBUA 4A3BH 3ND9A 3T51B 4A3IB 3JAMc 3S1NB 1X56A 2JA7B 1ICWA 5I6WA 1TQOA 3P20A 3QR8A 1K9MC 2O5JC 1DV5A 1BCPF 1KRTA 4L5QA 2VW9A 5CMDA 3CCRA 2X6LA 2FQ0A 2Z45A 1CHQD 4DK1A 1MI2A 4CJ0B 1EY7A 2RVLA 4OWXB 1Y8NB 3Q24A 2UU9L 3CD6A 3P75A 4B3RQ 1H9KA 1T5XD 5AFWA 5HURA 4WFN3 2JSOA 4R4CA 2M9VA 3K5OA 1I6VC 5IT9c 3S1RH 1XNRL 3E9HA 4DAVA 2LL8A 3VR3A 5F2KA 3PF5A 3TBIB 4DU9A 2AUJD 1Q86C 1I4HA 2XTIA 1I94L 2BA1A 4U673 1I4RA 2A6EC 3AEVA 5DCKA 2NTSA 1JWSD 3B6YA 4RKBA 3S1NH 3A8JE 1PTOB 1CQVA 1SNCA 3A54A 2KECA 1CKNA 1VQCA 4GKJL 3S24A 2F0UA 1M1KQ 2WKCA 2QEXP 3R8BA 3M7NA 2K0XA 2KORA 4IZ6A 5E7NA 1AW7A 2JJQA 4N8X1 3G6EA 4PQXA 2IW3A 1EY0A 4IFDJ 3J7YW 1JC7A 4NB3A 4BY7B 2KGEA 4XFXA 3M7GA 3M4QA 1PFBA 3ONAB 1E2ZA 3WDNA 1Q7YQ 2ENBA 1VS0A 3GTQH 1AP0A 1EY6A 2ES2A 3EVQA 2EFJA 2IJ0A 1DGSA 3V2TA 2GDWA 4Y7NH 4QKOA 2FAEA 3BDOA 4BPHA 5EW5E 1SROA 3NXWA 3FPUB 5IP9H 3T53B 4LF7L 2XXMA 3VYTA 1LTBD 2LSSA 4A3CG 4A3GH 4ZRZA 3OSOA 2KR5A 2JA5H 1CKOA 2GN5A 1PYBA 3CU7A 4JK1C 2YU9B 3S2DB 2PNHA 2CCZA 1F2YA 2PNRC 1EIFA 4LNQA 1GHKA 2LY7A 1HNWL 3DMUA 3MEFA 2G9DA 3CC2P 3I91A 4MIUA 4YWLA 3I4NH 1DONA 1YIJA 1IBMQ 5C4ZA 2F0FA 2OQKA 4DK6C 1VQJA 2EOTA 4A3MG 4LAAA 5FLMH 3CPWO 3K7UC 3OW2A 1T8KA 2M5RA 5CYUA 2D0PA 1LT3D 2PYKA 3VA5A 3NK9A 1H95A 1VF7A 2KA7A 4JV5L 2R3ZA 2DGYA 4GKKQ 1W6KA 2X6GA 1G291 1HFGA 2PZWA 2KCCA 3SR1A 3S2HB 3Q0AA 2JA6B 1LYLA 2DNEA 1MZ8A 2FQ1A 1QCBD 2ZXPA 2MVVA 2PMZB 2M2LA 1UE1A 4G4KA 2PQEA 1PTOC 1SNOA 2A1AA 3A7LA 4NPSA 1VQKA 5GROA 4IUPA 2CH4A 1UE6A 1NBWA 4KJOA 4UAIA 3CW2C 1XX8A 2LFNA 4LW1A 1VKUA 1WFQA 2ROQA 4TSSA 2HQLA 3ZYYX 1H9MA 2Z9HA 4RCNA 4QIWE 3I55P 2ID0A 1XXGA 4ODGA 1Y1VB 4LFCL 3QOLA 1LT6D 1GUTA 2IT1A 1B53A 1U4PA 2ERHA 3FRPB 1PZKD 4MNOA 3HKZE 3RD4A 3H3VH 1FL0A 3MXGA 3VRLC 4BBSH 4UP7A 3TQYA 2F3WA 1SYFA 1AE2A 2QW7A 3G29A 1DNYA 1KNAA 4IZ8A 1XPOA 3KDFA 5M3MB 1S5FD 4IALA 3CCEP 2LKIA 4NKLA 4R9WA 1GXDC 1EIHA 2A8VA 4JI2Q 5BR8Q 1ZYRC 4H44C 2O4XA 2B8GA 3CXCO 1SMXA 1S72P 2RCFA 4PV1C 1YHQA 2UXCL 1BNZA 3M4OH 4IOCA 1XMOL 4R0MA 3SGIA 4JI3L 4LFBQ 5DNFA 2E5LQ 1J5EL 5BS2A 1E0HA 3EJEA 2EJGC 5M3FB 1CI3M 2XZ0D 2N5IA 1Y1WG 3TS2A 4APVA 2F0KA 3HKSA 3KUPA 1PH8A 4QNBA 3GDEA 2VLQA 1AYIA 2JA9A 3ND8A 2TMPA 4A3LG 1QUQA 4JOIA 3T4AC 5M3MH 2B2UC 3NHHA 4IUNA 3BZKA 2CGQA 1I6HH 1KXLA 2A74C 1UEAB 3OW7A 1A6XA 4JI4L 4GR2A 4OL7A 1HJPA 4POFA 1NAPA 4RGOS 1A2UA 1C4QA 4JI3Q 1JR0D 2QDBA 3K58A 1WCMG 1VQ6A 3TP8A 2ZTDA 2F0SA 5HY6A 3I4MB 3U58A 3BVMA 4UPAA 5C5LA 2B63H 2JA6H 1B50A 2FHTA 2VB3X 1KRSA 2NUCA 3OIQA 1SSOA 3KBXA 4RKLA 1YHAA 3AYHB 1K73Q 1S5DD 3X3NA 2B39A 3EJIA 2QF7A 3GV6A 1ASYA 2NZ1D 3SK4A 2PEOA 4RA8A 5LL6X 4HTHA 1IYJB 4C2MB 3OPOA 3M3YB 3EJDA 1UUPA 1JOQA 2MY5A 4DR7L 2WV6D 2XVSA 1HHVA 5I9OA 4C3IG 4TVAB 3K5MA 3J7AF 4DR1Q 2VY3A 2EYFA 5IGEA 3DWQA 4I7AA 2MR7A 1PHJA 1VQ5P 1SYBA 3A8KE 2JB0A 2N55A 3PUYA 1OR5A 2LF4A 5IP7H 2F0OA 3HOYG 2RA4A 2JO0A 1IBKQ 4L5SA 3KDFB 4XQJA 1R4QB 3UDGA 4HAEA 2BUOA 3UDFA 1PH1A 4B3TL 1N33L 2ONTA 2X2BA 2EY2A 5IWAL 3RR5A 2LXJA 2XWBB 3BZDB 2D2CC 4IPHA 1QILA 4P75A 3V96A 4BBRG 4RAUC 2KG6A 3MXUA 1H9SB 2OTLP 2EYOA 5BS1A 1N34Q 4DV4Q 2MQHA 3HG9A 1D6EC 3E9IA 4DR7Q 5KP7B 1BUVT 3OW2O 3NBHA 3G4SP 1WYDA 5GADC 2FMMA 2A6ED 2KBNA 1B9NA 1GUOA 3CPFA 2WP8J 3OWEB 2XNAC 2B2WA 1BF4A 1VQ8P 4A3EG 3UDIA 2JQOA 2WAQB 1X9NA 4AYBB 1Z6MA 4YCWA 1YHBA 2K5HA 4LMQD 1EL0A 1WTOA 1L0HA 1V1PB 1VQ6P 2K04A 2Z4IA 3CCJP 1L1OA 2F52A 3HZXA 4JV5Q 1HQRD 4OELB 1XNRQ 2FXQA 3EFXD 2N6ZA 4A4IA 4KMUC 2BE5D 2DJGC 4GLXA 1KDCA 4JW0A 1G2TA 1TT2A 2J0TD 4HMIA 1GD7A 2LOLA 1SE2A 2CNRA 1CQFA 3C1EA 3MHBA 4RGTA 2KCMA 2EJMA 2EY1A 5G3LF 3ITPA 4HJ8A 1UJZA 1VQOP 4X3TA 5CV6A 1VMCA 4G7HC 1OXVA 4AYBG 2VUMH 4JC0A 4XYOA 3I7FA 1LTTD 4RG1A 1L0XB 3DS2A 3GZMA 1K83B 3SHLA 5EPLA 1V1OA 1IBLL 4K5XA 3T1HL 4A3FG 1LV9A 2VB2X 2UUAQ 3J80E 3NQIA 1HZBA 2QGQA 4NW2A 3RLOA 2NZOA 4GN5A 4I7ZC 4DV1Q 2MO0A 4F88A 1NY4A 3J81L 5M3FG 2Q2HA 2NZHA 1BBXC 4DAPA 3TP6A 1RO2A 4XIGS 4B3SL 5ELBA 3K59A 3K7AB 4FF3A 5HV8A 1YVCA 2MO1A 2AQ1B 1ICFB 2EG5A 2IHFA 2KOPA 4L63B 1H9JA 2F4VQ 3U50C 5FLXE 3KF6A 4HIKA 4B3ML 2AFDA 1LTID 4XT1B 3DM1A 4CKBA 2G5DA 3K5NA 7CEIA 2HD3A 2BHVA 2VLPA 4KKSA 4H02A 4DV1L 4DV5Q 1IMQA 3CMEP 1EOVA 4OO1G 1X3PA 4MTKA 3S2DH 2AQ2B 2R93G 1HXYD 2PPBC 3RN2A 3T16A 3M9BA 5CC4A 1C48A 4A3DH 4JPBW 4A3MB 4BY1B 3J80L 4KN7C 1STGA 3KFUA 4F87A 4LF7Q 4L5TA 1F77A 3CE7A 4IPDA 3LNNA 3CC7A 1SNQA 1BBWA 1RO0A 3FKIH 4LF4Q 3CCMA 1B3QA 2CG5B 2DNWA 2HIVA 1HNWQ 2GVAA 2JQ4A 1K28A 2IPKD 3N6RA 1X3EA 2C35B 5FJ8G 1EIGA 3NTHA 1BCPD 3SK6A 1KAWA 2I5LX 2JA6G 3BVZA 5I4TG 2ICIA 3J81c 2K93A 1KNEA 4JI7L 3GTPB 1JB3A 3SDZA 3AB9A 1ZKOA 3K0YA 5KNBA 1CT1D 1Q81Q 2N88A 3FHWA 1R9TB 3H15A 1VDZA 5J1ZA 4BY1H 4HCSA 4JYAL 5C44B 1UE7A 3P1HA 5IYCG 2GVBA 2JA5G 1EU3A 2B2TA 2NN6I 3K6OA 4DF7A 2N50A 2BH8A 4DR6Q 3RG6C 5IP9G 4G7OC 1CFMA 1IHZA 2AWNA 3D4RA 3K5LA 2MHVA 1XNQL 1E1TA 2XGTA 4A3FH 2KG9A 1I4PA 4DR2L 4OHJA 3PGZA 3J7A5 4FXGC 2X69A 1B1ZA 4A3GB 3S1QH 4C3JH 1D1KA 3VR5A 2KEDA 2A68D 2ATWA 5C4XB 1JORA 4KKUA 4KD4A 1B44D 2YU9H 4K6LA 1EQQA 5IY0A 2K0DX 2Z6KC 2WAQG 3G1IA 2H4OA 3EA6A 3ERQA 4A3KB 4M8AA 4X3UA 4IFDG 2KG8A 1LUZA 4QUFA 1QVGA 3PO2G 4K2KA 4QL5A 1V1QA 1VQLP 3W2DA 3S2HH 2UUBL 2N8NA 3O13A 4J1MA 1YNJC 4XRQA 5GQOA 3CCUA 1XJVA 4V190 4B9WA 1OXUA 2VL6A 3P05A 3CQZH 4G57A 4RGMA 2Z4HA 2PI2E 3CC7P 2Q2IA 4BY7H 1NUCA 2FVFA 2JYGA 4GS3A 3H0GH 4IUVA 4HJ9A 3CCQP 2JP1A 3HOXG 2XZ1C 3W1BA 2OQ0A 3DUZA 1MJCA 2B2YC 3PMFA 2XV6A 5FO9B 3CCSP 1PFNA 1AEXA 3OOCA 1UNKA 2PENA 5FJ8H 3QO2A 2R7ZG 2L15A 3K8AA 5D14A 3PO2H 1A43A 3TREA 2VLOA 1NTGA 2VXWA 1GPJA 2MUYA 3KF8A 4LF6L 4LF6Q 1O7YA 1QWYA 2KHJA 2UXDQ 3WWVA 2Z1CA 1DCZA 2F0LA 1NR2A 4QJFA 1IXRA 1TVXA 4DNIA 5I6YA 1ESRA 1Z47A 2F0TA 4BBSB 4K6DA 4LF5Q 1CKNB 4OGQC 3IL8A 3GP7A 4PNYA 4C3JG 3NUCA 4RWSC 2IX3A 5C0XG 3QWNA 2UUCQ 3FMCA 1HZCA 5EJDA 2CHBD 2IHEA 2L4NA 3U9SA 2F0NA 3BDCA 1LT5D 4K8IA 3BG3A 5BN5A 5I2YA 4B3MQ 1M90C 2AKWB 3H3VI 1JICA 2HDMA 3MEHA 1B4OA 4DV0Q 1STNA 4GOPC 5FKAC 1MD2D 3BYYB 2HCIA 3AQQA 3T1YQ 5IYCH 1VQ9A 5COYA 5AJ3L 1BCPC 2RDHA 5IYBH 3GTKH 1O80A 2FJ2A 3VDYA 1S5CD 2FADA 3L7ZC 3WOFA 5C0XJ 5M5YH 1SMYC 1CUKA 4ZUJA 3DS0A 2K6AA 1XPRA 4LF9L 4F7XA 4DV3Q 5JAVA 1G2SA 3GZLA 4J6HA 1NNXA 1XTCD 4Q0FA 3MWYW 5DLQE 1ENAA 1Y8OB 3PCOB 4YHHL 1EIYB 3I4OA 4A3GG 2F3IA 4DUZQ 1KC8Q 3H47A 2ZXRA 4EGVA 1IBLQ 1CSQA 1VQ7P 3FKIG 4F8MA 2N98A 3A5ZB 5IODA 2B2UA 1ZXTA 1AFPA 5JJKA 3HOWB 1VQGA 4CDDC 1EYCA 1VQ8A 4EQPA 3CP0A 4LK1C 4JBWA 1VF5C 4A3LH 2E5LL 3OHXC 5JVG3 2CW0D 3PIOA 2G9HD 4XFZA 1O78A 5TSSA 4NDXA 4LFAL 3D4WA 4GOPA 5J22A 4EQNA 4FYDA 2PY8A 1CK1A 1F2MA 4ZYSA 4PZ7A 4XXEA 1N9WA 4QGUA 4LWCA 1M8AA 2PEMA 2A69C 2R92B 4NEOA 4POGA 3UDXA 2ZTEA 1LLRD 1B2TA 4R8IA 3HZQA 1SYGA 1S40A 2R7DA 5EKKA 3K80C 3F2BA 2JA8B 1K83H 5NUCA 2PZUA 1VQOA 2XSCA 4GLVB 3BS1A 2R7FA 4A3JB 3D8GA 5C3EH 4IUTA 3HOZH 4JCVE 1BQQT 1RD9D 2IY5B 3WOEA 5CBAE 2HHHL 3HOWG 4NXML 4NXMQ 1YNNC 4HR7B 5G3LD 4UP8A 2JA8H 5K36H 4BPGA 3NQTA 3C3LA 3B4QA 4LF4L 2OF1A 5H1SE 3GD7A 2PEQA 2CWPA 4KKTA 3HP3A 2RDGA 4HIOA 3IRBA 4DR2Q 1Q82Q 2AMCB 2WFWA 1VQDA 3GJNA 4A93H 3UE1A 2B63B 4H2WC 2D0OA 1WJJA 1NR4A 5HGLA 3L3OC 3OWFA 1EWIA 1PMRA 5F2DA 3S16B 1TIID 2HQEA 2L9HA 4DV7L 2OT2A 4UHPB 4KY5A 1M1KC 1VQ5A 1JE5A 2OTJP 1CZWA 5E4WC 2HHHQ 1V8QA 2H1EA 4IUUA 3S1MH 4LFCQ 4X65Q 4C3IH 1WTQA 2KOLA 5CGKA 4YWMA 1BVSA 4A3BB 4X66Q 1W2BA 1PH9A 3RLFA 1A3UA 1E3PA 4BA2I 2V1CC 1BKBA 3KBGA 4GNXA 5LMNQ 4CBVA 1STYA 1EU4A 4DR5Q 3HKZB 3P7JA 2GZGA 1SE4A 2K5WA 3F2DA 4OX9L 4DR4Q 5EBDA 2UXBL 3C46A 2IL8A 3S9WA 4DV6Q 2JBGA 1K0RA 3W3AA 4IJHA 2R61A 2B63G 1U9RA 1AZPA 2KWLA 1LO5D 3A55A 4O1NA 4KK7A 3L9AX 1AE3A 5GAGC 4GKKL 5IGBA 3L2PA 1N32L 3OMCA 4L5RC 1NMGA 3FP9A 4QIWB 1CEIA 3MGEA 5JVH3 3S1MB 4DFAA 3LRYA 5LMUL 2F0QA 4C56C 4X3SA 5FLXL 4MHEA 2Y0SE 1K0SA 2AWOA 1LTLA 3NWSA 3CRKC 2K01A 2K50A 2L12A 2QDLA 2QNWA 5KYLA 1E6JP 3DXJC 2L0QA 2F0MA 2EYMA 1SMYD 3R2TA 5CV7A 3NBHB 1N36Q 3ER0A 3TEHB 4U0EA 1HH2P 2E2JB 5ELEA 2MP1A 1VQPP 1F2LA 1EY8A 5C4XH 2QKIC 3G0VA 1IYUA 2MPMA 3NENA 1RKNA 2NVXH 1KD1Q 1E2VA 3VR2A 2NN6H 2XWJB 1U5KA 2RF4A 2Y0SG 3U4VA 2JGPA 1IBML 3IFTA 4BXXH 3CCUP 1YI2P 1A0IA 1RDPD 5FO8B 1QVFA 2MFIA 2NVQH 1QB5D 1SFOH 1VQ9P 2WAQE 1PRTB 4A75A 1CZGA 4YIJA 4BA1I 4DXFA 1VQEA 1HQMC 3MFYA 3SK5A 1A3TA 2F0IA 2UUAL 2EHTA 4AQYQ 4IJLA 4X64Q 4TQUS 2NTTA 4WORA 1VHNA 4DN4M 3J81j 1IUQA 3M4PA 5JJLA 2XT1A 2ICEC 2KCTA 2VS1A 3H4EA 2N78A 3QG1A 4HJ5A 3AFQA 1I4GA 3SEBA 2C5CA 4FXKC 3NTEA 1L1OB 1GXHA 3EQLC 1Y69U 4RHRA 4FF1A 2H5XA 1VQBA 2GA4B 3NTIA 4N9TA 3A74A 3OYYA 3Q23A 5EBCA 5FLXc 1VQ4A 2EPBA 5C44H 1MJEA 4U0AA 4HMJA 5E4XA 5ELFA 3ULJA 1WOCA 4IPYA 2NVYB 4DV0L 2ZTCA 4DAYB 2QA4A 4R4QA 1I5FA 2PEIA 1PH2A 1II3A 1TWCH 3QB3A 3U43A 1OXTA 5IYBG 5F2NA 3E0JA 1MIUA 3BDLA 4JVZA 1PRTD 2RBMA 4JI5L 3M4OB 2FQ2A 4YY3L 2BDOA 5KYIA 3RUZA 2K03A 2VZAA 1FGUA 1NJIQ 1EEFD 4ME3A 3F2UA 1SDFA 1XMQL 2F0JA 2K5NA 4DV2L 1YHQP 2DJFC 4KJNA 4OXPA 2RHSB 1GUSA 1L0IA 3VA7A 1SNDA 1STAA 3F8TA 3S14B 2FINB 2SNMA 2KVMA 4KN4C 1EFWA 2M8NA 3CCRP 1V9PA 4A93G 1K8GA 3MXPA 1IBKL 2K75A 3GTGH 2RKSA 2JE6I 1D5XC 4JBKA 1X54A 4P2CB 1TS3A 1FNWA 1B70B 1GHJA 1A62A 2ZT9C 1JJGA 5DAUA 2L6EA 4U0DA 1RF2D 1SRUA 2KQ3A 1EFID 3ZJYC 2UXCQ 3H09A 4RH6A 4LUZA 3OTOL 3T1YL 3DPHA 3MA2B 3HOZG 2B2YA 1EYGA 4HIMA 1Q8IA 2OXPA 2K5DA 3HFZB 3HYBA 1P8LA 1RJTA 1UNSA 2I07B 5D3DA 1DOMA 4ABNA 4C2MH 3CCJA 2E75C 2A5HA 1TWAH 3E6ZX 1DJRD 2EYHA 3I2ZA 1U4LA 5KGUA 2QA4P 2F0HA 3GTGB 3G48A 1YJ9P 2B2WC 2NN6G 5T1IA 4DV7Q 1E24A 1LM0A 1N8RQ 1ET9A 3PUVA 4DR6L 2K92A 1WVLA 1HCZA 2M8PA 4HEDA 3A5UA 3DS1A 1FR2A 4BBRH 2NVTH 1HRJA 2L55A 2HIXA 4A3IG 1KC8C 1C8CA 4DAYA 5HGNA 3RMHA 5A2QE 1Y1VH 5M3MG 2MVUA 3I56A 3K0XA 2AF8A 1EY4A 1UEBA 4A3DG 4PXHB 4JI6Q 1AZQA 2LTEA 3WBHA 1QG7A 2R93H 3NY7B 2NVTB 2N3SA 1TWFB 1TWAB 4QUCA 4JBMA 2UUCL 3FVQA 4H2XC 5JPAA 2EDGA 5ELOA 1WD0A 3OIPA 2I0QA 2GZFA 2BDNA 2F03A 3HOVG 2RCNA 5HVCA 2D9UA 2C9OA 2OTLA 4O0AA 1EOTA 5FK9C 4A76A 5IYDG 1KD1C 4WYMA 2KJXA 3CD6P 1I3QH 1O7ZA 1IW7D 4DPGA 3JC66 2F0EA 1CTMA 2JYOA 3PQIA 3DTJA 3LWEA 1K73C 1BAJA 2VSQA 1IZ6A 3A56A 3MZ5A 1VQPA 1ACPA 1SXTA 1I4QA 4GLAC 1QE6A 1TS4A 5D3IB 3KLSX 1D2BA 1FR3A 4DNTB 2JAZA 2Z8LA 5A35A 3CC4P 1XMQQ 1I3QB 3JAMi 3CHBD 1MSGA 2ZJQA 1HNXL 2ALYB 1SN8A 1RNIA 1G8ZD 1PH3A 3U4ZA 1DOLA 2J4XA 1HUMA 1AF8A 1YJWA 3MAQA 2UXDL 1GVPA 2Q2TA 3OTOQ 2OEOA 4FDBA 3TZDA 5KNCA 1TKWB 5DM73 4E6IA 3NE5B 5AJ3Q 3PUZA 2MR8A 5D65A 2HUGA 2I46A 3TRZA 2LMCB 2PW7A 3H91A 4GN3B 3OMGA 3GO5A 1RCVD 4CDCC 5C0XI 2PEKA 1Y1WH 4UY8C 1G51A 1YJNP 1EEID 4WJWA 5JJIA 5HGQA 1Q7YC 1RIPA 3I73A 4LFAQ 3IFDA 1C9OA 1PV4A 2LIWA 2LPKA 2N5HA 3G21A 4HSVA 3W1GA 4I65A 4GNXB 2B8FA 1N36L 3HOUG 1V1PA 4COPA 3Q6SA 3Q8DA 4N9PA 5ELCA 1Q86Q 1T9HA 1HZ9A 5FOBB 5K36G 4R8NA 2F0VA 2F0DA 1KLUD 5JEAH 1UWVA 3H3VC 4GR6A 2E2JH 5E1FA 4LFBL 4UHVA 4BY7G 1TWGB 4LUVA 1KDAA 3EROA 1B9MA 4ZUIA 1HNZL 1JOKA 3CMAA 4BPFA 2B29A 4H7BA 3S16H 5JEAG 3FEWX 1VMPA 4U0BA 4WRDA 5CV4A 2UU9Q 2DY7A 4AH6A 2KW2A 2EY5A 2EJFC 2F3VA 3DWPA 2F4IA 2JEAI 2DUDA 2OWOA 5IYDH 3TZUA 4H2YC 1VQNP 3HOUH 1OXXK 2KCNA 3TS0A 1S72A 1SJHD 1VQNA 1YITP 1TR5A 2J7ZA 5M5XH 4UP9A 2VUMG 1TY2A 4IPCA 4C3IB 2M8LA 4NXNL 1HFNA 1G6ZA 2CVRA 1EMVA 2AFEA 4BWGB 4IQZA 3CRLC 1SJED 3KYHC 2B2TC 3ULPA 1E2WA 4M1UB 5IGGA 4BS9A 1QVFO 3VYSA 5IE8A 1BXTA 4PG3A 1WTXA 2E2HH 1J6QA 4MTNA 4CDEC 1D5MC 1NMFA 2KGDA 1PRTC 1SYEA 2WINB 1I4XA 2BH2A 1N8RC 1HA5A 4R4OA 3EJBA 2VQEQ 1SFOB 4C1NK 5M9OA 1E22A 1ENCA 3U9OA 3QJYA 1SBBB 1YNXA 1JMCA 3PSIA 1WCMB 3G71P 2F0GA
chains in the Genus database with same CATH topology
1M74A 4JI3Q 4HIOA 3IRBA 4X6AH 4DR2Q 1VQ6A 4A3KG 1WCMG 5LMNW 1Q82Q 3E0EA 2ZTDA 2AMCB 2D62A 2WFWA 1VQDA 5HY6A 4A93H 1Q1BA 1W3SA 4UPAA 3UE1A 3U58A 2B63H 2JA6H 2D0OA 1WJJA 1ZMBA 5HGLA 2BA0A 2OARA 1SLJA 4LF5L 4OO1G 1KRSA 1EWIA 3CMEA 1L2FA 1FJGQ 1YHAA 3AYHB 1K73Q 3RLNA 4YY3Q 4QQBX 4RMFA 4DV7L 1WCMH 3KOJA 4JI5Q 1CKMA 2F4VL 4YWKA 1M1KC 1ASYA 1VQ5A 4AYBE 1OXSC 1XPUA 2PEOA 1O7IA 1JE5A 3T1HQ 1IYJB 2OTJP 2HHHQ 3M3YH 3UE0A 2R7ZH 1QZGA 4DR7L 1N32Q 1YBYA 3S1MH 4PZ8A 1M90Q 1YEZA 3KLWA 4X65Q 4LFCQ 4TVAB 4C3IH 1N34L 4YWMA 4DR1L 4DR1Q 1BVSA 4DV5L 2VY3A 4U0CA 1Q82C 1YI2A 3GTPH 3ICEA 1GM5A 2YTVA 4M0IA 2K52A 3STBD 4X66Q 3M85A 1W2BA 1PH9A 3RLFA 1E3PA 1PHJA 1VQ5P 4BA2I 2R6GA 3PUYA 2V1CC 1BKBA 2E1MA 2ZJRA 2LF4A 3BU2A 5IP7H 3HOXH 4GNXA 3RNUA 3HOYG 5LMNQ 2JO0A 3H0GG 1IBKQ 4L5SA 2E8GA 2CKZB 4DR5L 4DR5Q 3KDFB 2JA7G 4P72A 3J7ZC 4DR4Q 1E1OA 3F2DA 4OX9L 2UXBL 3UDGA 1FJGL 2BUOA 1M6NA 4DV6Q 1K0RA 3UDFA 5EAYA 4IJHA 1PH1A 2ONTA 4B3TL 1N33L 2PQAA 2B63G 3GTLH 5IWAL 4IO9A 3RR5A 2CQOA 2LXJA 3PUXA 4IPHA 3S15H 1C0AA 4P75A 3I4NG 4R1JA 4BBRG 4GKJQ 1S3OA 1X3FA 4YHHQ 4YCUA 1JJ2A 2OTLP 4U0FA 5BS1A 1A8VA 1YZ6A 2MQHA 1AE3A 4DK3C 5GAGC 4DV4L 4DV4Q 3E9IA 3L2PA 1N34Q 1HNXQ 2E2IH 4DR7Q 1VQ7A 4L5RC 1N32L 3OW2O 1NMGA 3G4SP 1WYDA 3FP9A 2Z6KA 4PH0A 1Q8KA 5GADC 4ALPA 3MGEA 2KBNA 3J80i 3AFPA 1I94Q 3LRYA 3CPFA 2WP8J 5LMUL 3LGJA 4HJ7A 1VCIA 1D8LA 1VQ8P 2Z44A 2Y0SE 4DKAC 2AWOA 3UDIA 1LTLA 4A3EG 2JQOA 2B3GA 3S14H 1XTDA 1W2BO 3EN2A 2K50A 4YCVA 1X9NA 1VQMP 5C3EG 1E7ZA 2ZM6Q 1VQFA 2CWAA 1Q81C 1N33Q 3MXNB 4IPGA 1TWHH 4YCWA 1YHBA 2K5HA 1XNQQ 1E6JP 1D1DA 1KHIA 3PO3G 1VQ6P 4XTCS 4X62Q 4X62L 2YV5A 3NBHB 4PZ6A 5GAEC 3ER0A 3TEHB 4U0EA 3CCJP 1L1OA 2F52A 3DM3A 4A3KH 1HH2P 4P73A 4JV5Q 3L0OA 1NE3A 2Q2UA 3HOWH 4KHPQ 2YTYA 2FXQA 4KHZA 1XNRQ 4KHPL 4A4IA 1PH6A 1VQPP 1Q1EA 4R4TA 4A3IH 5C4XH 3RN5A 4GLXA 3G0VA 1GD7A 4AQYL 4X64L 3NENA 3GTMH 3G1GA 2NVXH 1KD1Q 2KCMA 4HJ8A 2OTJA 1YIJP 1VQKP 1U5KA 2KHIA 2Z46A 2RF4A 2Y0SG 3U4VA 2P9XA 1CSPA 1HNZQ 1IBML 4JI6L 1VQOP 1EQRA 4BXXH 3J81i 4MZ9A 1OXVA 2K4KA 3G6EP 3CCUP 1KQSA 3DS5A 4AYBG 2VUMH 4JC0A 2WB1G 4GNXC 1YI2P 3I7FA 4JYAQ 1A0IA 1YJWP 2NVQH 1QVFA 2MFIA 1Z9FA 4RG1A 1SFOH 3DS2A 1VQ9P 2WAQE 4A75A 1WI5A 5M3FH 5J3BA 4BA1I 3CC4A 1VQEA 4BBSG 4JI1Q 1IBLL 3T1HL 4DUYL 4EX5A 4A3FG 4JI4Q 2PQAB 3EBEA 2UUAQ 1A8OA 2UUAL 1HZBA 2QGQA 4IJLA 2OCEA 4TQUS 3CCMP 4JOIC 2NZOA 4GN5A 3RLOA 4X64Q 4DV1Q 3J81j 1HR0W 1IUQA 2MO0A 3M4PA 4X65L 4NXNQ 5JJLA 1NY4A 2JK8A 5M3FG 2XT1A 3G28A 2Q2HA 2NZHA 4R4IA 2IX1A 2KCTA 2K14A 2VS1A 3NEMA 1RO2A 3I56P 4XIGS 3H4EA 2N78A 4JI8L 4JI8Q 5FLMG 3DLLA 2YYZA 1VQMA 2I5MX 4HJ5A 3AFQA 1JB7A 4A3EH 1YVCA 4BXXG 1M6EX 3W5OA 4GKKQ 2MO1A 3NTEA 1L1OB 3CC2A 2EG5A 2IHFA 1HZAA 2PMZE 2F4VQ 3U50C 2H5XA 4JI1L 2EIFA 1VQBA 3KF6A 4DUYQ 5F2OA 3A74A 4HIKA 3OYYA 1VQ4P 4JG2A 4PH1A 4B3ML 4LF8Q 4K0KL 5FLXc 1K8AC 1AUMA 1EUJA 3D0FA 1VQ4A 4A3BG 5C44H 3HOVH 1MJEA 4U0AA 3ULJA 4XROA 1WOCA 4IPYA 4DUZL 2BHVA 1UE5A 4DV0L 4H02A 4DV1L 2ZTCA 3ERSX 4DAYB 3CMEP 1EOVA 3NELA 4R4QA 1I5FA 2QA4A 4DV5Q 1OTCA 4JI0Q 1L0WA 5GAHC 1YJ9A 2PEIA 2YTXA 3S2DH 3PO3H 2I5HA 1TWCH 4QY7A 1PH2A 2R93G 5HGOA 1KIXA 3I4MH 2N49A 3RN2A 1PFSA 5IP7G 3HOYH 5HGMA 3M9BA 2VQFQ 1OXTA 5IYBG 5F2NA 1MIUA 5M5WH 4A3DH 2R92H 3PUWA 2EIAA 2JYLA 5ELNA 4JI5L 1IL2A 4DR4L 2UXBQ 4OX9Q 4YY3L 3KFUA 1Y1VG 4LF7Q 2RHQB 4L5TA 1K3RA 3KJOA 3J80c 5IWAQ 4OWTB 1QRJA 1K30A 1JJCB 4IPDA 2VZAA 1FGUA 3KF6B 1NJIQ 3CC7A 4ME3A 1XMQL 3K81C 1BBWA 3K7AH 4GOPB 1RO0A 1QVGO 3FKIH 4LF4Q 3CCLA 3CCMA 2K5NA 4DV2L 2ZJPA 4DV2Q 1YHQP 4OO1I 4OXPA 1TWFH 2HIVA 2RHSB 1HNWQ 1PH7A 2GVAA 2EQSA 1GKHA 4JI0L 2PI2A 4A3JH 1VQLA 1TWGH 2JEBI 1X3EA 2C35B 5FJ8G 1Y14B 3F8TA 4O2DA 1BBUA 3RZOH 4A3BH 4WJ3M 3CCSA 4AQYQ 3JAMc 1X56A 1KAWA 3CXCA 2I5LX 2JA6G 5I4TG 1EFWA 1K9MC 2M8NA 3CCRP 3J81c 1V9PA 4JI7L 1KRTA 2VW9A 1K8GA 4L5QA 1IBKL 4A93G 2K75A 3CCRA 3GTGH 1X65A 2Z45A 1SE8A 2JE6I 2HT1A 4JBKA 1X54A 1Q81Q 3FHWA 1B70B 4OWXB 4C3HH 3H15A 1A62A 1KL9A 1Q46A 2CFMA 2UU9L 4BY1H 3CD6A 4JYAL 4B3RQ 1JJGA 1UE7A 5IYCG 2GVBA 2JA5G 2L6EA 4U0DA 2EXDA 1SRUA 3ULLA 4R4CA 2NN6I 4A3CH 5IT9c 3ZJYC 3S1RH 2BH8A 1XNRL 4B3RL 3A0JA 2UXCQ 4DR6Q 3RG6C 3E9HA 5IP9G 2AWNA 4LUZA 3HKZG 3OTOL 3GTOH 3T1YL 4X66L 3DPHA 1XNQL 5F2KA 3PF5A 3HOZG 3CCEA 4HIMA 1EYGA 1E1TA 2XGTA 4A3FH 1XMOQ 1Q86C 2XTIA 1I94L 2BA1A 3HFZB 4DR2L 3PGZA 3HYBA 1P8LA 4C2MH 3J7A5 1H95A 3CCJA 3AEVA 5DCKA 4B3SL 2JA8G 3B6YA 4J15A 3S1QH 4KI0A 4C3JH 3S1NH 2ATWA 1TWAH 1HR0L 3CMAP 3D31A 2YU9H 3I2ZA 1EQQA 2QA4P 5IY0A 2Z6KC 2WAQG 3G1IA 3CCVP 3BZCA 1CKNA 1YJ9P 2NN6G 3G48A 1VQCA 4DV7Q 1E24A 4GKJL 1LM0A 1N8RQ 3S24A 3PUVA 3RZDH 4HJAA 4IFDG 4DR6L 1M1KQ 1LUZA 1I50H 1QVGA 2QEXP 2M8PA 3PO2G 4Y52H 3M7NA 4QL5A 1V1QA 1VQLP 3DS1A 3A5UA 5E7NA 4BBRH 3G4SA 4A3IG 2HIXA 1KC8C 2UUBL 2JJQA 2K5VA 2NVTH 2N8NA 5HGNA 3S17H 5LMUQ 5GQOA 4XRQA 3E2DA 3G6EA 3CCUA 1XJVA 1OXUA 1VQHA 3P05A 2VL6A 3CQZH 1Y1VH 5M3MG 1G6PA 4IFDI 4IFDJ 1X55A 1FVIA 3I56A 2PI2E 3CC7P 2Q2IA 4NB3A 4BY7H 3K0XA 4AIMA 2JYGA 4GS3A 1UEBA 4XFXA 2JA7H 4A3DG 3H0GH 3M4QA 4HJ9A 4JI6Q 3CCQP 5LMNL 1Q7YQ 3G71A 3HOXG 1VS0A 3GTQH 3WBHA 3W1BA 3CCQA 2R93H 2KENA 2ES2A 2EFJA 1DGSA 2N3SA 2OQ0A 3KF8B 3CF5A 2AHOB 1PH4A 3Q20A 1MJCA 4Y7NH 4OWWB 2XV6A 4DV6L 4JBMA 1AH9A 4B3TQ 3CCSP 5IP9H 1SROA 2UUCL 4LF7L 5JPAA 1TXYA 5ELOA 2I0QA 2XXMA 3KJPA 2LSSA 4A3CG 4A3GH 3HOVG 2RCNA 2PENA 5FJ8H 4DR3Q 2JA5H 2OTLA 1CKOA 2GN5A 1PYBA 4O0AA 4A3JG 2L15A 2ASBA 2R7ZG 3K8AA 1MKHA 4GKKL 2PNHA 2CCZA 4A76A 3PO2H 1A43A 3TREA 1EIFA 5IYDG 4LNQA 2UUBQ 1HNWL 1NTGA 1KD1C 3MEFA 4WYMA 1X3GA 3CC2P 4LF6L 4LF6Q 2UXDQ 2KHJA 3CD6P 1I3QH 3F1ZA 4YWLA 1GO3E 3WWVA 1K9MQ 3I4NH 4DPGA 4B3SQ 4QJFA 1IXRA 4DNIA 1YIJA 1IBMQ 3JC66 1Z47A 3BJUA 2VQFL 3DTJA 4LF5Q 1CKNB 1K73C 2OQKA 1BAJA 4DK6C 3PIPA 1VQJA 4OONA 5JEAJ 1IZ6A 5FLMH 4A3MG 4JI7Q 3CPWO 1VQPA 4PMWA 5C0XG 2Z0SA 4GLAC 2UUCQ 1HZCA 2IHEA 3M1MA 3I4MG 3DS3A 3K7UC 3OW2A 3CC4P 2D0PA 1XMQQ 3PV0A 3JAMi 4B3MQ 2PEJA 1M90C 1EIAA 4LF8L 2AKWB 3H3VI 2ZJQA 4JV5L 2DGYA 1R9TH 2MNAA 4P74A 2ALYB 1SN8A 4DR3L 1RNIA 1G291 1PH3A 3U4ZA 1C7YA 1HNXL 3PF4A 4JBJA 4HIDA 4DV0Q 1YJWA 4GOPC 1GVPA 2Q2TA 2UXDL 3OTOQ 4FDBA 3AQQA 3T1YQ 5IYCH 1VQ9A 5AJ3L 1LYLA 5AJ3Q 3CCVA 4A3MH 3PUZA 2R92G 4BY1G 1ASZA 5IYBH 3TRZA 1L1OC 3I55A 3GTKH 4GN3B 1UE1A 3GO5A 2A1AA 4NPSA 3L7ZC 3VDYA 1VQKA 2LXKA 5C0XI 5C0XJ 2PEKA 1Y1WH 5M5YH 1U0LA 1EOQA 1CUKA 1G51A 4COCA 5GROA 3DS0A 1YJNP 4P71A 4UY8C 5JJIA 1UE6A 1NBWA 5HGQA 3CW2C 1HR0Q 1XPRA 4LW1A 4LF9Q 4LF9L 3CAMA 1Q7YC 1WFQA 1RIPA 4DV3Q 1PVOA 1KQSO 2HQLA 1VQIA 1PH5A 1RL2A 4LFAQ 1SR3A 1C9OA 1PV4A 1K8AQ 5C44G 5C4XG 3G21A 4QIWE 5DLQE 3W1GA 4GNXB 3I55P 2ID0A 4YHHL 3PCOB 1N36L 4LFCL 1EIYB 3I4OA 3HOUG 4A3GG 2F3IA 4XFYA 1KC8Q 1QUQB 3H47A 4DUZQ 2CWPA 4COPA 1CSQA 5C4JH 2IT1A 1IBLQ 1VQ7P 3Q8DA 4MNOA 4EQ5A 1YJNA 3FKIG 1Q86Q 3HKZE 3A5ZB 3H3VH 1FL0A 1T9HA 1HZ9A 3VRLC 5K36G 1PYSB 4BBSH 3DS4A 4UP7A 5JJKA 3TQYA 1VQGA 1UWVA 1N36Q 1QVCA 4GR6A 1VQ8A 3CP0A 4JBWA 2E2JH 4LFBL 4A3LH 2E5LL 4BY7G 1HNZL 4LUVA 1AE2A 3B5IA 3G29A 3CMAA 1XPOA 3KDFA 4DV3L 2B29A 3S16H 3PIOA 5JEAG 2NVYH 3S2HH 4U0BA 4XFZA 1JT8A 1VQAA 3GTJH 2WB1E 3CCEP 1NJIC 2UU9Q 4LFAL 4AH6A 4IOAA 2A8VA 4JI2Q 5BR8Q 4GOPA 4KLKA 2JEAI 2PY8A 1Q12A 2CWOA 2DUDA 2OWOA 5IYDH 4PZ7A 2KODA 4DAMA 3CXCO 1SMXA 1S72P 4GN4B 2QEXA 1YHQA 1VQNP 1QZHA 2UXCL 4K0KQ 3HOUH 1N9WA 1OXXK 4QGUA 3TS0A 1S72A 4LWCA 4IOCA 2PEMA 1VQNA 3M4OH 3G26A 1YITP 3EIVA 1X6OA 3UDXA 2ZTEA 1B8AA 5M5XH 4UP9A 4POGA 1XMOL 2VUMG 1PA6A 4IPCA 3HZQA 1JJ2O 2IX0A 2M8LA 2R7DA 4JI3L 4NXNL 3SGIA 1S40A 1J5EQ 2E5LQ 1J5EL 4LFBQ 3K80C 5BS2A 3F2BA 3CCLP 3F2CA 1K83H 4LUOA 1A63A 1B7YB 2ZM6L 1Y1WG 3TS2A 4WJ4A 3KYHC 4APVA 3ULPA 3HKSA 1VQOA 1PH8A 4GLVB 4QNBA 3GDEA 1QVFO 2R7FA 5IE8A 4PG3A 1P16A 2JA9A 5C3EH 1YITA 2VNUD 3HOZH 2E2HH 3H0DA 1J6QA 4MTNA 1NMFA 4JCVE 4A3LG 1D7QA 1QUQA 4JOIA 5M3MH 1V43A 2IY5B 3BZKA 5BR8L 2HHHL 4JI2L 3HOWG 1I6HH 2BH2A 4NXML 1N8RC 4NXMQ 1KXLA 4R4OA 4UP8A 2JA8H 2VQEQ 2A19A 2VQEL 4JI4L 4GR2A 1E22A 4LF4L 1HJPA 4POFA 5H1SE 1YNXA 3STBC 1JMCA 3PSIA 3GD7A 2PEQA 3G71P 3CPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 Q;  4HIO A;  3IRB A;  4X6A H;  4DR2 Q;  1VQ6 A;  4A3K G;  1WCM G;  5LMN W;  3E0E A;  2ZTD A;  2AMC B;  2D62 A;  2WFW A;  1VQD A;  5HY6 A;  4A93 H;  1Q1B A;  1W3S A;  4UPA A;  3UE1 A;  3U58 A;  2B63 H;  2JA6 H;  2D0O A;  1WJJ A;  2BA0 A;  1SLJ A;  4LF5 L;  1KRS A;  1EWI A;  3CME A;  1L2F A;  1FJG Q;  1YHA A;  3AYH B;  4YY3 Q;  3RLN A;  4QQB X;  4RMF A;  4DV7 L;  1WCM H;  3KOJ A;  4JI5 Q;  1CKM A;  2F4V L;  4YWK A;  1M1K C;  1ASY A;  1VQ5 A;  4AYB E;  1OXS C;  1XPU A;  1JE5 A;  1O7I A;  3T1H Q;  1IYJ B;  2HHH Q;  3M3Y H;  3UE0 A;  2R7Z H;  1QZG A;  4DR7 L;  1N32 Q;  1YBY A;  3S1M H;  4PZ8 A;  1YEZ A;  3KLW A;  4X65 Q;  4LFC Q;  4TVA B;  4C3I H;  1N34 L;  4YWM A;  4DR1 L;  4DR1 Q;  1BVS A;  4DV5 L;  2VY3 A;  1Q82 C;  1YI2 A;  3GTP H;  3ICE A;  1GM5 A;  2YTV A;  4X66 Q;  2K52 A;  3STB D;  3M85 A;  1W2B A;  1PH9 A;  1XNQ Q;  3RLF A;  1E3P A;  1PHJ A;  4BA2 I;  2R6G A;  3PUY A;  2V1C C;  1BKB A;  2ZJR A;  4GNX A;  3BU2 A;  5IP7 H;  3HOX H;  3RNU A;  3HOY G;  5LMN Q;  3H0G G;  1IBK Q;  4L5S A;  2E8G A;  2CKZ B;  4DR5 L;  4DR5 Q;  3KDF B;  2JA7 G;  4P72 A;  3J7Z C;  4DR4 Q;  1E1O A;  3F2D A;  4OX9 L;  2UXB L;  3UDG A;  1FJG L;  4DV6 Q;  1K0R A;  3UDF A;  5EAY A;  4IJH A;  1PH1 A;  4B3T L;  1N33 L;  3GTL H;  2PQA A;  2B63 G;  5IWA L;  4IO9 A;  3RR5 A;  2CQO A;  2LXJ A;  3PUX A;  4IPH A;  3S15 H;  1C0A A;  4P75 A;  3I4N G;  4R1J A;  4BBR G;  4GKJ Q;  1S3O A;  1X3F A;  4YHH Q;  4YCU A;  1JJ2 A;  4DV4 L;  1A8V A;  1YZ6 A;  2MQH A;  1AE3 A;  4DK3 C;  5GAG C;  4DV4 Q;  1N34 Q;  3E9I A;  3L2P A;  1HNX Q;  2E2I H;  4DR7 Q;  1N32 L;  1VQ7 A;  4L5R C;  1NMG A;  3FP9 A;  1WYD A;  5GAD C;  2Z6K A;  1Q8K A;  4ALP A;  2KBN A;  3J80 i;  3AFP A;  1I94 Q;  5LMU L;  3CPF A;  2WP8 J;  3LGJ A;  4HJ7 A;  1VCI A;  1D8L A;  4DKA C;  2Y0S E;  4A3E G;  2AWO A;  3UDI A;  1LTL A;  2JQO A;  2B3G A;  3S14 H;  1XTD A;  3EN2 A;  2K50 A;  4YCV A;  1X9N A;  5C3E G;  1E7Z A;  2ZM6 Q;  1VQF A;  2CWA A;  1Q81 C;  1N33 Q;  3MXN B;  4IPG A;  1TWH H;  4YCW A;  1YHB A;  2K5H A;  1KHI A;  3PO3 G;  4XTC S;  4X62 Q;  4X62 L;  2YV5 A;  3NBH B;  4PZ6 A;  5GAE C;  3ER0 A;  3TEH B;  3DM3 A;  1L1O A;  2F52 A;  4A3K H;  1N36 Q;  1HH2 P;  4P73 A;  4JV5 Q;  3L0O A;  1NE3 A;  2Q2U A;  3HOW H;  4KHP Q;  2YTY A;  2FXQ A;  4KHZ A;  1XNR Q;  4KHP L;  4A4I A;  1PH6 A;  1Q1E A;  4R4T A;  4A3I H;  5C4X H;  3RN5 A;  4GLX A;  1GD7 A;  4AQY L;  4X64 L;  3NEN A;  3GTM H;  2NVX H;  2KCM A;  4HJ8 A;  2OTJ A;  1U5K A;  2KHI A;  2RF4 A;  2Y0S G;  3U4V A;  1CSP A;  1HNZ Q;  4JI6 L;  1IBM L;  1EQR A;  4BXX H;  3J81 i;  4MZ9 A;  1OXV A;  2K4K A;  1KQS A;  4AYB G;  2VUM H;  4JC0 A;  2WB1 G;  4GNX C;  3I7F A;  4JYA Q;  4B3R L;  1A0I A;  2NVQ H;  1QVF A;  2MFI A;  1Z9F A;  4RG1 A;  1SFO H;  2WAQ E;  4A75 A;  1WI5 A;  5M3F H;  5J3B A;  4BA1 I;  3CC4 A;  1VQE A;  4BBS G;  4JI1 Q;  1IBL L;  3T1H L;  4DUY L;  4EX5 A;  4A3F G;  4JI4 Q;  2PQA B;  3EBE A;  2UUA Q;  2UUA L;  1HZB A;  2QGQ A;  4IJL A;  2OCE A;  4TQU S;  4X64 Q;  4JOI C;  2NZO A;  4GN5 A;  3RLO A;  4DV1 Q;  3J81 j;  1HR0 W;  3M4P A;  2MO0 A;  4X65 L;  4NXN Q;  5JJL A;  1NY4 A;  2JK8 A;  5M3F G;  2Q2H A;  2NZH A;  4R4I A;  2IX1 A;  2KCT A;  2K14 A;  2VS1 A;  3NEM A;  4XIG S;  5FLM G;  4JI8 Q;  3DLL A;  2N78 A;  4JI8 L;  4B3S L;  2YYZ A;  1VQM A;  2I5M X;  4HJ5 A;  3AFQ A;  1JB7 A;  4A3E H;  1YVC A;  4BXX G;  3W5O A;  4GKK Q;  2MO1 A;  1L1O B;  3CC2 A;  2IHF A;  1HZA A;  2PMZ E;  2F4V Q;  3U50 C;  2H5X A;  4JI1 L;  2EIF A;  1VQB A;  3KF6 A;  4DUY Q;  3A74 A;  4HIK A;  3OYY A;  4JG2 A;  4B3M L;  4LF8 Q;  4K0K L;  5FLX c;  1K8A C;  1EUJ A;  3D0F A;  1VQ4 A;  4A3B G;  5C44 H;  3HOV H;  1MJE A;  3ULJ A;  1WOC A;  4DUZ L;  1UE5 A;  4DV0 L;  4H02 A;  4DV1 L;  2ZTC A;  3ERS X;  4DAY B;  3NEL A;  1EOV A;  4R4Q A;  2QA4 A;  1I5F A;  4DV5 Q;  1OTC A;  4JI0 Q;  4OO1 G;  1L0W A;  5GAH C;  1YJ9 A;  3S2D H;  2YTX A;  3PO3 H;  2I5H A;  1TWC H;  4QY7 A;  1PH2 A;  2R93 G;  1KIX A;  3I4M H;  2N49 A;  3RN2 A;  1PFS A;  5IP7 G;  3HOY H;  3M9B A;  2VQF Q;  1OXT A;  5IYB G;  1MIU A;  5M5W H;  4A3D H;  2R92 H;  3PUW A;  5ELN A;  4JI5 L;  1IL2 A;  4DR4 L;  2UXB Q;  4OX9 Q;  4YY3 L;  3KFU A;  1Y1V G;  4LF7 Q;  2RHQ B;  4L5T A;  1K3R A;  3KJO A;  3J80 c;  5IWA Q;  4OWT B;  1JJC B;  4IPD A;  2VZA A;  1FGU A;  3KF6 B;  3CC7 A;  4ME3 A;  1XMQ L;  3K81 C;  1BBW A;  3K7A H;  4GOP B;  3FKI H;  4LF4 Q;  3CCL A;  3CCM A;  2K5N A;  4DV2 L;  2ZJP A;  4DV2 Q;  4OO1 I;  4OXP A;  1TWF H;  2RHS B;  2HIV A;  1HNW Q;  1PH7 A;  2GVA A;  2EQS A;  1GKH A;  4JI0 L;  2PI2 A;  4A3J H;  1VQL A;  1TWG H;  2JEB I;  1X3E A;  2C35 B;  5FJ8 G;  1Y14 B;  3F8T A;  4O2D A;  1BBU A;  3RZO H;  4A3B H;  4WJ3 M;  3CCS A;  4AQY Q;  3JAM c;  1X56 A;  1KAW A;  3CXC A;  2I5L X;  2JA6 G;  1EFW A;  1K9M C;  3J81 c;  1V9P A;  4JI7 L;  1KRT A;  2VW9 A;  1K8G A;  4L5Q A;  1IBK L;  4A93 G;  2K75 A;  3CCR A;  3GTG H;  1X65 A;  1SE8 A;  2JE6 I;  2HT1 A;  4JBK A;  1X54 A;  3FHW A;  1B70 B;  4OWX B;  4C3H H;  3H15 A;  1A62 A;  1KL9 A;  1Q46 A;  2CFM A;  2UU9 L;  4BY1 H;  3CD6 A;  4JYA L;  4B3R Q;  1JJG A;  1UE7 A;  5IYC G;  2GVB A;  2JA5 G;  2EXD A;  1SRU A;  3ULL A;  4R4C A;  2NN6 I;  4A3C H;  5IT9 c;  3ZJY C;  3S1R H;  2BH8 A;  1XNR L;  2UXC Q;  3A0J A;  4DR6 Q;  3E9H A;  5IP9 G;  2AWN A;  4LUZ A;  3HKZ G;  3OTO L;  3GTO H;  3T1Y L;  4X66 L;  1XNQ L;  3PF5 A;  3HOZ G;  3CCE A;  4HIM A;  1EYG A;  1E1T A;  2XGT A;  4A3F H;  1XMO Q;  1Q86 C;  2XTI A;  1I94 L;  2BA1 A;  3HFZ B;  4DR2 L;  3PGZ A;  1H95 A;  1P8L A;  4C2M H;  3J7A 5;  3CCJ A;  3AEV A;  3B6Y A;  4J15 A;  3S1Q H;  4KI0 A;  4C3J H;  3S1N H;  2ATW A;  1TWA H;  1HR0 L;  3D31 A;  2YU9 H;  3I2Z A;  1EQQ A;  5IY0 A;  2Z6K C;  2WAQ G;  3G48 A;  3BZC A;  1CKN A;  2NN6 G;  1VQC A;  4DV7 Q;  1E24 A;  4GKJ L;  1LM0 A;  3S24 A;  3PUV A;  3RZD H;  4HJA A;  4IFD G;  4DR6 L;  1LUZ A;  1I50 H;  1QVG A;  3PO2 G;  4Y52 H;  3M7N A;  4QL5 A;  1V1Q A;  3A5U A;  5E7N A;  4BBR H;  3G4S A;  4A3I G;  2HIX A;  1KC8 C;  2UUB L;  2JJQ A;  2K5V A;  2NVT H;  2N8N A;  3S2H H;  3S17 H;  5LMU Q;  5GQO A;  3G6E A;  3CCU A;  1XJV A;  1OXU A;  1VQH A;  2VL6 A;  3CQZ H;  1G6P A;  1Y1V H;  5M3M G;  4IFD I;  4IFD J;  1X55 A;  1FVI A;  3I56 A;  2PI2 E;  2Q2I A;  4NB3 A;  4BY7 H;  3K0X A;  4AIM A;  2JA7 H;  4GS3 A;  1UEB A;  4A3D G;  3H0G H;  3M4Q A;  4HJ9 A;  4JI6 Q;  5LMN L;  3G71 A;  3HOX G;  1VS0 A;  3GTQ H;  3W1B A;  3CCQ A;  2R93 H;  2KEN A;  2ES2 A;  1DGS A;  2N3S A;  2OQ0 A;  3KF8 B;  3CF5 A;  2AHO B;  1PH4 A;  1MJC A;  4Y7N H;  4OWW B;  4DV6 L;  4JBM A;  1AH9 A;  4B3T Q;  2UUC L;  5IP9 H;  1SRO A;  4LF7 L;  1TXY A;  5ELO A;  2I0Q A;  4A3G H;  3KJP A;  2LSS A;  4A3C G;  3HOV G;  2RCN A;  5FJ8 H;  4DR3 Q;  2JA5 H;  2OTL A;  1CKO A;  2GN5 A;  1PYB A;  4O0A A;  4A3J G;  2L15 A;  2ASB A;  2R7Z G;  3K8A A;  1MKH A;  4GKK L;  2PNH A;  2CCZ A;  4A76 A;  3PO2 H;  3TRE A;  1EIF A;  5IYD G;  4LNQ A;  2UUB Q;  1HNW L;  1NTG A;  1KD1 C;  3MEF A;  1X3G A;  4LF6 L;  4LF6 Q;  2UXD Q;  2KHJ A;  1I3Q H;  3F1Z A;  4YWL A;  1GO3 E;  3WWV A;  3I4N H;  4DPG A;  4B3S Q;  4QJF A;  1IXR A;  4DNI A;  1YIJ A;  1IBM Q;  3JC6 6;  1Z47 A;  3BJU A;  2VQF L;  4LF5 Q;  1CKN B;  1K73 C;  2OQK A;  4DK6 C;  3PIP A;  1VQJ A;  4OON A;  5JEA J;  1IZ6 A;  5FLM H;  4A3M G;  4JI7 Q;  1VQP A;  4PMW A;  5C0X G;  2Z0S A;  4GLA C;  2UUC Q;  1HZC A;  2IHE A;  3I4M G;  3K7U C;  3OW2 A;  2D0P A;  1XMQ Q;  3PV0 A;  3JAM i;  4B3M Q;  1M90 C;  4LF8 L;  2AKW B;  3H3V I;  2ZJQ A;  4JV5 L;  2DGY A;  1R9T H;  2MNA A;  4P74 A;  2ALY B;  1SN8 A;  4DR3 L;  1G29 1;  1PH3 A;  1C7Y A;  3U4Z A;  1HNX L;  2JA8 G;  3PF4 A;  4JBJ A;  4HID A;  4DV0 Q;  1YJW A;  4GOP C;  1GVP A;  2Q2T A;  2UXD L;  3OTO Q;  4FDB A;  3AQQ A;  3T1Y Q;  5IYC H;  1VQ9 A;  5AJ3 L;  1LYL A;  5AJ3 Q;  3CCV A;  4A3M H;  3PUZ A;  2R92 G;  4BY1 G;  1ASZ A;  5IYB H;  3TRZ A;  1L1O C;  3I55 A;  3GTK H;  4GN3 B;  1UE1 A;  3GO5 A;  2A1A A;  4NPS A;  3L7Z C;  3VDY A;  1VQK A;  2LXK A;  5C0X I;  5C0X J;  1Y1W H;  5M5Y H;  1U0L A;  1CUK A;  1G51 A;  5GRO A;  4UY8 C;  4P71 A;  5JJI A;  1UE6 A;  1NBW A;  5HGQ A;  3CW2 C;  1HR0 Q;  1XPR A;  4LW1 A;  4LF9 Q;  4LF9 L;  3CAM A;  1Q7Y C;  1WFQ A;  1RIP A;  4DV3 Q;  1PVO A;  2HQL A;  1VQI A;  1PH5 A;  1RL2 A;  4LFA Q;  1SR3 A;  1C9O A;  1PV4 A;  5C44 G;  5C4X G;  3W1G A;  4QIW E;  5DLQ E;  4GNX B;  2ID0 A;  4YHH L;  3PCO B;  1N36 L;  4LFC L;  1EIY B;  3I4O A;  3HOU G;  4A3G G;  2F3I A;  4DUZ Q;  1QUQ B;  1IBL Q;  1CSQ A;  5C4J H;  2IT1 A;  4MNO A;  3Q8D A;  4EQ5 A;  1YJN A;  3FKI G;  3HKZ E;  3A5Z B;  3H3V H;  1FL0 A;  1T9H A;  1HZ9 A;  5K36 G;  1PYS B;  4BBS H;  4UP7 A;  5JJK A;  3TQY A;  1VQG A;  1UWV A;  1QVC A;  1VQ8 A;  3CP0 A;  4JBW A;  2E2J H;  4LFB L;  4A3L H;  2E5L L;  4BY7 G;  1HNZ L;  4LUV A;  1AE2 A;  3CMA A;  1XPO A;  3KDF A;  4DV3 L;  2B29 A;  3S16 H;  3PIO A;  5JEA G;  2NVY H;  1JT8 A;  1VQA A;  3GTJ H;  2WB1 E;  1NJI C;  2UU9 Q;  4LFA L;  4AH6 A;  4IOA A;  2A8V A;  4JI2 Q;  5BR8 Q;  4GOP A;  4KLK A;  2JEA I;  1Q12 A;  2DUD A;  2OWO A;  5IYD H;  4PZ7 A;  4DAM A;  1QZH A;  2QEX A;  1SMX A;  4GN4 B;  1YHQ A;  2UXC L;  4K0K Q;  3HOU H;  1N9W A;  1OXX K;  4QGU A;  3TS0 A;  1S72 A;  4LWC A;  4IOC A;  1VQN A;  3M4O H;  3EIV A;  1X6O A;  3UDX A;  2ZTE A;  1B8A A;  5M5X H;  4UP9 A;  4POG A;  1XMO L;  2VUM G;  1PA6 A;  4IPC A;  1S40 A;  2IX0 A;  2R7D A;  3SGI A;  4JI3 L;  4NXN L;  4LFB Q;  1J5E Q;  2E5L Q;  1J5E L;  3K80 C;  3F2B A;  3F2C A;  1K83 H;  4LUO A;  1A63 A;  1B7Y B;  2ZM6 L;  1Y1W G;  3TS2 A;  4WJ4 A;  3KYH C;  4APV A;  3ULP A;  3HKS A;  1VQO A;  1PH8 A;  4GLV B;  3GDE A;  5IE8 A;  2R7F A;  4PG3 A;  1P16 A;  2JA9 A;  5C3E H;  1YIT A;  2VNU D;  3HOZ H;  2E2H H;  1J6Q A;  4MTN A;  1D7Q A;  1NMF A;  4JCV E;  4A3L G;  1QUQ A;  4JOI A;  5M3M H;  1V43 A;  2IY5 B;  3BZK A;  5BR8 L;  2HHH L;  4JI2 L;  3HOW G;  1I6H H;  2BH2 A;  4NXM L;  1N8R C;  4NXM Q;  1KXL A;  4R4O A;  4UP8 A;  2JA8 H;  2VQE Q;  2A19 A;  2VQE L;  4JI4 L;  4LF4 L;  1E22 A;  1HJP A;  4POF A;  5H1S E;  1YNX A;  3STB C;  1JMC A;  3PSI A;  3GD7 A;  2CWP A;  3CPW A; 
#chains in the Genus database with same CATH topology
 5I2X A;  1K3B C;  4A3D B;  3HOU B;  5LMN W;  5FO7 B;  4ZKB B;  2MD9 A;  4L8J A;  2AUK A;  1FD7 D;  3NPP A;  1M4V A;  1EZ6 A;  2BA0 A;  1SLJ A;  1NCV A;  1IL8 A;  2K0Y A;  3E5S A;  1LAC A;  2RDF A;  1L2F A;  4CDF C;  4YY3 Q;  4TRD A;  1WCM H;  4JI5 Q;  1CKM A;  2F4V L;  2EHS A;  4YWK A;  4MRT C;  4AYB E;  1OXS C;  2EXZ A;  5COR A;  1GUW A;  2IWH A;  3T1H Q;  1ROD A;  1BR9 A;  3UE0 A;  1QZG A;  5EJW A;  4GZY C;  3I4N B;  1M90 Q;  1BOS A;  1YEZ A;  2HCC A;  2K5Q A;  3KLW A;  1T5E A;  4Y7N B;  4DA2 A;  3AMU A;  3JAM L;  3FPP A;  4DR1 L;  1NSN S;  2M00 A;  1Q82 C;  3M4Y A;  3GTP H;  1GM5 A;  2E74 C;  2YTV A;  2K52 A;  3STB D;  4A3E B;  2R6G A;  2LKV A;  4H0L C;  2E1M A;  3H0G B;  2ZJR A;  3BU2 A;  2CKZ B;  4DR5 L;  1WTH A;  3J7Z C;  1Q90 A;  1QJO A;  1PDQ A;  2PQA A;  4IO9 A;  2KEE A;  3J81 E;  3S15 H;  4ZLT F;  1C0A A;  2KOQ A;  1WTP A;  4ZCK A;  4GKJ Q;  1S3O A;  1X3F A;  2P5Z X;  2NB0 A;  4U0F A;  4DV4 L;  1A8V A;  1YZ6 A;  4DK3 C;  1HNX Q;  3GTQ B;  1VQ7 A;  2N6Y A;  3LX0 A;  1GOZ A;  4HKG A;  1IKM A;  4PH0 A;  1Q8K A;  4A3F B;  1HPC A;  1O7L A;  4ALP A;  3HOY B;  3AFP A;  2NWG A;  3HS0 C;  3LGJ A;  1VCI A;  1D8L A;  4HJ7 A;  2Z44 A;  5C3W A;  3S15 B;  3S14 H;  2B3G A;  1XTD A;  3EN2 A;  2WPT A;  1RTN A;  4RCO A;  4YCV A;  1VQM P;  4FF2 A;  5CR3 A;  5C3E G;  2ZM6 Q;  3GTJ B;  4IPG A;  1TWH H;  1PZJ D;  1D1D A;  1KHI A;  4XTC S;  4X62 Q;  1GJX A;  2YV5 A;  4PZ6 A;  4A3K H;  1G91 A;  3I8Z A;  4P73 A;  3L0O A;  2GZJ A;  1TU2 B;  2K32 A;  2YTY A;  3SXH A;  2LML A;  4KHZ A;  4KHP L;  1Q1E A;  2TSS A;  4R4T A;  2SEB D;  1HUN A;  1X3Q A;  2JN4 A;  5CV8 A;  4X64 L;  1ILQ A;  3V05 A;  3GTM H;  3G1G A;  2GZI A;  4KHV A;  4DK0 A;  4J8Q A;  1S5E D;  4Z9C B;  2EVB A;  3KLR A;  1EYA A;  2ZXO A;  1VQK P;  2AVA A;  4OEM B;  2Z46 A;  1CSP A;  1EQR A;  4C1N I;  3G6E P;  5HGT A;  2Q8T A;  1KQS A;  3DS5 A;  1F9P A;  4JYA Q;  1YJW P;  4DNR B;  2NBF A;  5IGD A;  1QNU A;  2F1M A;  1HQB A;  2CH4 W;  4CA3 A;  2FVA A;  1SE3 A;  4EX5 A;  4DUY L;  4JI4 Q;  3SE0 A;  2PQA B;  1FNV A;  2NYZ D;  2RQX A;  3EBE A;  5KRU A;  3MXN A;  4A3K G;  1STE A;  1JQY D;  1F9R A;  1HR0 W;  3CKI B;  5DM6 3;  4X65 L;  1STB A;  3G28 A;  1DM0 B;  4BBR B;  2IX1 A;  1F9Q A;  2FHS C;  3NWT A;  2K14 A;  3NEM A;  2K1B A;  3I56 P;  5FLM G;  4JI8 Q;  4CJ2 C;  2D5D A;  2YYZ A;  3GTM B;  3KLS A;  4A3E H;  3D3R A;  1M6E X;  3W5O A;  4BXX G;  1KTK A;  2WAC A;  3N52 A;  1KLP A;  3CC2 A;  1MGS A;  1XWE A;  4KY7 A;  2R93 B;  1DZ1 A;  3I3C A;  3S1Q B;  4JI1 L;  2EIF A;  4QMG A;  4DUY Q;  4C3J B;  5I4D A;  4LF8 Q;  4PH1 A;  5KP8 B;  1AUM A;  1EUJ A;  3HOV H;  3I70 A;  4DUZ L;  1HTL D;  1UE5 A;  2KOO A;  2DNC A;  3K57 A;  3ERS X;  1OTC A;  4JI0 Q;  2YTX A;  3PO3 H;  5C4H A;  1IMP A;  3I4M H;  1PFS A;  5BN4 A;  3UI2 A;  5IP7 G;  3HOY H;  1A3V A;  5M5W H;  4C3H B;  2EIA A;  2JYL A;  5ELN A;  4OX9 Q;  1BXI A;  1DOK A;  1Y1V G;  3C1F A;  2RHQ B;  2L11 A;  2L5T A;  5IWA Q;  3J80 c;  1JJC B;  1DD2 A;  2CW0 C;  4IUR A;  4S3S A;  3MFG A;  2ZJP A;  2XRQ D;  2CQ8 A;  1PXU A;  1PH7 A;  2GYK A;  4JI0 L;  3I4L A;  4A3J H;  2K05 A;  2JEB I;  3RZO H;  1Y14 B;  4O2D A;  2A68 C;  5JOB A;  4EVO A;  4WJ3 M;  3CCS A;  1S4Z A;  3CXC A;  4QF4 A;  2EY6 A;  1DYQ A;  4ME5 A;  3VR6 A;  2CQA A;  5EQ0 A;  2F0P A;  1PLF A;  1X65 A;  4DGZ A;  1SE8 A;  2HT1 A;  2E76 C;  5A2Q L;  1Y1W B;  4C3H H;  2XIW A;  1KL9 A;  4B9X A;  1Q46 A;  2CFM A;  4KV6 A;  2FAC A;  1I50 B;  1JOO A;  1AN8 A;  3X3M A;  3GKL C;  2EXD A;  2HDL A;  3ULL A;  4A3C H;  4K5V A;  2EYJ A;  3TN2 A;  1KLG D;  4OIK A;  2JXM B;  3A0J A;  4PMB A;  3HKZ G;  3Q22 A;  3GTO H;  2KGA A;  4X66 L;  3CCE A;  2SDF A;  1XMO Q;  1B3A A;  3TP5 A;  1Q3L A;  4J15 A;  2WB1 B;  4KI0 A;  1Z7T A;  1HR0 L;  3D6W A;  3CMA P;  1PFM A;  3D31 A;  5T1G A;  2FMC A;  3GV3 A;  3VR4 A;  3GTO B;  2RSO A;  3CCV P;  3BZC A;  2BCO A;  4TKO B;  3HRZ C;  4H13 C;  3RZD H;  4HJA A;  1I50 H;  3HOZ B;  4Y52 H;  4DG9 A;  1R4P B;  3G4S A;  2K5V A;  3S17 H;  3R93 A;  2E2D C;  5LMU Q;  3E2D A;  1ZEQ X;  1HTP A;  1VQH A;  1G6P A;  4IFD I;  1X55 A;  3NBI A;  1FVI A;  5IOC A;  1TS2 A;  5C3X A;  4AIM A;  2JA7 H;  2LS0 1;  3RZD B;  2WII B;  5LMN L;  3G71 A;  4ZKC B;  1SNM A;  3R3O A;  3CCQ A;  2KEN A;  5L37 A;  4L6T B;  1EWH A;  3KF8 B;  3CF5 A;  2VUM B;  2AHO B;  1PH4 A;  3Q20 A;  1L0Y B;  3I90 A;  5J39 A;  5M5W B;  4OWW B;  2NO8 A;  4DV6 L;  1U4R A;  1AH9 A;  3AU7 A;  1ML0 D;  4B3T Q;  1TXY A;  3HEJ A;  2L9F A;  3KJP A;  5C6A A;  3DEP A;  4DR3 Q;  2ASB A;  4A3J G;  3DWA A;  4PWV B;  1Y8P B;  2KGC A;  1MKH A;  2LIU A;  1FYC A;  2UUB Q;  3PIO 3;  1X3G A;  1MBY A;  3F1Z A;  1GO3 E;  1K9M Q;  1PTO F;  3TP7 A;  4B3S Q;  1F2Z A;  3BJU A;  4XYQ A;  2VQF L;  3PIP A;  4OON A;  5JEA J;  4JI7 Q;  1EYD A;  4PMW A;  2NVQ B;  2Z0S A;  5ELD A;  2PZT A;  3M1M A;  3I4M G;  3DS3 A;  1HA6 A;  2DN8 A;  4ULL A;  1H9R A;  5EPK A;  2EYP A;  4UDU C;  3PV0 A;  4LF8 L;  2PEJ A;  1EIA A;  3H94 A;  1MHW C;  1R9T H;  2MNA A;  4P74 A;  1KDB A;  4DR3 L;  1C7Y A;  2JA8 G;  3PF4 A;  2MJ8 A;  1SEB D;  4JBJ A;  4HID A;  5EPJ A;  3TSS A;  4IUQ A;  4A3M H;  1CA5 A;  3CCV A;  1FGB D;  2R92 G;  4BY1 G;  1WTV A;  1ASZ A;  4C3H G;  4ZK9 B;  2B2V C;  1L1O C;  4N8F A;  3I55 A;  3E3X A;  2LXK A;  1RTO A;  4FF4 A;  1U0L A;  1EOQ A;  4COC A;  4P71 A;  2E2H B;  1HR0 Q;  3SK8 A;  4LF9 Q;  3CAM A;  1PVO A;  2BE5 C;  1KQS O;  1VQI A;  1PH5 A;  1RL2 A;  3IKJ A;  1LTS D;  1SR3 A;  1K8A Q;  2PO4 A;  5C44 G;  5C4X G;  4FO2 A;  5BN3 A;  4FXD A;  4CHT B;  1K8O A;  2NVX B;  1IYV A;  4XFY A;  1QUQ B;  1JE4 A;  1PRT F;  2Z6B A;  3NP8 A;  5JPN C;  3BVG A;  1PYW D;  5C4J H;  3BYT B;  4EQ5 A;  1YJN A;  1BDO A;  3RG2 A;  3SVM A;  1JWU D;  1PYS B;  3DS4 A;  3FKI B;  1QVC A;  4V0B A;  2A69 D;  1WTW A;  1J8I A;  3B5I A;  1CM9 A;  4DXG A;  1A15 A;  1ILP A;  3NSW A;  4DV3 L;  3LWU A;  2NVY H;  4NMZ A;  3JAM E;  1DXM A;  1JT8 A;  2A6H D;  1VQA A;  3GTJ H;  2WB1 E;  2K28 A;  1NJI C;  2A6H C;  4IOA A;  1SAP A;  1S5B D;  1ONL A;  2KUM A;  4KLK A;  1Q12 A;  2CWO A;  1LAB A;  2KOD A;  4DAM A;  2QEX A;  1QZH A;  4GN4 B;  4CJ1 B;  4K0K Q;  1PTO H;  1HY8 A;  1TY0 A;  3G26 A;  3EIV A;  5M5X B;  1X6O A;  1B8A A;  3H6M A;  3LMO A;  3MVV A;  3A8I E;  2K7V A;  1PA6 A;  3J7A V;  1JJ2 O;  2IX0 A;  5EKL A;  1J5E Q;  3CCL P;  3F2C A;  4LUO A;  1A63 A;  1B7Y B;  4K14 A;  2ZM6 L;  1SYC A;  4WJ4 A;  4HN7 A;  2VNU D;  1P16 A;  4IN3 A;  1YIT A;  3H0D A;  1D7Q A;  3C2P A;  1GXG A;  5LL6 S;  1V43 A;  5JPM C;  5BR8 L;  4JI2 L;  2GDY A;  5EGT A;  1X3O A;  1LTA D;  4NP5 A;  2XRS D;  3CQZ B;  4KTA A;  2A19 A;  4CKE A;  2VQE L;  3STB C;  2DY8 A;  4KY6 A;  3CPW A;  1M74 A;  4X6A H;  4LJZ C;  1GUG A;  1XYI A;  3E0E A;  2D62 A;  2R7Z B;  1Q1B A;  1W3S A;  4X3K A;  1GUN A;  4MN3 A;  5EKI A;  1Z6H A;  1ZMB A;  4LF5 L;  2OAR A;  3GTL B;  3DEO A;  3CME A;  1EQT A;  1FJG Q;  5LHY 1;  4QQB X;  3RLN A;  2Q8R E;  4RMF A;  3KOJ A;  2Q8I B;  2KOS A;  5CV9 A;  5IIF A;  5DEH A;  5IGF A;  1XPU A;  2E2I B;  1O7I A;  3HOX B;  2QCP X;  4OIJ A;  2FVE A;  1JCK B;  3PO3 B;  3M3Y H;  3QIA A;  2R7Z H;  2B2V A;  4U68 A;  4K8J A;  5CBE E;  1N32 Q;  1YBY A;  4HSP A;  4PZ8 A;  5K5P A;  2L22 A;  3PIP 3;  4XQN A;  3HGB A;  1N34 L;  4PMC A;  5I9P A;  1TWH B;  1U4M A;  4U0C A;  4DV5 L;  3TME A;  1YI2 A;  1RHP A;  2F0W A;  3ICE A;  1XNQ Q;  4M0I A;  1FNU A;  3M85 A;  3HOV B;  1E0B A;  5C4J B;  3T13 A;  5IGC A;  1ET6 A;  3HOX H;  3RNU A;  3H0G G;  2E8G A;  2JA7 G;  1QOH A;  4P72 A;  1BO0 A;  1E1O A;  2VLN A;  2PW5 A;  1FJG L;  1M6N A;  5EAY A;  3GTL H;  1JWM D;  2CQO A;  3PUX A;  4ZQ3 A;  1J9O A;  2K5X A;  3I4N G;  4R1J A;  2QEJ C;  2XN9 C;  4YHH Q;  4YCU A;  3T56 B;  1JJ2 A;  2K94 A;  2L1B A;  5JJZ A;  2E2I H;  1LTR D;  1TWC B;  1D5Z C;  4IFD H;  1UAP A;  2SNS A;  2Z6K A;  4G7Z C;  3D4D A;  2BOS A;  3J80 i;  5M5Y B;  1I94 Q;  1IW7 C;  5ISR A;  4DKA C;  2L0C A;  4QCL A;  1W2B O;  1YNN D;  2EZV A;  2O2L D;  1K8M A;  1SNP A;  1IKL A;  1QNK A;  1E7Z A;  1BCP B;  1VQF A;  2CWA A;  1Q81 C;  1N33 Q;  3MXN B;  1X32 A;  4CKC A;  2Y0S B;  3PO3 G;  4XDX A;  4KD3 A;  4X62 L;  5GAE C;  5IT9 E;  5KND A;  4F37 A;  3DM3 A;  2V4D A;  3GQB A;  2RSN A;  2O5I C;  1NE3 A;  1WD1 A;  4ZAI A;  2Q2U A;  3HOW H;  4KHP Q;  2WKD A;  1PH6 A;  4A3I H;  3RN5 A;  1NQ4 A;  1ZNV A;  1STH A;  5E3F A;  4RHS A;  3URY A;  4AQY L;  4XT3 B;  3PO2 B;  1ESF A;  2OTJ A;  1YIJ P;  2KHI A;  4RGN A;  4JI6 L;  1HNZ Q;  2P9X A;  3J81 i;  1MSH A;  2L4B A;  3MC0 B;  2K4K A;  4MZ9 A;  2WB1 G;  4GNX C;  4B3R L;  3A7A B;  2GDX A;  1Z9F A;  1CHP D;  2QIL A;  1WI5 A;  5M3F H;  2EYL A;  5CZD B;  1W6J A;  1PTO D;  2GZE A;  5J3B A;  2A73 B;  3QOJ A;  3CC4 A;  3GTK B;  2MF4 A;  4BBS G;  4JI1 Q;  5KEE A;  2SOB A;  1A8O A;  3G6J B;  2OCE A;  3CCM P;  4JOI C;  4B08 A;  5KP6 B;  3VYR A;  4NXN Q;  1KAA A;  2JK8 A;  1YNJ D;  4R4I A;  5C0X H;  1OO9 B;  1I6H B;  2K33 A;  5IT9 L;  4RFB A;  2JU2 A;  4JI8 L;  3DLL A;  3KK7 A;  3VYU A;  1VQM A;  2I5M X;  3R2I A;  1A2T A;  1JB7 A;  3G7L A;  2MGS A;  1CA6 A;  5KIX A;  4HCE A;  1EY9 A;  1ZYR D;  1HZA A;  2PMZ E;  5CV5 A;  4CGY B;  4Q5V A;  1WTR A;  2KHS A;  4OO1 H;  1EWC A;  4ID6 A;  5F2O A;  4EQO A;  1LTG D;  4K2L A;  1EZ8 A;  1SYD A;  4FNF A;  1VQ4 P;  1TS5 A;  4JG2 A;  3DHQ A;  1F9S A;  4K0K L;  4A3B G;  1K8A C;  3D0F A;  1EY5 A;  2K2Q A;  4XRO A;  2AQ3 B;  3NEL A;  1ENF A;  2PNG A;  2FFK B;  2PCF B;  3TDQ A;  1KAB A;  1L0W A;  5GAH C;  1YJ9 A;  4K5W A;  2I5H A;  4QY7 A;  4XQQ A;  5HGO A;  4QB4 A;  1KIX A;  4A93 B;  1EQV A;  2N49 A;  5C5M A;  1H9S A;  1F80 D;  5HGM A;  2VQF Q;  3D6C A;  1D1I A;  1LT4 D;  3PUW A;  3MTS A;  1IL2 A;  2R92 H;  4DR4 L;  2UXB Q;  4FP5 D;  3IAY A;  4ILW A;  3KJO A;  1K3R A;  4OWT B;  1QRJ A;  1K30 A;  2JA5 B;  3S1R B;  3KF6 B;  2JU1 A;  3K81 C;  3K7A H;  4GOP B;  4O42 A;  1QVG O;  2EE1 A;  3NTK A;  3CCL A;  4DV2 Q;  4OO1 I;  1TWF H;  3I72 A;  2EQS A;  1GKH A;  4FVM A;  3S17 B;  5C3E B;  2PI2 A;  3FDT A;  1VQL A;  3RZO B;  1TWG H;  1PZI D;  1BBU A;  4A3B H;  3ND9 A;  3T51 B;  4A3I B;  3JAM c;  3S1N B;  1X56 A;  2JA7 B;  1ICW A;  5I6W A;  1TQO A;  3P20 A;  3QR8 A;  1K9M C;  2O5J C;  1DV5 A;  1BCP F;  1KRT A;  4L5Q A;  2VW9 A;  5CMD A;  3CCR A;  2X6L A;  2FQ0 A;  2Z45 A;  1CHQ D;  4DK1 A;  1MI2 A;  4CJ0 B;  1EY7 A;  2RVL A;  4OWX B;  1Y8N B;  3Q24 A;  2UU9 L;  3CD6 A;  3P75 A;  4B3R Q;  1H9K A;  1T5X D;  5AFW A;  5HUR A;  4WFN 3;  2JSO A;  4R4C A;  2M9V A;  3K5O A;  1I6V C;  5IT9 c;  3S1R H;  1XNR L;  3E9H A;  4DAV A;  2LL8 A;  3VR3 A;  5F2K A;  3PF5 A;  3TBI B;  4DU9 A;  2AUJ D;  1Q86 C;  1I4H A;  2XTI A;  1I94 L;  2BA1 A;  4U67 3;  1I4R A;  2A6E C;  3AEV A;  5DCK A;  2NTS A;  1JWS D;  3B6Y A;  4RKB A;  3S1N H;  3A8J E;  1PTO B;  1CQV A;  1SNC A;  3A54 A;  2KEC A;  1CKN A;  1VQC A;  4GKJ L;  3S24 A;  2F0U A;  1M1K Q;  2WKC A;  2QEX P;  3R8B A;  3M7N A;  2K0X A;  2KOR A;  4IZ6 A;  5E7N A;  1AW7 A;  2JJQ A;  4N8X 1;  3G6E A;  4PQX A;  2IW3 A;  1EY0 A;  4IFD J;  3J7Y W;  1JC7 A;  4NB3 A;  4BY7 B;  2KGE A;  4XFX A;  3M7G A;  3M4Q A;  1PFB A;  3ONA B;  1E2Z A;  3WDN A;  1Q7Y Q;  2ENB A;  1VS0 A;  3GTQ H;  1AP0 A;  1EY6 A;  2ES2 A;  3EVQ A;  2EFJ A;  2IJ0 A;  1DGS A;  3V2T A;  2GDW A;  4Y7N H;  4QKO A;  2FAE A;  3BDO A;  4BPH A;  5EW5 E;  1SRO A;  3NXW A;  3FPU B;  5IP9 H;  3T53 B;  4LF7 L;  2XXM A;  3VYT A;  1LTB D;  2LSS A;  4A3C G;  4A3G H;  4ZRZ A;  3OSO A;  2KR5 A;  2JA5 H;  1CKO A;  2GN5 A;  1PYB A;  3CU7 A;  4JK1 C;  2YU9 B;  3S2D B;  2PNH A;  2CCZ A;  1F2Y A;  2PNR C;  1EIF A;  4LNQ A;  1GHK A;  2LY7 A;  1HNW L;  3DMU A;  3MEF A;  2G9D A;  3CC2 P;  3I91 A;  4MIU A;  4YWL A;  3I4N H;  1DON A;  1YIJ A;  1IBM Q;  5C4Z A;  2F0F A;  2OQK A;  4DK6 C;  1VQJ A;  2EOT A;  4A3M G;  4LAA A;  5FLM H;  3CPW O;  3K7U C;  3OW2 A;  1T8K A;  2M5R A;  5CYU A;  2D0P A;  1LT3 D;  2PYK A;  3VA5 A;  3NK9 A;  1H95 A;  1VF7 A;  2KA7 A;  4JV5 L;  2R3Z A;  2DGY A;  4GKK Q;  1W6K A;  2X6G A;  1G29 1;  1HFG A;  2PZW A;  2KCC A;  3SR1 A;  3S2H B;  3Q0A A;  2JA6 B;  1LYL A;  2DNE A;  1MZ8 A;  2FQ1 A;  1QCB D;  2ZXP A;  2MVV A;  2PMZ B;  2M2L A;  1UE1 A;  4G4K A;  2PQE A;  1PTO C;  1SNO A;  2A1A A;  3A7L A;  4NPS A;  1VQK A;  5GRO A;  4IUP A;  2CH4 A;  1UE6 A;  1NBW A;  4KJO A;  4UAI A;  3CW2 C;  1XX8 A;  2LFN A;  4LW1 A;  1VKU A;  1WFQ A;  2ROQ A;  4TSS A;  2HQL A;  3ZYY X;  1H9M A;  2Z9H A;  4RCN A;  4QIW E;  3I55 P;  2ID0 A;  1XXG A;  4ODG A;  1Y1V B;  4LFC L;  3QOL A;  1LT6 D;  1GUT A;  2IT1 A;  1B53 A;  1U4P A;  2ERH A;  3FRP B;  1PZK D;  4MNO A;  3HKZ E;  3RD4 A;  3H3V H;  1FL0 A;  3MXG A;  3VRL C;  4BBS H;  4UP7 A;  3TQY A;  2F3W A;  1SYF A;  1AE2 A;  2QW7 A;  3G29 A;  1DNY A;  1KNA A;  4IZ8 A;  1XPO A;  3KDF A;  5M3M B;  1S5F D;  4IAL A;  3CCE P;  2LKI A;  4NKL A;  4R9W A;  1GXD C;  1EIH A;  2A8V A;  4JI2 Q;  5BR8 Q;  1ZYR C;  4H44 C;  2O4X A;  2B8G A;  3CXC O;  1SMX A;  1S72 P;  2RCF A;  4PV1 C;  1YHQ A;  2UXC L;  1BNZ A;  3M4O H;  4IOC A;  1XMO L;  4R0M A;  3SGI A;  4JI3 L;  4LFB Q;  5DNF A;  2E5L Q;  1J5E L;  5BS2 A;  1E0H A;  3EJE A;  2EJG C;  5M3F B;  1CI3 M;  2XZ0 D;  2N5I A;  1Y1W G;  3TS2 A;  4APV A;  2F0K A;  3HKS A;  3KUP A;  1PH8 A;  4QNB A;  3GDE A;  2VLQ A;  1AYI A;  2JA9 A;  3ND8 A;  2TMP A;  4A3L G;  1QUQ A;  4JOI A;  3T4A C;  5M3M H;  2B2U C;  3NHH A;  4IUN A;  3BZK A;  2CGQ A;  1I6H H;  1KXL A;  2A74 C;  1UEA B;  3OW7 A;  1A6X A;  4JI4 L;  4GR2 A;  4OL7 A;  1HJP A;  4POF A;  1NAP A;  4RGO S;  1A2U A;  1C4Q A;  4JI3 Q;  1JR0 D;  2QDB A;  3K58 A;  1WCM G;  1VQ6 A;  3TP8 A;  2ZTD A;  2F0S A;  5HY6 A;  3I4M B;  3U58 A;  3BVM A;  4UPA A;  5C5L A;  2B63 H;  2JA6 H;  1B50 A;  2FHT A;  2VB3 X;  1KRS A;  2NUC A;  3OIQ A;  1SSO A;  3KBX A;  4RKL A;  1YHA A;  3AYH B;  1K73 Q;  1S5D D;  3X3N A;  2B39 A;  3EJI A;  2QF7 A;  3GV6 A;  1ASY A;  2NZ1 D;  3SK4 A;  2PEO A;  4RA8 A;  5LL6 X;  4HTH A;  1IYJ B;  4C2M B;  3OPO A;  3M3Y B;  3EJD A;  1UUP A;  1JOQ A;  2MY5 A;  4DR7 L;  2WV6 D;  2XVS A;  1HHV A;  5I9O A;  4C3I G;  4TVA B;  3K5M A;  3J7A F;  4DR1 Q;  2VY3 A;  2EYF A;  5IGE A;  3DWQ A;  4I7A A;  2MR7 A;  1PHJ A;  1VQ5 P;  1SYB A;  3A8K E;  2JB0 A;  2N55 A;  3PUY A;  1OR5 A;  2LF4 A;  5IP7 H;  2F0O A;  3HOY G;  2RA4 A;  2JO0 A;  1IBK Q;  4L5S A;  3KDF B;  4XQJ A;  1R4Q B;  3UDG A;  4HAE A;  2BUO A;  3UDF A;  1PH1 A;  4B3T L;  1N33 L;  2ONT A;  2X2B A;  2EY2 A;  5IWA L;  3RR5 A;  2LXJ A;  2XWB B;  3BZD B;  2D2C C;  4IPH A;  1QIL A;  4P75 A;  3V96 A;  4BBR G;  4RAU C;  2KG6 A;  3MXU A;  1H9S B;  2OTL P;  2EYO A;  5BS1 A;  1N34 Q;  4DV4 Q;  2MQH A;  3HG9 A;  1D6E C;  3E9I A;  4DR7 Q;  5KP7 B;  1BUV T;  3OW2 O;  3NBH A;  3G4S P;  1WYD A;  5GAD C;  2FMM A;  2A6E D;  2KBN A;  1B9N A;  1GUO A;  3CPF A;  2WP8 J;  3OWE B;  2XNA C;  2B2W A;  1BF4 A;  1VQ8 P;  4A3E G;  3UDI A;  2JQO A;  2WAQ B;  1X9N A;  4AYB B;  1Z6M A;  4YCW A;  1YHB A;  2K5H A;  4LMQ D;  1EL0 A;  1WTO A;  1L0H A;  1V1P B;  1VQ6 P;  2K04 A;  2Z4I A;  3CCJ P;  1L1O A;  2F52 A;  3HZX A;  4JV5 Q;  1HQR D;  4OEL B;  1XNR Q;  2FXQ A;  3EFX D;  2N6Z A;  4A4I A;  4KMU C;  2BE5 D;  2DJG C;  4GLX A;  1KDC A;  4JW0 A;  1G2T A;  1TT2 A;  2J0T D;  4HMI A;  1GD7 A;  2LOL A;  1SE2 A;  2CNR A;  1CQF A;  3C1E A;  3MHB A;  4RGT A;  2KCM A;  2EJM A;  2EY1 A;  5G3L F;  3ITP A;  4HJ8 A;  1UJZ A;  1VQO P;  4X3T A;  5CV6 A;  1VMC A;  4G7H C;  1OXV A;  4AYB G;  2VUM H;  4JC0 A;  4XYO A;  3I7F A;  1LTT D;  4RG1 A;  1L0X B;  3DS2 A;  3GZM A;  1K83 B;  3SHL A;  5EPL A;  1V1O A;  1IBL L;  4K5X A;  3T1H L;  4A3F G;  1LV9 A;  2VB2 X;  2UUA Q;  3J80 E;  3NQI A;  1HZB A;  2QGQ A;  4NW2 A;  3RLO A;  2NZO A;  4GN5 A;  4I7Z C;  4DV1 Q;  2MO0 A;  4F88 A;  1NY4 A;  3J81 L;  5M3F G;  2Q2H A;  2NZH A;  1BBX C;  4DAP A;  3TP6 A;  1RO2 A;  4XIG S;  4B3S L;  5ELB A;  3K59 A;  3K7A B;  4FF3 A;  5HV8 A;  1YVC A;  2MO1 A;  2AQ1 B;  1ICF B;  2EG5 A;  2IHF A;  2KOP A;  4L63 B;  1H9J A;  2F4V Q;  3U50 C;  5FLX E;  3KF6 A;  4HIK A;  4B3M L;  2AFD A;  1LTI D;  4XT1 B;  3DM1 A;  4CKB A;  2G5D A;  3K5N A;  7CEI A;  2HD3 A;  2BHV A;  2VLP A;  4KKS A;  4H02 A;  4DV1 L;  4DV5 Q;  1IMQ A;  3CME P;  1EOV A;  4OO1 G;  1X3P A;  4MTK A;  3S2D H;  2AQ2 B;  2R93 G;  1HXY D;  2PPB C;  3RN2 A;  3T16 A;  3M9B A;  5CC4 A;  1C48 A;  4A3D H;  4JPB W;  4A3M B;  4BY1 B;  3J80 L;  4KN7 C;  1STG A;  3KFU A;  4F87 A;  4LF7 Q;  4L5T A;  1F77 A;  3CE7 A;  4IPD A;  3LNN A;  3CC7 A;  1SNQ A;  1BBW A;  1RO0 A;  3FKI H;  4LF4 Q;  3CCM A;  1B3Q A;  2CG5 B;  2DNW A;  2HIV A;  1HNW Q;  2GVA A;  2JQ4 A;  1K28 A;  2IPK D;  3N6R A;  1X3E A;  2C35 B;  5FJ8 G;  1EIG A;  3NTH A;  1BCP D;  3SK6 A;  1KAW A;  2I5L X;  2JA6 G;  3BVZ A;  5I4T G;  2ICI A;  3J81 c;  2K93 A;  1KNE A;  4JI7 L;  3GTP B;  1JB3 A;  3SDZ A;  3AB9 A;  1ZKO A;  3K0Y A;  5KNB A;  1CT1 D;  1Q81 Q;  2N88 A;  3FHW A;  1R9T B;  3H15 A;  1VDZ A;  5J1Z A;  4BY1 H;  4HCS A;  4JYA L;  5C44 B;  1UE7 A;  3P1H A;  5IYC G;  2GVB A;  2JA5 G;  1EU3 A;  2B2T A;  2NN6 I;  3K6O A;  4DF7 A;  2N50 A;  2BH8 A;  4DR6 Q;  3RG6 C;  5IP9 G;  4G7O C;  1CFM A;  1IHZ A;  2AWN A;  3D4R A;  3K5L A;  2MHV A;  1XNQ L;  1E1T A;  2XGT A;  4A3F H;  2KG9 A;  1I4P A;  4DR2 L;  4OHJ A;  3PGZ A;  3J7A 5;  4FXG C;  2X69 A;  1B1Z A;  4A3G B;  3S1Q H;  4C3J H;  1D1K A;  3VR5 A;  2KED A;  2A68 D;  2ATW A;  5C4X B;  1JOR A;  4KKU A;  4KD4 A;  1B44 D;  2YU9 H;  4K6L A;  1EQQ A;  5IY0 A;  2K0D X;  2Z6K C;  2WAQ G;  3G1I A;  2H4O A;  3EA6 A;  3ERQ A;  4A3K B;  4M8A A;  4X3U A;  4IFD G;  2KG8 A;  1LUZ A;  4QUF A;  1QVG A;  3PO2 G;  4K2K A;  4QL5 A;  1V1Q A;  1VQL P;  3W2D A;  3S2H H;  2UUB L;  2N8N A;  3O13 A;  4J1M A;  1YNJ C;  4XRQ A;  5GQO A;  3CCU A;  1XJV A;  4V19 0;  4B9W A;  1OXU A;  2VL6 A;  3P05 A;  3CQZ H;  4G57 A;  4RGM A;  2Z4H A;  2PI2 E;  3CC7 P;  2Q2I A;  4BY7 H;  1NUC A;  2FVF A;  2JYG A;  4GS3 A;  3H0G H;  4IUV A;  4HJ9 A;  3CCQ P;  2JP1 A;  3HOX G;  2XZ1 C;  3W1B A;  2OQ0 A;  3DUZ A;  1MJC A;  2B2Y C;  3PMF A;  2XV6 A;  5FO9 B;  3CCS P;  1PFN A;  1AEX A;  3OOC A;  1UNK A;  2PEN A;  5FJ8 H;  3QO2 A;  2R7Z G;  2L15 A;  3K8A A;  5D14 A;  3PO2 H;  1A43 A;  3TRE A;  2VLO A;  1NTG A;  2VXW A;  1GPJ A;  2MUY A;  3KF8 A;  4LF6 L;  4LF6 Q;  1O7Y A;  1QWY A;  2KHJ A;  2UXD Q;  3WWV A;  2Z1C A;  1DCZ A;  2F0L A;  1NR2 A;  4QJF A;  1IXR A;  1TVX A;  4DNI A;  5I6Y A;  1ESR A;  1Z47 A;  2F0T A;  4BBS B;  4K6D A;  4LF5 Q;  1CKN B;  4OGQ C;  3IL8 A;  3GP7 A;  4PNY A;  4C3J G;  3NUC A;  4RWS C;  2IX3 A;  5C0X G;  3QWN A;  2UUC Q;  3FMC A;  1HZC A;  5EJD A;  2CHB D;  2IHE A;  2L4N A;  3U9S A;  2F0N A;  3BDC A;  1LT5 D;  4K8I A;  3BG3 A;  5BN5 A;  5I2Y A;  4B3M Q;  1M90 C;  2AKW B;  3H3V I;  1JIC A;  2HDM A;  3MEH A;  1B4O A;  4DV0 Q;  1STN A;  4GOP C;  5FKA C;  1MD2 D;  3BYY B;  2HCI A;  3AQQ A;  3T1Y Q;  5IYC H;  1VQ9 A;  5COY A;  5AJ3 L;  1BCP C;  2RDH A;  5IYB H;  3GTK H;  1O80 A;  2FJ2 A;  3VDY A;  1S5C D;  2FAD A;  3L7Z C;  3WOF A;  5C0X J;  5M5Y H;  1SMY C;  1CUK A;  4ZUJ A;  3DS0 A;  2K6A A;  1XPR A;  4LF9 L;  4F7X A;  4DV3 Q;  5JAV A;  1G2S A;  3GZL A;  4J6H A;  1NNX A;  1XTC D;  4Q0F A;  3MWY W;  5DLQ E;  1ENA A;  1Y8O B;  3PCO B;  4YHH L;  1EIY B;  3I4O A;  4A3G G;  2F3I A;  4DUZ Q;  1KC8 Q;  3H47 A;  2ZXR A;  4EGV A;  1IBL Q;  1CSQ A;  1VQ7 P;  3FKI G;  4F8M A;  2N98 A;  3A5Z B;  5IOD A;  2B2U A;  1ZXT A;  1AFP A;  5JJK A;  3HOW B;  1VQG A;  4CDD C;  1EYC A;  1VQ8 A;  4EQP A;  3CP0 A;  4LK1 C;  4JBW A;  1VF5 C;  4A3L H;  2E5L L;  3OHX C;  5JVG 3;  2CW0 D;  3PIO A;  2G9H D;  4XFZ A;  1O78 A;  5TSS A;  4NDX A;  4LFA L;  3D4W A;  4GOP A;  5J22 A;  4EQN A;  4FYD A;  2PY8 A;  1CK1 A;  1F2M A;  4ZYS A;  4PZ7 A;  4XXE A;  1N9W A;  4QGU A;  4LWC A;  1M8A A;  2PEM A;  2A69 C;  2R92 B;  4NEO A;  4POG A;  3UDX A;  2ZTE A;  1LLR D;  1B2T A;  4R8I A;  3HZQ A;  1SYG A;  1S40 A;  2R7D A;  5EKK A;  3K80 C;  3F2B A;  2JA8 B;  1K83 H;  5NUC A;  2PZU A;  1VQO A;  2XSC A;  4GLV B;  3BS1 A;  2R7F A;  4A3J B;  3D8G A;  5C3E H;  4IUT A;  3HOZ H;  4JCV E;  1BQQ T;  1RD9 D;  2IY5 B;  3WOE A;  5CBA E;  2HHH L;  3HOW G;  4NXM L;  4NXM Q;  1YNN C;  4HR7 B;  5G3L D;  4UP8 A;  2JA8 H;  5K36 H;  4BPG A;  3NQT A;  3C3L A;  3B4Q A;  4LF4 L;  2OF1 A;  5H1S E;  3GD7 A;  2PEQ A;  2CWP A;  4KKT A;  3HP3 A;  2RDG A;  4HIO A;  3IRB A;  4DR2 Q;  1Q82 Q;  2AMC B;  2WFW A;  1VQD A;  3GJN A;  4A93 H;  3UE1 A;  2B63 B;  4H2W C;  2D0O A;  1WJJ A;  1NR4 A;  5HGL A;  3L3O C;  3OWF A;  1EWI A;  1PMR A;  5F2D A;  3S16 B;  1TII D;  2HQE A;  2L9H A;  4DV7 L;  2OT2 A;  4UHP B;  4KY5 A;  1M1K C;  1VQ5 A;  1JE5 A;  2OTJ P;  1CZW A;  5E4W C;  2HHH Q;  1V8Q A;  2H1E A;  4IUU A;  3S1M H;  4LFC Q;  4X65 Q;  4C3I H;  1WTQ A;  2KOL A;  5CGK A;  4YWM A;  1BVS A;  4A3B B;  4X66 Q;  1W2B A;  1PH9 A;  3RLF A;  1A3U A;  1E3P A;  4BA2 I;  2V1C C;  1BKB A;  3KBG A;  4GNX A;  5LMN Q;  4CBV A;  1STY A;  1EU4 A;  4DR5 Q;  3HKZ B;  3P7J A;  2GZG A;  1SE4 A;  2K5W A;  3F2D A;  4OX9 L;  4DR4 Q;  5EBD A;  2UXB L;  3C46 A;  2IL8 A;  3S9W A;  4DV6 Q;  2JBG A;  1K0R A;  3W3A A;  4IJH A;  2R61 A;  2B63 G;  1U9R A;  1AZP A;  2KWL A;  1LO5 D;  3A55 A;  4O1N A;  4KK7 A;  3L9A X;  1AE3 A;  5GAG C;  4GKK L;  5IGB A;  3L2P A;  1N32 L;  3OMC A;  4L5R C;  1NMG A;  3FP9 A;  4QIW B;  1CEI A;  3MGE A;  5JVH 3;  3S1M B;  4DFA A;  3LRY A;  5LMU L;  2F0Q A;  4C56 C;  4X3S A;  5FLX L;  4MHE A;  2Y0S E;  1K0S A;  2AWO A;  1LTL A;  3NWS A;  3CRK C;  2K01 A;  2K50 A;  2L12 A;  2QDL A;  2QNW A;  5KYL A;  1E6J P;  3DXJ C;  2L0Q A;  2F0M A;  2EYM A;  1SMY D;  3R2T A;  5CV7 A;  3NBH B;  1N36 Q;  3ER0 A;  3TEH B;  4U0E A;  1HH2 P;  2E2J B;  5ELE A;  2MP1 A;  1VQP P;  1F2L A;  1EY8 A;  5C4X H;  2QKI C;  3G0V A;  1IYU A;  2MPM A;  3NEN A;  1RKN A;  2NVX H;  1KD1 Q;  1E2V A;  3VR2 A;  2NN6 H;  2XWJ B;  1U5K A;  2RF4 A;  2Y0S G;  3U4V A;  2JGP A;  1IBM L;  3IFT A;  4BXX H;  3CCU P;  1YI2 P;  1A0I A;  1RDP D;  5FO8 B;  1QVF A;  2MFI A;  2NVQ H;  1QB5 D;  1SFO H;  1VQ9 P;  2WAQ E;  1PRT B;  4A75 A;  1CZG A;  4YIJ A;  4BA1 I;  4DXF A;  1VQE A;  1HQM C;  3MFY A;  3SK5 A;  1A3T A;  2F0I A;  2UUA L;  2EHT A;  4AQY Q;  4IJL A;  4X64 Q;  4TQU S;  2NTT A;  4WOR A;  1VHN A;  4DN4 M;  3J81 j;  1IUQ A;  3M4P A;  5JJL A;  2XT1 A;  2ICE C;  2KCT A;  2VS1 A;  3H4E A;  2N78 A;  3QG1 A;  4HJ5 A;  3AFQ A;  1I4G A;  3SEB A;  2C5C A;  4FXK C;  3NTE A;  1L1O B;  1GXH A;  3EQL C;  1Y69 U;  4RHR A;  4FF1 A;  2H5X A;  1VQB A;  2GA4 B;  3NTI A;  4N9T A;  3A74 A;  3OYY A;  3Q23 A;  5EBC A;  5FLX c;  1VQ4 A;  2EPB A;  5C44 H;  1MJE A;  4U0A A;  4HMJ A;  5E4X A;  5ELF A;  3ULJ A;  1WOC A;  4IPY A;  2NVY B;  4DV0 L;  2ZTC A;  4DAY B;  2QA4 A;  4R4Q A;  1I5F A;  2PEI A;  1PH2 A;  1II3 A;  1TWC H;  3QB3 A;  3U43 A;  1OXT A;  5IYB G;  5F2N A;  3E0J A;  1MIU A;  3BDL A;  4JVZ A;  1PRT D;  2RBM A;  4JI5 L;  3M4O B;  2FQ2 A;  4YY3 L;  2BDO A;  5KYI A;  3RUZ A;  2K03 A;  2VZA A;  1FGU A;  1NJI Q;  1EEF D;  4ME3 A;  3F2U A;  1SDF A;  1XMQ L;  2F0J A;  2K5N A;  4DV2 L;  1YHQ P;  2DJF C;  4KJN A;  4OXP A;  2RHS B;  1GUS A;  1L0I A;  3VA7 A;  1SND A;  1STA A;  3F8T A;  3S14 B;  2FIN B;  2SNM A;  2KVM A;  4KN4 C;  1EFW A;  2M8N A;  3CCR P;  1V9P A;  4A93 G;  1K8G A;  3MXP A;  1IBK L;  2K75 A;  3GTG H;  2RKS A;  2JE6 I;  1D5X C;  4JBK A;  1X54 A;  4P2C B;  1TS3 A;  1FNW A;  1B70 B;  1GHJ A;  1A62 A;  2ZT9 C;  1JJG A;  5DAU A;  2L6E A;  4U0D A;  1RF2 D;  1SRU A;  2KQ3 A;  1EFI D;  3ZJY C;  2UXC Q;  3H09 A;  4RH6 A;  4LUZ A;  3OTO L;  3T1Y L;  3DPH A;  3MA2 B;  3HOZ G;  2B2Y A;  1EYG A;  4HIM A;  1Q8I A;  2OXP A;  2K5D A;  3HFZ B;  3HYB A;  1P8L A;  1RJT A;  1UNS A;  2I07 B;  5D3D A;  1DOM A;  4ABN A;  4C2M H;  3CCJ A;  2E75 C;  2A5H A;  1TWA H;  3E6Z X;  1DJR D;  2EYH A;  3I2Z A;  1U4L A;  5KGU A;  2QA4 P;  2F0H A;  3GTG B;  3G48 A;  1YJ9 P;  2B2W C;  2NN6 G;  5T1I A;  4DV7 Q;  1E24 A;  1LM0 A;  1N8R Q;  1ET9 A;  3PUV A;  4DR6 L;  2K92 A;  1WVL A;  1HCZ A;  2M8P A;  4HED A;  3A5U A;  3DS1 A;  1FR2 A;  4BBR H;  2NVT H;  1HRJ A;  2L55 A;  2HIX A;  4A3I G;  1KC8 C;  1C8C A;  4DAY A;  5HGN A;  3RMH A;  5A2Q E;  1Y1V H;  5M3M G;  2MVU A;  3I56 A;  3K0X A;  2AF8 A;  1EY4 A;  1UEB A;  4A3D G;  4PXH B;  4JI6 Q;  1AZQ A;  2LTE A;  3WBH A;  1QG7 A;  2R93 H;  3NY7 B;  2NVT B;  2N3S A;  1TWF B;  1TWA B;  4QUC A;  4JBM A;  2UUC L;  3FVQ A;  4H2X C;  5JPA A;  2EDG A;  5ELO A;  1WD0 A;  3OIP A;  2I0Q A;  2GZF A;  2BDN A;  2F03 A;  3HOV G;  2RCN A;  5HVC A;  2D9U A;  2C9O A;  2OTL A;  4O0A A;  1EOT A;  5FK9 C;  4A76 A;  5IYD G;  1KD1 C;  4WYM A;  2KJX A;  3CD6 P;  1I3Q H;  1O7Z A;  1IW7 D;  4DPG A;  3JC6 6;  2F0E A;  1CTM A;  2JYO A;  3PQI A;  3DTJ A;  3LWE A;  1K73 C;  1BAJ A;  2VSQ A;  1IZ6 A;  3A56 A;  3MZ5 A;  1VQP A;  1ACP A;  1SXT A;  1I4Q A;  4GLA C;  1QE6 A;  1TS4 A;  5D3I B;  3KLS X;  1D2B A;  1FR3 A;  4DNT B;  2JAZ A;  2Z8L A;  5A35 A;  3CC4 P;  1XMQ Q;  1I3Q B;  3JAM i;  3CHB D;  1MSG A;  2ZJQ A;  1HNX L;  2ALY B;  1SN8 A;  1RNI A;  1G8Z D;  1PH3 A;  3U4Z A;  1DOL A;  2J4X A;  1HUM A;  1AF8 A;  1YJW A;  3MAQ A;  2UXD L;  1GVP A;  2Q2T A;  3OTO Q;  2OEO A;  4FDB A;  3TZD A;  5KNC A;  1TKW B;  5DM7 3;  4E6I A;  3NE5 B;  5AJ3 Q;  3PUZ A;  2MR8 A;  5D65 A;  2HUG A;  2I46 A;  3TRZ A;  2LMC B;  2PW7 A;  3H91 A;  4GN3 B;  3OMG A;  3GO5 A;  1RCV D;  4CDC C;  5C0X I;  2PEK A;  1Y1W H;  4UY8 C;  1G51 A;  1YJN P;  1EEI D;  4WJW A;  5JJI A;  5HGQ A;  1Q7Y C;  1RIP A;  3I73 A;  4LFA Q;  3IFD A;  1C9O A;  1PV4 A;  2LIW A;  2LPK A;  2N5H A;  3G21 A;  4HSV A;  3W1G A;  4I65 A;  4GNX B;  2B8F A;  1N36 L;  3HOU G;  1V1P A;  4COP A;  3Q6S A;  3Q8D A;  4N9P A;  5ELC A;  1Q86 Q;  1T9H A;  1HZ9 A;  5FOB B;  5K36 G;  4R8N A;  2F0V A;  2F0D A;  1KLU D;  5JEA H;  1UWV A;  3H3V C;  4GR6 A;  2E2J H;  5E1F A;  4LFB L;  4UHV A;  4BY7 G;  1TWG B;  4LUV A;  1KDA A;  3ERO A;  1B9M A;  4ZUI A;  1HNZ L;  1JOK A;  3CMA A;  4BPF A;  2B29 A;  4H7B A;  3S16 H;  5JEA G;  3FEW X;  1VMP A;  4U0B A;  4WRD A;  5CV4 A;  2UU9 Q;  2DY7 A;  4AH6 A;  2KW2 A;  2EY5 A;  2EJF C;  2F3V A;  3DWP A;  2F4I A;  2JEA I;  2DUD A;  2OWO A;  5IYD H;  3TZU A;  4H2Y C;  1VQN P;  3HOU H;  1OXX K;  2KCN A;  3TS0 A;  1S72 A;  1SJH D;  1VQN A;  1YIT P;  1TR5 A;  2J7Z A;  5M5X H;  4UP9 A;  2VUM G;  1TY2 A;  4IPC A;  4C3I B;  2M8L A;  4NXN L;  1HFN A;  1G6Z A;  2CVR A;  1EMV A;  2AFE A;  4BWG B;  4IQZ A;  3CRL C;  1SJE D;  3KYH C;  2B2T C;  3ULP A;  1E2W A;  4M1U B;  5IGG A;  4BS9 A;  1QVF O;  3VYS A;  5IE8 A;  1BXT A;  4PG3 A;  1WTX A;  2E2H H;  1J6Q A;  4MTN A;  4CDE C;  1D5M C;  1NMF A;  2KGD A;  1PRT C;  1SYE A;  2WIN B;  1I4X A;  2BH2 A;  1N8R C;  1HA5 A;  4R4O A;  3EJB A;  2VQE Q;  1SFO B;  4C1N K;  5M9O A;  1E22 A;  1ENC A;  3U9O A;  3QJY A;  1SBB B;  1YNX A;  1JMC A;  3PSI A;  1WCM B;  3G71 P;  2F0G A; 
#chains in the Genus database with same CATH homology
 1M74 A;  4JI3 Q;  4HIO A;  3IRB A;  4X6A H;  4DR2 Q;  1VQ6 A;  4A3K G;  1WCM G;  5LMN W;  1Q82 Q;  3E0E A;  2ZTD A;  2AMC B;  2D62 A;  2WFW A;  1VQD A;  5HY6 A;  4A93 H;  1Q1B A;  1W3S A;  4UPA A;  3UE1 A;  3U58 A;  2B63 H;  2JA6 H;  2D0O A;  1WJJ A;  1ZMB A;  5HGL A;  2BA0 A;  2OAR A;  1SLJ A;  4LF5 L;  4OO1 G;  1KRS A;  1EWI A;  3CME A;  1L2F A;  1FJG Q;  1YHA A;  3AYH B;  1K73 Q;  3RLN A;  4YY3 Q;  4QQB X;  4RMF A;  4DV7 L;  1WCM H;  3KOJ A;  4JI5 Q;  1CKM A;  2F4V L;  4YWK A;  1M1K C;  1ASY A;  1VQ5 A;  4AYB E;  1OXS C;  1XPU A;  2PEO A;  1O7I A;  1JE5 A;  3T1H Q;  1IYJ B;  2OTJ P;  2HHH Q;  3M3Y H;  3UE0 A;  2R7Z H;  1QZG A;  4DR7 L;  1N32 Q;  1YBY A;  3S1M H;  4PZ8 A;  1M90 Q;  1YEZ A;  3KLW A;  4X65 Q;  4LFC Q;  4TVA B;  4C3I H;  1N34 L;  4YWM A;  4DR1 L;  4DR1 Q;  1BVS A;  4DV5 L;  2VY3 A;  4U0C A;  1Q82 C;  1YI2 A;  3GTP H;  3ICE A;  1GM5 A;  2YTV A;  4M0I A;  2K52 A;  3STB D;  4X66 Q;  3M85 A;  1W2B A;  1PH9 A;  3RLF A;  1E3P A;  1PHJ A;  1VQ5 P;  4BA2 I;  2R6G A;  3PUY A;  2V1C C;  1BKB A;  2E1M A;  2ZJR A;  2LF4 A;  3BU2 A;  5IP7 H;  3HOX H;  4GNX A;  3RNU A;  3HOY G;  5LMN Q;  2JO0 A;  3H0G G;  1IBK Q;  4L5S A;  2E8G A;  2CKZ B;  4DR5 L;  4DR5 Q;  3KDF B;  2JA7 G;  4P72 A;  3J7Z C;  4DR4 Q;  1E1O A;  3F2D A;  4OX9 L;  2UXB L;  3UDG A;  1FJG L;  2BUO A;  1M6N A;  4DV6 Q;  1K0R A;  3UDF A;  5EAY A;  4IJH A;  1PH1 A;  2ONT A;  4B3T L;  1N33 L;  2PQA A;  2B63 G;  3GTL H;  5IWA L;  4IO9 A;  3RR5 A;  2CQO A;  2LXJ A;  3PUX A;  4IPH A;  3S15 H;  1C0A A;  4P75 A;  3I4N G;  4R1J A;  4BBR G;  4GKJ Q;  1S3O A;  1X3F A;  4YHH Q;  4YCU A;  1JJ2 A;  2OTL P;  4U0F A;  5BS1 A;  1A8V A;  1YZ6 A;  2MQH A;  1AE3 A;  4DK3 C;  5GAG C;  4DV4 L;  4DV4 Q;  3E9I A;  3L2P A;  1N34 Q;  1HNX Q;  2E2I H;  4DR7 Q;  1VQ7 A;  4L5R C;  1N32 L;  3OW2 O;  1NMG A;  3G4S P;  1WYD A;  3FP9 A;  2Z6K A;  4PH0 A;  1Q8K A;  5GAD C;  4ALP A;  3MGE A;  2KBN A;  3J80 i;  3AFP A;  1I94 Q;  3LRY A;  3CPF A;  2WP8 J;  5LMU L;  3LGJ A;  4HJ7 A;  1VCI A;  1D8L A;  1VQ8 P;  2Z44 A;  2Y0S E;  4DKA C;  2AWO A;  3UDI A;  1LTL A;  4A3E G;  2JQO A;  2B3G A;  3S14 H;  1XTD A;  1W2B O;  3EN2 A;  2K50 A;  4YCV A;  1X9N A;  1VQM P;  5C3E G;  1E7Z A;  2ZM6 Q;  1VQF A;  2CWA A;  1Q81 C;  1N33 Q;  3MXN B;  4IPG A;  1TWH H;  4YCW A;  1YHB A;  2K5H A;  1XNQ Q;  1E6J P;  1D1D A;  1KHI A;  3PO3 G;  1VQ6 P;  4XTC S;  4X62 Q;  4X62 L;  2YV5 A;  3NBH B;  4PZ6 A;  5GAE C;  3ER0 A;  3TEH B;  4U0E A;  3CCJ P;  1L1O A;  2F52 A;  3DM3 A;  4A3K H;  1HH2 P;  4P73 A;  4JV5 Q;  3L0O A;  1NE3 A;  2Q2U A;  3HOW H;  4KHP Q;  2YTY A;  2FXQ A;  4KHZ A;  1XNR Q;  4KHP L;  4A4I A;  1PH6 A;  1VQP P;  1Q1E A;  4R4T A;  4A3I H;  5C4X H;  3RN5 A;  4GLX A;  3G0V A;  1GD7 A;  4AQY L;  4X64 L;  3NEN A;  3GTM H;  3G1G A;  2NVX H;  1KD1 Q;  2KCM A;  4HJ8 A;  2OTJ A;  1YIJ P;  1VQK P;  1U5K A;  2KHI A;  2Z46 A;  2RF4 A;  2Y0S G;  3U4V A;  2P9X A;  1CSP A;  1HNZ Q;  1IBM L;  4JI6 L;  1VQO P;  1EQR A;  4BXX H;  3J81 i;  4MZ9 A;  1OXV A;  2K4K A;  3G6E P;  3CCU P;  1KQS A;  3DS5 A;  4AYB G;  2VUM H;  4JC0 A;  2WB1 G;  4GNX C;  1YI2 P;  3I7F A;  4JYA Q;  1A0I A;  1YJW P;  2NVQ H;  1QVF A;  2MFI A;  1Z9F A;  4RG1 A;  1SFO H;  3DS2 A;  1VQ9 P;  2WAQ E;  4A75 A;  1WI5 A;  5M3F H;  5J3B A;  4BA1 I;  3CC4 A;  1VQE A;  4BBS G;  4JI1 Q;  1IBL L;  3T1H L;  4DUY L;  4EX5 A;  4A3F G;  4JI4 Q;  2PQA B;  3EBE A;  2UUA Q;  1A8O A;  2UUA L;  1HZB A;  2QGQ A;  4IJL A;  2OCE A;  4TQU S;  3CCM P;  4JOI C;  2NZO A;  4GN5 A;  3RLO A;  4X64 Q;  4DV1 Q;  3J81 j;  1HR0 W;  1IUQ A;  2MO0 A;  3M4P A;  4X65 L;  4NXN Q;  5JJL A;  1NY4 A;  2JK8 A;  5M3F G;  2XT1 A;  3G28 A;  2Q2H A;  2NZH A;  4R4I A;  2IX1 A;  2KCT A;  2K14 A;  2VS1 A;  3NEM A;  1RO2 A;  3I56 P;  4XIG S;  3H4E A;  2N78 A;  4JI8 L;  4JI8 Q;  5FLM G;  3DLL A;  2YYZ A;  1VQM A;  2I5M X;  4HJ5 A;  3AFQ A;  1JB7 A;  4A3E H;  1YVC A;  4BXX G;  1M6E X;  3W5O A;  4GKK Q;  2MO1 A;  3NTE A;  1L1O B;  3CC2 A;  2EG5 A;  2IHF A;  1HZA A;  2PMZ E;  2F4V Q;  3U50 C;  2H5X A;  4JI1 L;  2EIF A;  1VQB A;  3KF6 A;  4DUY Q;  5F2O A;  3A74 A;  4HIK A;  3OYY A;  1VQ4 P;  4JG2 A;  4PH1 A;  4B3M L;  4LF8 Q;  4K0K L;  5FLX c;  1K8A C;  1AUM A;  1EUJ A;  3D0F A;  1VQ4 A;  4A3B G;  5C44 H;  3HOV H;  1MJE A;  4U0A A;  3ULJ A;  4XRO A;  1WOC A;  4IPY A;  4DUZ L;  2BHV A;  1UE5 A;  4DV0 L;  4H02 A;  4DV1 L;  2ZTC A;  3ERS X;  4DAY B;  3CME P;  1EOV A;  3NEL A;  4R4Q A;  1I5F A;  2QA4 A;  4DV5 Q;  1OTC A;  4JI0 Q;  1L0W A;  5GAH C;  1YJ9 A;  2PEI A;  2YTX A;  3S2D H;  3PO3 H;  2I5H A;  1TWC H;  4QY7 A;  1PH2 A;  2R93 G;  5HGO A;  1KIX A;  3I4M H;  2N49 A;  3RN2 A;  1PFS A;  5IP7 G;  3HOY H;  5HGM A;  3M9B A;  2VQF Q;  1OXT A;  5IYB G;  5F2N A;  1MIU A;  5M5W H;  4A3D H;  2R92 H;  3PUW A;  2EIA A;  2JYL A;  5ELN A;  4JI5 L;  1IL2 A;  4DR4 L;  2UXB Q;  4OX9 Q;  4YY3 L;  3KFU A;  1Y1V G;  4LF7 Q;  2RHQ B;  4L5T A;  1K3R A;  3KJO A;  3J80 c;  5IWA Q;  4OWT B;  1QRJ A;  1K30 A;  1JJC B;  4IPD A;  2VZA A;  1FGU A;  3KF6 B;  1NJI Q;  3CC7 A;  4ME3 A;  1XMQ L;  3K81 C;  1BBW A;  3K7A H;  4GOP B;  1RO0 A;  1QVG O;  3FKI H;  4LF4 Q;  3CCL A;  3CCM A;  2K5N A;  4DV2 L;  2ZJP A;  4DV2 Q;  1YHQ P;  4OO1 I;  4OXP A;  1TWF H;  2HIV A;  2RHS B;  1HNW Q;  1PH7 A;  2GVA A;  2EQS A;  1GKH A;  4JI0 L;  2PI2 A;  4A3J H;  1VQL A;  1TWG H;  2JEB I;  1X3E A;  2C35 B;  5FJ8 G;  1Y14 B;  3F8T A;  4O2D A;  1BBU A;  3RZO H;  4A3B H;  4WJ3 M;  3CCS A;  4AQY Q;  3JAM c;  1X56 A;  1KAW A;  3CXC A;  2I5L X;  2JA6 G;  5I4T G;  1EFW A;  1K9M C;  2M8N A;  3CCR P;  3J81 c;  1V9P A;  4JI7 L;  1KRT A;  2VW9 A;  1K8G A;  4L5Q A;  1IBK L;  4A93 G;  2K75 A;  3CCR A;  3GTG H;  1X65 A;  2Z45 A;  1SE8 A;  2JE6 I;  2HT1 A;  4JBK A;  1X54 A;  1Q81 Q;  3FHW A;  1B70 B;  4OWX B;  4C3H H;  3H15 A;  1A62 A;  1KL9 A;  1Q46 A;  2CFM A;  2UU9 L;  4BY1 H;  3CD6 A;  4JYA L;  4B3R Q;  1JJG A;  1UE7 A;  5IYC G;  2GVB A;  2JA5 G;  2L6E A;  4U0D A;  2EXD A;  1SRU A;  3ULL A;  4R4C A;  2NN6 I;  4A3C H;  5IT9 c;  3ZJY C;  3S1R H;  2BH8 A;  1XNR L;  4B3R L;  3A0J A;  2UXC Q;  4DR6 Q;  3RG6 C;  3E9H A;  5IP9 G;  2AWN A;  4LUZ A;  3HKZ G;  3OTO L;  3GTO H;  3T1Y L;  4X66 L;  3DPH A;  1XNQ L;  5F2K A;  3PF5 A;  3HOZ G;  3CCE A;  4HIM A;  1EYG A;  1E1T A;  2XGT A;  4A3F H;  1XMO Q;  1Q86 C;  2XTI A;  1I94 L;  2BA1 A;  3HFZ B;  4DR2 L;  3PGZ A;  3HYB A;  1P8L A;  4C2M H;  3J7A 5;  1H95 A;  3CCJ A;  3AEV A;  5DCK A;  4B3S L;  2JA8 G;  3B6Y A;  4J15 A;  3S1Q H;  4KI0 A;  4C3J H;  3S1N H;  2ATW A;  1TWA H;  1HR0 L;  3CMA P;  3D31 A;  2YU9 H;  3I2Z A;  1EQQ A;  2QA4 P;  5IY0 A;  2Z6K C;  2WAQ G;  3G1I A;  3CCV P;  3BZC A;  1CKN A;  1YJ9 P;  2NN6 G;  3G48 A;  1VQC A;  4DV7 Q;  1E24 A;  4GKJ L;  1LM0 A;  1N8R Q;  3S24 A;  3PUV A;  3RZD H;  4HJA A;  4IFD G;  4DR6 L;  1M1K Q;  1LUZ A;  1I50 H;  1QVG A;  2QEX P;  2M8P A;  3PO2 G;  4Y52 H;  3M7N A;  4QL5 A;  1V1Q A;  1VQL P;  3DS1 A;  3A5U A;  5E7N A;  4BBR H;  3G4S A;  4A3I G;  2HIX A;  1KC8 C;  2UUB L;  2JJQ A;  2K5V A;  2NVT H;  2N8N A;  5HGN A;  3S17 H;  5LMU Q;  5GQO A;  4XRQ A;  3E2D A;  3G6E A;  3CCU A;  1XJV A;  1OXU A;  1VQH A;  3P05 A;  2VL6 A;  3CQZ H;  1Y1V H;  5M3M G;  1G6P A;  4IFD I;  4IFD J;  1X55 A;  1FVI A;  3I56 A;  2PI2 E;  3CC7 P;  2Q2I A;  4NB3 A;  4BY7 H;  3K0X A;  4AIM A;  2JYG A;  4GS3 A;  1UEB A;  4XFX A;  2JA7 H;  4A3D G;  3H0G H;  3M4Q A;  4HJ9 A;  4JI6 Q;  3CCQ P;  5LMN L;  1Q7Y Q;  3G71 A;  3HOX G;  1VS0 A;  3GTQ H;  3WBH A;  3W1B A;  3CCQ A;  2R93 H;  2KEN A;  2ES2 A;  2EFJ A;  1DGS A;  2N3S A;  2OQ0 A;  3KF8 B;  3CF5 A;  2AHO B;  1PH4 A;  3Q20 A;  1MJC A;  4Y7N H;  4OWW B;  2XV6 A;  4DV6 L;  4JBM A;  1AH9 A;  4B3T Q;  3CCS P;  5IP9 H;  1SRO A;  2UUC L;  4LF7 L;  5JPA A;  1TXY A;  5ELO A;  2I0Q A;  2XXM A;  3KJP A;  2LSS A;  4A3C G;  4A3G H;  3HOV G;  2RCN A;  2PEN A;  5FJ8 H;  4DR3 Q;  2JA5 H;  2OTL A;  1CKO A;  2GN5 A;  1PYB A;  4O0A A;  4A3J G;  2L15 A;  2ASB A;  2R7Z G;  3K8A A;  1MKH A;  4GKK L;  2PNH A;  2CCZ A;  4A76 A;  3PO2 H;  1A43 A;  3TRE A;  1EIF A;  5IYD G;  4LNQ A;  2UUB Q;  1HNW L;  1NTG A;  1KD1 C;  3MEF A;  4WYM A;  1X3G A;  3CC2 P;  4LF6 L;  4LF6 Q;  2UXD Q;  2KHJ A;  3CD6 P;  1I3Q H;  3F1Z A;  4YWL A;  1GO3 E;  3WWV A;  1K9M Q;  3I4N H;  4DPG A;  4B3S Q;  4QJF A;  1IXR A;  4DNI A;  1YIJ A;  1IBM Q;  3JC6 6;  1Z47 A;  3BJU A;  2VQF L;  3DTJ A;  4LF5 Q;  1CKN B;  1K73 C;  2OQK A;  1BAJ A;  4DK6 C;  3PIP A;  1VQJ A;  4OON A;  5JEA J;  1IZ6 A;  5FLM H;  4A3M G;  4JI7 Q;  3CPW O;  1VQP A;  4PMW A;  5C0X G;  2Z0S A;  4GLA C;  2UUC Q;  1HZC A;  2IHE A;  3M1M A;  3I4M G;  3DS3 A;  3K7U C;  3OW2 A;  3CC4 P;  2D0P A;  1XMQ Q;  3PV0 A;  3JAM i;  4B3M Q;  2PEJ A;  1M90 C;  1EIA A;  4LF8 L;  2AKW B;  3H3V I;  2ZJQ A;  4JV5 L;  2DGY A;  1R9T H;  2MNA A;  4P74 A;  2ALY B;  1SN8 A;  4DR3 L;  1RNI A;  1G29 1;  1PH3 A;  3U4Z A;  1C7Y A;  1HNX L;  3PF4 A;  4JBJ A;  4HID A;  4DV0 Q;  1YJW A;  4GOP C;  1GVP A;  2Q2T A;  2UXD L;  3OTO Q;  4FDB A;  3AQQ A;  3T1Y Q;  5IYC H;  1VQ9 A;  5AJ3 L;  1LYL A;  5AJ3 Q;  3CCV A;  4A3M H;  3PUZ A;  2R92 G;  4BY1 G;  1ASZ A;  5IYB H;  3TRZ A;  1L1O C;  3I55 A;  3GTK H;  4GN3 B;  1UE1 A;  3GO5 A;  2A1A A;  4NPS A;  3L7Z C;  3VDY A;  1VQK A;  2LXK A;  5C0X I;  5C0X J;  2PEK A;  1Y1W H;  5M5Y H;  1U0L A;  1EOQ A;  1CUK A;  1G51 A;  4COC A;  5GRO A;  3DS0 A;  1YJN P;  4P71 A;  4UY8 C;  5JJI A;  1UE6 A;  1NBW A;  5HGQ A;  3CW2 C;  1HR0 Q;  1XPR A;  4LW1 A;  4LF9 Q;  4LF9 L;  3CAM A;  1Q7Y C;  1WFQ A;  1RIP A;  4DV3 Q;  1PVO A;  1KQS O;  2HQL A;  1VQI A;  1PH5 A;  1RL2 A;  4LFA Q;  1SR3 A;  1C9O A;  1PV4 A;  1K8A Q;  5C44 G;  5C4X G;  3G21 A;  4QIW E;  5DLQ E;  3W1G A;  4GNX B;  3I55 P;  2ID0 A;  4YHH L;  3PCO B;  1N36 L;  4LFC L;  1EIY B;  3I4O A;  3HOU G;  4A3G G;  2F3I A;  4XFY A;  1KC8 Q;  1QUQ B;  3H47 A;  4DUZ Q;  2CWP A;  4COP A;  1CSQ A;  5C4J H;  2IT1 A;  1IBL Q;  1VQ7 P;  3Q8D A;  4MNO A;  4EQ5 A;  1YJN A;  3FKI G;  1Q86 Q;  3HKZ E;  3A5Z B;  3H3V H;  1FL0 A;  1T9H A;  1HZ9 A;  3VRL C;  5K36 G;  1PYS B;  4BBS H;  3DS4 A;  4UP7 A;  5JJK A;  3TQY A;  1VQG A;  1UWV A;  1N36 Q;  1QVC A;  4GR6 A;  1VQ8 A;  3CP0 A;  4JBW A;  2E2J H;  4LFB L;  4A3L H;  2E5L L;  4BY7 G;  1HNZ L;  4LUV A;  1AE2 A;  3B5I A;  3G29 A;  3CMA A;  1XPO A;  3KDF A;  4DV3 L;  2B29 A;  3S16 H;  3PIO A;  5JEA G;  2NVY H;  3S2H H;  4U0B A;  4XFZ A;  1JT8 A;  1VQA A;  3GTJ H;  2WB1 E;  3CCE P;  1NJI C;  2UU9 Q;  4LFA L;  4AH6 A;  4IOA A;  2A8V A;  4JI2 Q;  5BR8 Q;  4GOP A;  4KLK A;  2JEA I;  2PY8 A;  1Q12 A;  2CWO A;  2DUD A;  2OWO A;  5IYD H;  4PZ7 A;  2KOD A;  4DAM A;  3CXC O;  1SMX A;  1S72 P;  4GN4 B;  2QEX A;  1YHQ A;  1VQN P;  1QZH A;  2UXC L;  4K0K Q;  3HOU H;  1N9W A;  1OXX K;  4QGU A;  3TS0 A;  1S72 A;  4LWC A;  4IOC A;  2PEM A;  1VQN A;  3M4O H;  3G26 A;  1YIT P;  3EIV A;  1X6O A;  3UDX A;  2ZTE A;  1B8A A;  5M5X H;  4UP9 A;  4POG A;  1XMO L;  2VUM G;  1PA6 A;  4IPC A;  3HZQ A;  1JJ2 O;  2IX0 A;  2M8L A;  2R7D A;  4JI3 L;  4NXN L;  3SGI A;  1S40 A;  1J5E Q;  2E5L Q;  1J5E L;  4LFB Q;  3K80 C;  5BS2 A;  3F2B A;  3CCL P;  3F2C A;  1K83 H;  4LUO A;  1A63 A;  1B7Y B;  2ZM6 L;  1Y1W G;  3TS2 A;  4WJ4 A;  3KYH C;  4APV A;  3ULP A;  3HKS A;  1VQO A;  1PH8 A;  4GLV B;  4QNB A;  3GDE A;  1QVF O;  2R7F A;  5IE8 A;  4PG3 A;  1P16 A;  2JA9 A;  5C3E H;  1YIT A;  2VNU D;  3HOZ H;  2E2H H;  3H0D A;  1J6Q A;  4MTN A;  1NMF A;  4JCV E;  4A3L G;  1D7Q A;  1QUQ A;  4JOI A;  5M3M H;  1V43 A;  2IY5 B;  3BZK A;  5BR8 L;  2HHH L;  4JI2 L;  3HOW G;  1I6H H;  2BH2 A;  4NXM L;  1N8R C;  4NXM Q;  1KXL A;  4R4O A;  4UP8 A;  2JA8 H;  2VQE Q;  2A19 A;  2VQE L;  4JI4 L;  4GR2 A;  1E22 A;  4LF4 L;  1HJP A;  4POF A;  5H1S E;  1YNX A;  3STB C;  1JMC A;  3PSI A;  3GD7 A;  2PEQ A;  3G71 P;  3CPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...