2DGYA

Solution structure of the eukaryotic initiation factor 1a in mgc11102 protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
111
Chain Sequence
GSSGSSGEHIVPSNQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGC11102 protein
publication title Solution structure of the eukaryotic initiation factor 1A in MGC11102 protein
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 10
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.180 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2dgyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2dgyA01
2IX1A 4A93H 2ALYB 4IFDG 1GVPA 4DV7Q 5IY0A 3KYHC 4B3SQ 3K7AH 4JYAQ 4BBSG 4WJ3M 4JI8Q 2ZJRA 1N34L 3CC2A 4MNOA 3Q8DA 5M5XH 1CSQA 1V1QA 1KRTA 4LF9Q 3F2DA 4OX9Q 1N32Q 5IP9H 1MJEA 5C4XG 4EX5A 5FLMH 1XPRA 3W1GA 2WB1E 2YTXA 4IJLA 4IO9A 1VQ7A 4IFDI 1N8RC 2Q2IA 1PFSA 1JJCB 2F3IA 3K80C 4C2MH 3RN2A 2EXDA 2NN6G 4GKKL 1MIUA 3PF4A 1PA6A 4A3DH 3HKSA 2L15A 5FJ8G 1CKNA 3FKIH 2ZM6L 4HJAA 5E7NA 2I5LX 1Z47A 4JI2Q 4BA2I 2E2HH 4JOIC 1JJ2A 1PVOA 1CUKA 1Q8KA 2QA4A 4HIKA 3T1HQ 1TXYA 4BXXG 1XTDA 2OCEA 2NN6I 4X65Q 4JI4Q 2XGTA 3CMAA 2B63G 4GKJL 5LMUL 4X62L 4LF8Q 4LF4Q 4JV5Q 1D8LA 2WP8J 4BY1G 2QEXA 1YHBA 2Z6KA 2BA0A 1SFOH 1HNXQ 4DV2Q 1NMFA 1K73C 1EIYB 4A3GG 1FVIA 1HNZQ 1Y14B 2PI2A 2MFIA 3E9HA 3KJPA 4PG3A 2HHHL 2IHFA 1YHAA 1YI2A 1L1OC 4GLAC 3FHWA 3I4NG 1FL0A 2C35B 1PH4A 3EIVA 1UE6A 3K81C 3CC4A 3GTMH 1EUJA 3J7ZC 1YJWA 4X64L 4DR6Q 1OXXK 4YWKA 2UU9L 1AE2A 3UE0A 2D0OA 3JC66 3PUVA 4A3MG 3TREA 4NXNL 4UY8C 2KCTA 1JB7A 2IY5B 5M3FG 1KIXA 4B3TL 2JA8G 1YITA 3HOUH 3GO5A 4P75A 1X55A 4DR3Q 1HZAA 1M90C 4IPCA 4BBRH 2DGYA 1K8GA 2AMCB 4GNXC 4L5SA 1G291 2R7FA 2VQEL 4A3LH 1T9HA 4MTNA 1XNQQ 3GTKH 2BH8A 2KBNA 2Q2HA 1PH2A 1MKHA 4LFCQ 2HQLA 4UP9A 4LF6Q 5IYCG 1Y1WG 2LSSA 1N33L 3HKZG 5C0XG 1Q1BA 2QGQA 2RCNA 4DUYQ 3T1YL 4L5TA 1UWVA 4GOPC 4JOIA 1OXUA 2EQSA 4A3FG 1YEZA 1V9PA 1YZ6A 4KHZA 4DR1L 1CKNB 5IP7H 2I5HA 4K0KL 1YVCA 5M3MH 5C0XI 3HOXG 4DUZL 1RL2A 4DV0Q 5IWAQ 4OXPA 1Z9FA 4DR4L 1TWGH 2D62A 4EQ5A 5M5WH 1N36Q 3S14H 2UXDQ 4L5RC 3H0GG 1U5KA 3CQZH 4A93G 4H02A 1VQ6A 3GD7A 3STBC 2CWAA 1Q12A 4LFBL 5IE8A 4YWMA 4JBKA 1L1OA 4LF5Q 1DGSA 4R1JA 4A75A 4YY3Q 2OQ0A 4B3ML 4P72A 2MO0A 5GAEC 1XMQL 3PV0A 2K14A 2UUBL 2R92H 5IP9G 3A5UA 4AYBG 2IX0A 3CC7A 3WWVA 5FLMG 2Z0SA 3U58A 3M4QA 4JI3L 1BKBA 2JE6I 4HIDA 4A3CH 4DKAC 2IHEA 4IPHA 4R4QA 5JJLA 4JI7L 3MXNB 3U4ZA 1KRSA 1C9OA 2RHSB 2VQFQ 4DV6Q 3IRBA 3OW2A 3SGIA 3S1NH 1PV4A 4A3DG 2N78A 2PI2E 2NVYH 3FKIG 2ES2A 3OTOQ 4GNXA 2RF4A 3B6YA 4AH6A 3L7ZC 3S1RH 2VL6A 4IPGA 2K75A 4JG2A 1RIPA 3GTJH 4IOCA 3PUWA 3CCSA 1GM5A 1BBWA 1X6OA 5LMNL 4AQYL 2KCMA 3GTQH 2N3SA 2ZJPA 2ASBA 4TQUS 1A0IA 3E9IA 2WAQE 1LTLA 4DR5Q 1E1OA 2CFMA 2JA9A 1XMOQ 1IBLQ 5IYDH 3A5ZB 1HR0L 1IBKL 4GOPA 1SR3A 4DV4L 3HOVH 1P8LA 3FP9A 1SROA 3KF6A 3S24A 1UE1A 4R4OA 3JAMc 1Q86C 2MO1A 2R6GA 3AFQA 1K9MC 4MZ9A 1VQFA 4HJ8A 4LF7Q 1NY4A 2VZAA 3H15A 2JA7H 3CCMA 1HZCA 4PMWA 1A62A 3HOYH 4X66Q 3D31A 3J80c 5ELOA 1IBML 2I0QA 4KLKA 2JEBI 2YV5A 4QGUA 2AWNA 3HOZH 3DLLA 3I4OA 1I3QH 3CCVA 1LM0A 3AYHB 1S3OA 3L2PA 3GTOH 2WB1G 3GTGH 4XIGS 2UXBQ 4LUVA 3TS2A 1WCMH 3HOUG 4DV7L 3RZDH 4B3SL 2E8GA 2GN5A 3F1ZA 1N9WA 3CP0A 4BBRG 3CPWA 4GLXA 1WOCA 3PSIA 2Y0SE 2JK8A 1L1OB 1E22A 4JI8L 4JI1Q 3GTLH 3HOWG 4DK3C 4OX9L 1N32L 4DR7Q 1D7QA 1WYDA 3M7NA 3G71A 2A8VA 1Y1VH 2VS1A 3PUZA 4A3EH 2JJQA 4YHHQ 1KXLA 3K7UC 4HJ7A 5GQOA 2PMZE 4AIMA 4JI6L 2UXCQ 1E7ZA 1VQHA 3NELA 1VCIA 3KJOA 5IP7G 4A4IA 4JBJA 4KHPL 5JEAJ 3UDFA 2JA5H 4IJHA 5M3MG 1O7IA 2E5LQ 3T1HL 2K52A 3ZJYC 3NENA 1PH7A 3L0OA 4X65L 4JI4L 1PHJA 2R7DA 4LFAQ 1KAWA 4LF8L 2H5XA 2YYZA 1GKHA 4YCWA 5J3BA 2YTYA 1Q1EA 5BR8Q 1VQKA 4LF4L 4JV5L 3CPFA 3VDYA 1HNXL 4RMFA 1GD7A 5AJ3Q 4DV2L 4GOPB 3U50C 2HIXA 2LXJA 3KF6B 2JEAI 2KHJA 4ALPA 2UUAL 4BY7H 1CSPA 2F52A 4JI0L 4R4TA 2R92G 3UDIA 2KENA 1SLJA 2CWPA 4R4CA 4NXMQ 3F8TA 1BVSA 4O0AA 3CW2C 1J6QA 2MQHA 4GN5A 4A3CG 4B3RQ 1YJNA 4A3BG 1G6PA 4DR6L 1QUQA 4DR2Q 1H95A 1IYJB 2CQOA 2KHIA 3CCUA 2OTLA 2PNHA 3OYYA 2JA6H 4QQBX 2CKZB 1J5EL 4DAMA 1L2FA 3BU2A 4LNQA 4DR3L 2NVTH 1KC8C 1I6HH 2B3GA 4YCUA 3ER0A 2DUDA 4JC0A 4QJFA 2ZTCA 5FJ8H 1B7YB 4A3IH 1W2BA 4DV3Q 4DNIA 1XNQL 1HNWQ 4FDBA 3NEMA 4LFCL 3CCRA 4A76A 4HIOA 3PO2H 1YIJA 5IYDG 4LF6L 5IYBH 4DUZQ 3J81c 3HOVG 1OXTA 1PH1A 1FGUA 4WJ4A 3M4OH 3F2CA 4DUYL 4DR4Q 4UP7A 1VQ5A 2JA7G 2A19A 1TWFH 3CAMA 2F4VL 1PH6A 1VQCA 3RZOH 1TWHH 3HOYG 2R93H 3BZCA 4LFBQ 1VQJA 2VW9A 3I56A 4DAYB 3HOZG 1LYLA 5HGQA 1VQDA 3CF5A 3MEFA 4DV0L 2YTVA 3PCOB 1JE5A 3GDEA 5IWAL 4DK6C 1N36L 2UUCQ 1I5FA 2UXDL 4DV5L 3BJUA 3I7FA 3I55A 1WCMG 4JI7Q 1EQRA 1L0WA 3S15H 2N49A 1AE3A 3HFZB 1QZHA 1X3FA 1SE8A 4YY3L 1XNRL 2K50A 4LW1A 4DV1Q 1I94Q 4POGA 4JI5Q 4J15A 4QL5A 3TQYA 5C3EH 3PIOA 3S1QH 1Y1VG 2GVAA 3D0FA 2WAQG 4JCVE 1EOVA 4BA1I 4A3EG 1A63A 1VQAA 2VQFL 1FJGQ 4DV6L 2HT1A 1EIFA 2A1AA 1IL2A 2PQAA 3AFPA 5HY6A 3TEHB 1HR0Q 2I5MX 3EBEA 3CD6A 1QZGA 3NBHB 4NB3A 3S1MH 2EIFA 5GROA 1NBWA 2UU9Q 2JA5G 2VUMH 3KOJA 4GN4B 5JJIA 3BZKA 1Q7YC 3I4MH 3M85A 5EAYA 3ULPA 3JAMi 4PZ8A 1JJGA 3TS0A 4IOAA 4JBMA 1VQ8A 3PGZA 4OONA 3CMEA 4DR5L 1N34Q 1VQOA 3UE1A 1GO3E 3E0EA 3ULJA 1X3EA 3J80i 3RLNA 3KFUA 4A3KH 3PO3H 1EWIA 4OWTB 3DM3A 3RR5A 4Y52H 2JQOA 5ELNA 5JEAG 3K8AA 4BY7G 4GKKQ 1HZ9A 2D0PA 1VQPA 1PYBA 4JYAL 4APVA 1XPOA 3GTPH 1KQSA 1HZBA 3A74A 4X66L 2ZM6Q 1WFQA 2Y0SG 4C3JH 4UP8A 4LF9L 1X9NA 4P74A 2OWOA 1I50H 5C44H 1QVGA 3TRZA 3CCJA 4POFA 5LMNW 1PH5A 1SRUA 4QY7A 4R4IA 5IT9c 1S72A 2NZHA 2JA6G 2K5NA 4IPDA 4P73A 1P16A 1E24A 4GKJQ 5LMUQ 4X62Q 4P71A 4GS3A 3I2ZA 3PIPA 2UXBL 3ICEA 3U4VA 1PH3A 1HR0W 1OXSC 3ULLA 1KD1C 2R7ZH 4GNXB 1KL9A 4JI6Q 4JI2L 4JBWA 3S16H 4NXML 4JI1L 4A3IG 1EQQA 3H3VH 3CCQA 2HHHQ 4KHPQ 4IFDJ 1VQ4A 4DR7L 1HH2P 2XTIA 3PO2G 3S2HH 4TVAB 1QVCA 1PYSB 5IYBG 3PUYA 4YWLA 5C4JH 2GVBA 4YHHL 4X6AH 2OQKA 4X64Q 5K36G 4A3JH 1EYGA 4NXNQ 2PQAB 3AQQA 4L5QA 2UXCL 2RHQB 1HNZL 1U0LA 2R93G 1JMCA 3K0XA 4B3TQ 3AEVA 1KHIA 5DLQE 2UUAQ 1NTGA 2E5LL 1K0RA 1NMGA 4HJ5A 2E2JH 4JI0Q 2AKWB 4BBSH 2VQEQ 4A3LG 1UEBA 1AH9A 4LFAL 4GLVB 3EN2A 4PZ6A 5BR8L 5C4XH 3UDGA 4NPSA 5AJ3L 1N33Q 4LUZA 1NJIC 1IZ6A 4OWWB 3M3YH 1XJVA 1HJPA 2MNAA 2BA1A 1VS0A 3T1YQ 1VQMA 1Q82C 1J5EQ 3A0JA 2ATWA 3CCLA 3KDFA 5GAHC 1VQNA 5C3EG 4DR1Q 1CKMA 3CCEA 4B3RL 4K0KQ 3G48A 1VQEA 4DR2L 3HOWH 2ZTDA 3KF8B 1BBUA 1TWCH 4BXXH 3HKZE 2HIVA 2BH2A 1Q46A 1XPUA 2OTJA 3PUXA 4YCVA 1IXRA 4DPGA 2B63H 2FXQA 2NVQH 3W5OA 3CXCA 4BY1H 1K3RA 1VQBA 2E2IH 3J81i 2VUMG 1CKOA 3J81j 3ERSX 3I4MG 2NVXH 3RLOA 4HIMA 2Q2TA 2F4VQ 1R9TH 4A3GH 5JJKA 3RNUA 4DV3L 3RLFA 4OWXB 2AWOA 4B3MQ 1XMQQ 1HNWL 2UUBQ 1PH8A 1A8VA 1B70B 5FLXc 4Y7NH 3I4NH 5GAGC 4A3KG 4JI3Q 1SN8A 1EFWA 3PO3G 1V43A 3PF5A 1M1KC 3LGJA 1UE7A 2B29A 4KI0A 4OO1G 1C0AA 4A3MH 2ZTEA 1K83H 3STBD 1VQGA 4C3IH 4DV5Q 4QIWE 4LF5L 1VQIA 5C0XJ 1TWAH 5M3FH 1K8AC 1WI5A 1X3GA 4ME3A 2JA8H 4HJ9A 1Q81C 3S17H 1VQ9A 2LXKA 1ASZA 1XNRQ 4AYBE 3W1BA 5C44G 1VQLA 5LMNQ 1B8AA 4AQYQ 1YHQA 1E1TA 5GADC 1X65A 3KLWA 5H1SE 1QUQB 1OTCA 2YU9H 2UUCL 3M4PA 4OO1I 1JT8A 3UDXA 4C3HH 4A3BH 2WFWA 1YBYA 4XTCS 1C7YA 1MJCA 1YNXA 4O2DA 5IYCH 2ID0A 3G4SA 4DV4Q 1Y1WH 1IBKQ 1LUZA 3OTOL 2R7ZG 3S2DH 2VNUD 1SMXA 4UPAA 2CCZA 2ZJQA 2Z6KC 3RN5A 4DV1L 1I94L 3G6EA 3M9BA 4A3FH 2IT1A 2N8NA 1WJJA 3KDFB 4LWCA 4RG1A 4JI5L 2Q2UA 3J7A5 2V1CC 1PH9A 1NE3A 1X54A 2AHOB 4PZ7A 1IBMQ 1XMOL 1G51A 1IBLL 1ASYA 1X56A 2NZOA 1W3SA 2K5HA 3HOXH 3F2BA 2K4KA 1FJGL 1QVFA 4A3JG 1E3PA 2K5VA 1OXVA 2VY3A 3H3VI 4LF7L 5M5YH 1S40A 4LUOA 1UE5A 4GN3B 3H0GH 1YJ9A
chains in the Genus database with same CATH superfamily
4IFDG 4R8NA 1D1KA 3G1IA 1EEFD 4WJ3M 4JI8Q 2ZJRA 4MNOA 4OL7A 3HOWB 3I72A 1MHWC 1MJEA 1KABA 5G3LD 4ZK9B 4IJLA 2L1BA 4K8IA 1PFSA 1SYEA 2A6ED 1LACA 2NVXB 2L15A 2ZXRA 3JAML 2G9DA 1JJ2A 3GP7A 2BE5C 2PW5A 2QA4A 3T1HQ 4BXXG 4HCSA 3DEPA 1TY2A 2OCEA 4X65Q 2WPTA 2RCFA 3OIQA 4GKJL 4B08A 1F2MA 1WD0A 3QJYA 4LF8Q 2GZIA 1D8LA 4BY1G 5ELCA 4C3IB 1HCZA 3K57A 5DNFA 1K73C 5M3FB 2FVEA 1FVIA 1X32A 1DV5A 1JOKA 2HHHL 5IGCA 1YHAA 1V1PA 2X2BA 1L1OC 3FHWA 5HGOA 3GZMA 2YU9B 3CC4A 3GTMH 3K5NA 1YJWA 4X64L 4A3MG 1QG7A 2FQ0A 1LTRD 3S2DB 3ERQA 3MFGA 1KIXA 5JEAH 2IPKD 3FPPA 1X55A 3MXGA 2OEOA 4A3FB 4NXML 2PZUA 4GNXC 1G291 3RMHA 1T8KA 3CC2P 2VQEL 5CV7A 1H9KA 3VYSA 5C6AA 1MKHA 3BDOA 3DWPA 5IYCG 1Y1WG 1CK1A 4XFZA 2D5DA 1AP0A 1ML0D 1Q1BA 1PTOF 1A6XA 3QB3A 1EIGA 2AQ2B 1YEZA 1YZ6A 5IIFA 1JOQA 3U9SA 1HTLD 5C0XI 1E2WA 1PDQA 2QILA 3CMAP 2A69C 3Q6SA 3H0GG 3GTGB 1C48A 2D9UA 4A93G 1WD1A 3TDQA 3GD7A 4A3DB 4CJ2C 4YWMA 2CH4W 1L1OA 4JBKA 2CH4A 2E76C 2G5DA 4B3ML 3PV0A 2UUBL 2R92H 4AYBG 1I4GA 2XVSA 5FLMG 1STYA 3U58A 2AQ3B 4LK1C 3I3CA 4A3CH 1O78A 3NTIA 3T13A 2K1BA 2EY1A 2VQFQ 2E1MA 1ZYRC 2PI2E 1EYAA 4GNXA 2RF4A 2ENBA 4JG2A 1RIPA 2CHBD 1LT5D 5LMNL 2JO0A 2SEBD 2P9XA 4X3TA 1PYWD 4K14A 2ZJPA 1FNUA 2KOPA 1EEID 1LTLA 5EPKA 5CBEE 2CFMA 1B9NA 2FVFA 1SSOA 3GV3A 3IFDA 3KF6A 3S24A 4R8IA 3JAMc 4KN7C 1EQTA 4BY7B 3VR3A 4KN4C 4I65A 2SOBA 2QKIC 4Z9CB 5FO7B 3HOYH 2F0EA 3KLRA 4U0CA 1IYVA 3NBIA 2AWNA 1SYDA 3DLLA 3I4OA 4KD3A 3CCVA 1LM0A 4G7HC 3BS1A 1S3OA 3GTGH 2FINB 1TT2A 2NTTA 2E2DC 2N98A 3HOUG 2FVAA 3CPWA 1W2BO 4YIJA 3PSIA 2PMZB 4GLXA 2ZXPA 1VQLP 1Q3LA 3GKLC 4DFAA 3GTLH 3N52A 5D3IB 4OX9L 3QWNA 3G71A 1U9RA 2A8VA 2VS1A 3M4OB 4A3EH 4IUQA 1F9RA 1KXLA 3HEJA 1S4ZA 5GQOA 5CR3A 1WTOA 4AIMA 2UXCQ 3NELA 1VCIA 5IP7G 3A56A 4DAYA 5M3MG 5ELDA 1O7IA 3NENA 1PFBA 2C5CA 3MVVA 2XN9C 2YYZA 5J3BA 2F4IA 4JV5L 4NMZA 3CPFA 1HNXL 1SE3A 4DV2L 3S1NB 2O5JC 1YJ9P 3S9WA 2JEAI 1GUTA 2WV6D 2UUAL 4BY7H 4K6DA 1XYIA 3GTJB 4QCLA 4JI0L 1ONLA 3UDIA 4XYQA 1ET9A 1SLJA 4R4CA 1EZ6A 1BVSA 3F8TA 4O0AA 3CW2C 3Q24A 4GN5A 1CQVA 4A3BG 3FDTA 1TQOA 3CCUA 2KHIA 1BXIA 2B2VC 2JA6H 2N6ZA 3NBHA 1BF4A 2CKZB 1L2FA 1I6HH 4WRDA 4YCUA 1DNYA 4JC0A 3BZDB 4UHPB 4KY7A 5BS1A 1OXTA 3M4OH 3GTOB 1K30A 3HS0C 2JA7G 3OWEB 1TWFH 1STBA 1ESFA 1PRTC 4DG9A 1DOLA 1LTAD 3OMCA 1PH6A 3X3MA 4G7ZC 2R93H 2K2QA 4TKOB 2VW9A 1F2LA 1PXUA 5FOBB 3Q22A 1QVGO 1UEAB 4M1UB 3HOZG 1B3AA 1LYLA 1V1PB 2YTVA 1I4RA 1JE5A 4DK6C 2NBFA 1I5FA 2K94A 1CI3M 1WCMG 4JI7Q 5I4TG 1KTKA 4IZ8A 1SE8A 4YY3L 2CVRA 4DV1Q 1QRJA 5KYIA 2GDXA 1Y8PB 1PTOH 4JI5Q 3G7LA 2M5RA 2A6HD 3PIOA 2JBGA 2HUGA 2QF7A 4ZRZA 1Y1VG 2GVAA 1TY0A 3MWYW 5KRUA 2PQAA 5HY6A 1UJZA 3ZYYX 4NB3A 2AUKA 2JA5G 5JJIA 1GUOA 3M85A 3ULPA 1DJRD 2Y0SB 4IOAA 2KGEA 3CMEA 1N34Q 4C1NI 3KUPA 4UHVA 1IUQA 2K01A 2PEKA 3E0EA 1X3EA 3J80i 2PEIA 3KFUA 2AFDA 3J80E 3OWFA 1EU3A 4GR6A 4KY6A 2EZVA 5JEAG 3K8AA 4GKKQ 1GUSA 3R2TA 2D0PA 1S5BD 4JYAL 1OO9B 1ZXTA 1A2TA 2K93A 1HZBA 2ZM6Q 5C4HA 4C3JH 4N9PA 4LF9L 2I46A 1X3OA 2L22A 4XT3B 2KW2A 5C44H 3TRZA 1TWCB 1NCVA 4R4IA 1S72A 5DEHA 3I55P 5LMUQ 1DYQA 4GS3A 4BY1B 2EE1A 4FO2A 3U4VA 1FGBD 1D5XC 3ULLA 4MN3A 1TWHB 4GNXB 3NE5B 4JI6Q 4JBWA 1K28A 1EQQA 2BE5D 4BPFA 1HH2P 3LRYA 4TVAB 1CEIA 5KEEA 1RODA 2B8GA 4X6AH 3CD6P 4A3JH 2DY8A 4NXNQ 1HNZL 4R0MA 1UNKA 2FACA 2B2UC 2ONTA 1KHIA 4IFDH 2E5LL 1NMGA 1RJTA 1BR9A 2AKWB 2B2YC 5C3EB 2L55A 1NNXA 4LFAL 4GLVB 5BR8L 1L0IA 3OW2O 2PO4A 3MXNA 2EJGC 1IZ6A 5I6YA 4OWWB 1XJVA 2MNAA 1VS0A 5CC4A 3T1YQ 2EG5A 3E2DA 1VKUA 2ATWA 4HSVA 4O1NA 5TSSA 2F0NA 3CCLA 5J1ZA 1VQNA 1CKMA 1Z6HA 3A55A 4DF7A 1VQEA 1CA6A 4C1NK 1TWCH 3NQIA 1KC8Q 4BXXH 5ISRA 1EY6A 2HIVA 4A3KB 3ITPA 1M74A 2OTJA 5M5YB 3W5OA 4BY1H 1VQBA 4KK7A 2PZWA 4A93B 1HA5A 3GTPB 1KNEA 3RLOA 1Q90A 4HIMA 5JJKA 3FVQA 3RNUA 4OWXB 1XMQQ 4MRTC 1A8VA 1B70B 1SBBB 3E5SA 3CHBD 5GAGC 2A69D 4RA8A 3PO3G 1E0BA 3PF5A 1L0HA 3A7LA 1EIHA 4C2MB 4OO1G 2B2UA 4A3MH 2K6AA 1VQGA 2Z45A 3S16B 1VQIA 5C0XJ 4F7XA 3BVMA 1JJ2O 2B2YA 1B44D 4ME3A 4HJ9A 1Q81C 1VQ9A 2LXKA 1ASZA 2MVUA 2EVBA 3W1BA 2DNWA 4AQYQ 4ULLA 2NO8A 5GADC 2XT1A 3KLWA 5C4JB 2UUCL 2X69A 1I4HA 1ZYRD 4XTCS 1Q81Q 1AW7A 1MJCA 2K7VA 5IYCH 1Y1WH 2ID0A 2CCZA 1QNKA 1BCPF 4DGZA 4HMJA 1RCVD 3M9BA 2IT1A 2Q2UA 3CCRP 1SNDA 1NE3A 4PZ7A 2AHOB 2H1EA 2LF4A 1IBLL 3GQBA 1W3SA 2WIIB 1AEXA 1E3PA 5M5YH 1S40A 2HCCA 1S5ED 2PNGA 3DS1A 3H0GH 3HRZC 4A93H 5G3LF 4DV7Q 5IY0A 3KYHC 1STHA 4B3SQ 3K7AH 4U0AA 1VF5C 2RVLA 1NR2A 2LFNA 1GPJA 1V1QA 5EKLA 3URYA 3GTKB 3F2DA 1N32Q 4U0BA 4UDUC 2F0VA 2L9FA 5FLMH 2EYOA 3W1GA 2WB1E 2YTXA 1VQ7A 4IFDI 1I4QA 1N8RC 1CA5A 4C2MH 2E2IB 4CJ0B 3QOLA 3SK8A 3DMUA 4RHRA 4A3GB 2KVMA 4KJNA 3R8BA 5IT9E 2I5LX 4BA2I 5HVCA 4FP5D 1N8RQ 2GZEA 1Q8KA 4HIKA 2F0GA 1PFNA 1XTCD 3J80L 2XGTA 1RF2D 2B63G 4X62L 5CGKA 3EJIA 3SR1A 2PPBC 1K83B 2BA0A 1NMFA 3A8IE 1EIYB 5T1IA 4F8MA 4U0EA 3U9OA 4QF4A 3E9HA 3KJPA 1A43A 1YI2A 3MAQA 2ZXOA 1UE6A 4DR6Q 4A3BB 4RAUC 1CTMA 5D14A 3TREA 3HKZB 3NSWA 2KR5A 2KCTA 2BDNA 2XWJB 4DNTB 4B3TL 2JA8G 2K33A 1YITA 3EQLC 3HOUH 3GO5A 4DR3Q 1HZAA 5A35A 2AMCB 4QKOA 2L0CA 3GTKH 4MTNA 2JGPA 2J4XA 1K3BC 4H2WC 4CDEC 4DUYQ 2BUOA 4L5TA 1UWVA 2VB3X 3OMGA 1M6NA 5IP7H 1ZKOA 2I5HA 3M7GA 4K0KL 4XROA 1L0YB 2QA4P 2DNEA 5M3MH 3HOXG 3W2DA 4KMUC 4ZQ3A 2DY7A 4OXPA 5F2OA 1Z9FA 1TWGH 1N36Q 4KV6A 5KIXA 4JPBW 2UXDQ 4CA3A 3HZQA 1U5KA 4H02A 1PRTD 3CPWO 1VQ6A 4XDXA 1Q12A 4LFBL 5IE8A 2O4XA 2WKDA 4LF5Q 4C3JG 1DGSA 1SEBD 4A75A 3V05A 4P72A 2MO0A 1IKMA 1BBXC 3A5UA 3C46A 1EZ8A 2N6YA 5AFWA 3CC4P 1BKBA 4FF2A 4HIDA 1YJWP 4DKAC 4IPHA 1BCPB 2KG9A 4R4QA 4H2YC 3MXNB 3OW2A 3IRBA 2MJ8A 3PQIA 3M4YA 1V8QA 4QNBA 3G26A 3OTOQ 4M0IA 2M8NA 2SDFA 3B6YA 2K75A 2JA5B 4IOCA 1GXDC 1CM9A 3GTQH 1B9MA 2HD3A 1D1IA 4TQUS 5EQ0A 4RWSC 1E1OA 1JQYD 2BOSA 1XMOQ 3A5ZB 1IBKL 2KEDA 1SR3A 2KGCA 1P8LA 2OF1A 3HZXA 2LY7A 1ILPA 1F9QA 2MO1A 1BUVT 4LF7Q 2JA7H 1VQFA 5C3XA 4HJ8A 1NY4A 2VZAA 5E4WC 3IL8A 4HSPA 2NUCA 4X66Q 2LIWA 2JU2A 4F37A 5J39A 3J80c 2A5HA 4KLKA 2JEBI 2YV5A 1SYCA 4TSSA 3HOZH 5ELFA 1I3QH 1G2SA 4KTAA 2TSSA 2GZFA 3L2PA 5EJDA 5EGTA 2WB1G 3OOCA 2OARA 4LUVA 4BWGB 1WCMH 1ICWA 2E8GA 4BBRG 3F1ZA 1N9WA 1IYUA 4JI8L 4JI1Q 1NUCA 1HUNA 4DK3C 3CE7A 1G8ZD 4HEDA 3PIO3 3M7NA 1Q8IA 1Y1VH 4RCOA 1ICFB 4YHHQ 4HJ7A 2JYOA 3D3RA 2L4NA 3A8KE 1TKWB 3T51B 3NTHA 2F0WA 4IQZA 3KBXA 3RZOB 2K5DA 1F80D 4A4IA 4KHPL 2JA5H 2R92B 1SJED 2R3ZA 4ID6A 2Z1CA 3T1HL 3ZJYC 3D4DA 1K73Q 4X65L 4EQPA 2R7DA 4LF8L 4YCWA 5F2NA 2KG6A 1O7ZA 1Q1EA 2YTYA 1QNUA 2RBMA 3IFTA 3VDYA 1GD7A 5AJ3Q 1PZID 2FHSC 1EMVA 5IT9L 5CMDA 1EYDA 1E6JP 3J7YW 4R4TA 2F0HA 3A8JE 3G21A 3FRPB 4B9XA 5HV8A 4PH1A 4U673 4NXMQ 2MR8A 4B3RQ 3OSOA 2RDFA 1QUQA 1CHQD 4DR2Q 4PMBA 3CCVP 3H94A 2OTLA 3ND8A 1RO2A 3HP3A 2Z4HA 5LL6X 4G57A 4DAMA 1QILA 1GXHA 4KD4A 3MGEA 5HGTA 3HOYB 3ER0A 2DUDA 2LMCB 3B5IA 1LT4D 4QJFA 2PENA 4DV3Q 2PCFB 3NWSA 4A76A 4HIOA 1B3QA 4OIJA 5IYDG 3G71P 3HOVG 3LX0A 4WJ4A 3PO3B 1VQ5A 2A19A 4CDCC 2F4VL 1STNA 2LPKA 5JJZA 2XZ1C 1VQCA 3RZOH 1JE4A 4K2LA 3BZCA 3GTLB 5HGMA 4XYOA 1VQDA 1SJHD 4F87A 4XFYA 4F88A 3GDEA 1SYGA 4A3EB 1ILQA 5KGUA 2F0MA 2WINB 3I7FA 1EQRA 4PH0A 2ICEC 1L0WA 2N49A 2F03A 5CV9A 3T16A 4MHEA 4QUFA 4CKEA 2JN4A 2MPMA 1I94Q 3SEBA 2JYGA 4POGA 2EHTA 2CQAA 4CKCA 2M9VA 4J15A 2L4BA 3VYUA 3CCUP 2HDLA 1EOVA 5ELBA 1VQAA 2VQFL 1FJGQ 1EIFA 2JXMB 2PY8A 1QZGA 4HKGA 3S1MH 2EIFA 5HGNA 1CQFA 1Q7YC 5IODA 4PZ8A 4OONA 1VQOA 1TVXA 3UE1A 1EL0A 1UNSA 1YNNC 2JA6B 3RLNA 1Q7YQ 1T5XD 3PO3H 1HY8A 5FO9B 5M9OA 4Y52H 5ELNA 4MIUA 2B8FA 5C3WA 4OO1H 1VQPA 1I6HB 1XPOA 1D5MC 2PEMA 1R4QB 4IPYA 1TS4A 2EDGA 4P74A 3TZDA 1I50H 1RKNA 3CCJA 4POFA 5LMNW 2ROQA 4CGYB 5IT9c 2NZHA 4IPDA 2A68C 4P73A 1E24A 1TWFB 3ICEA 1W6JA 5ELEA 1OXSC 1ENAA 4GZYC 1KL9A 2R93B 4JI2L 1KLGD 4MTKA 4A3IG 3HGBA 1GHJA 4IFDJ 1VQ4A 2EXZA 2F0SA 3PO2G 1PMRA 1QVCA 1PYSB 5IYBG 1AZQA 4KY5A 1QCBD 2KCCA 3PUYA 2J7ZA 2MR7A 4X3SA 1EYGA 1SAPA 2UXCL 2UUAQ 1NTGA 1EOTA 1QWYA 3RD4A 1PTOB 4HJ5A 2E2JH 4JI0Q 3A7AB 3CMEP 3UI2A 2RQXA 2EFJA 3K58A 1AH9A 4K5VA 3UDGA 3H4EA 4NPSA 1N33Q 4LUZA 1NJIC 2QNWA 3M3YH 3PIP3 2PYKA 2BA1A 5JVG3 3K59A 1FYCA 1GHKA 5GAHC 2HDMA 4DR1Q 3CCEA 1ACPA 2ICIA 1S5CD 4M8AA 4RKBA 1S72P 4CKBA 2HCIA 3HOXB 3EA6A 1W6KA 3D6WA 1XPUA 3PUXA 4YCVA 1IXRA 2B63H 5BN3A 2EYHA 2NVQH 3CXCA 3H0DA 3TMEA 1MZ8A 2VUMG 1O7LA 2L11A 3ERSX 3I4MG 2Q2TA 4WFN3 1A3UA 1R9TH 3SK4A 2PQEA 4C3JB 3RLFA 1E0HA 4V190 4RGNA 5C44B 2L9HA 3EJBA 3T56B 4L8JA 2FQ2A 3EFXD 4JI3Q 5CV6A 1M1KC 2B29A 2IL8A 3AMUA 1CFMA 1EU4A 1TWAH 1K8AC 2JA8H 4U68A 2E2HB 3BDLA 1NR4A 2EY2A 1D2BA 1VQLA 1B53A 1A3VA 1I4PA 1X65A 4OO1I 1JT8A 1QUQB 1LTSD 2AUJD 2VLPA 2KG8A 1K8AQ 3X3NA 2AF8A 1YBYA 4A3JB 2EYFA 1IMQA 1YNXA 2XRSD 3S17H 4DV4Q 4RFBA 2VNUD 3KBGA 1SMXA 4UPAA 2ZJQA 2P5ZX 2Z6KC 3RN5A 4DV1L 3CCLP 1EQVA 1VQNP 3G6EA 4JI5L 4RG1A 3J7A5 1PH9A 1IW7C 1AFPA 1IKLA 1YIJP 1LV9A 1X54A 1IBMQ 4L63B 3S15H 1G51A 3D8GA 3EROA 3HOXH 2M2LA 2OTJP 2VXWA 2XXMA 1BCPC 2F3WA 1UE5A 2WB1B 5E7NA 1YJ9A 2IX1A 5EW5E 4K2KA 3I56P 4JYAQ 2Q8TA 3TP8A 1YNJC 1N34L 2QCPX 1CSQA 5M5XH 1KRTA 4LF9Q 3CRLC 3TSSA 5C4XG 1XPRA 3BVGA 4IO9A 2Q2IA 3RN2A 4GKKL 2NN6G 5FK9C 4B9WA 3PF4A 3BYYB 3MXUA 1PA6A 3FMCA 1RHPA 2ZM6L 4CJ1B 3V96A 2E2HH 2RSNA 1GUWA 1M8AA 1TXYA 3VYRA 1KLUD 4JI4Q 5LMUL 5I4DA 4LF4Q 4I7AA 4A3MB 2QEXA 2Z6KA 3CQZB 1SFOH 1EIAA 4XXEA 2MP1A 1HNZQ 2PI2A 3U43A 4PG3A 4RKLA 2EYPA 1VQ8P 4OGQC 1HA6A 3RUZA 2LMLA 3LWUA 1FL0A 2C35B 3EIVA 2RDGA 1SE4A 1B2TA 4YWKA 2UU9L 3UE0A 1Y1WB 5J22A 1SXTA 4KKSA 4NXNL 4C3IG 2F0PA 4BPHA 4RGTA 2NVYB 5M3FG 1F9SA 4FF4A 2KOQA 4P75A 1M90C 4L5SA 4X3UA 2DGYA 2JAZA 4BBRH 2FMMA 2R7FA 2K0DX 1JICA 4EQOA 3P1HA 5CORA 1LTTD 4C3HG 2BH8A 4XQQA 1PH2A 1HPCA 2Q2HA 4LFCQ 1XNQQ 2HQLA 5KNBA 4LF6Q 1VQ7P 3WOEA 1Z7TA 1M90Q 1ESRA 2RCNA 3H0GB 3T1YL 3E3XA 1GJXA 3LNNA 3H6MA 5IOCA 3K7AB 2MHVA 4A3FG 3CCQP 1AF8A 1LTGD 1CKNB 2Z6BA 3OHXC 1A2UA 1U4RA 1PRTF 5JPNC 1MSGA 2XIWA 4AYBB 4DUZL 2KECA 4DV0Q 2K5WA 5IWAQ 4DR4L 4EQ5A 5M5WH 2KA7A 3S14H 4L5RC 3CQZH 5FLXE 3STBC 1KQSO 5COYA 2OQ0A 5GAEC 1XMQL 4K6LA 3HYBA 1YI2P 3NUCA 5IP9G 4ZUIA 2IX0A 3CC7A 3WWVA 2Z0SA 4H44C 5L37A 2IHEA 1AN8A 1PZKD 2ZT9C 2FAEA 5JJLA 5C5LA 2F0DA 4IN3A 2EYLA 3U4ZA 4NKLA 2GZGA 4DV6Q 5CV4A 1PV4A 4A3DG 2N78A 2NVYH 3FKIG 1YITP 3BG3A 3S1RH 2E74C 4IPGA 3CCSA 1D5ZC 1BBWA 4AQYL 2KCMA 2N3SA 3Q20A 2WAQE 2M8LA 4DR5Q 2JA9A 3W3AA 1DD2A 1IBLQ 5IYDH 1HR0L 3HOVH 1F2ZA 3FP9A 1QE6A 4KJOA 2K03A 2RDHA 2R6GA 4R4OA 1Q86C 5KNCA 4MZ9A 1K9MC 3H15A 3HOUB 3CCMA 4ZKBB 5DM73 4O42A 5ELOA 2MD9A 3EVQA 2A73B 1YNND 1HFNA 3QOJA 1K9MQ 4KKTA 3H47A 2KJXA 3AYHB 2F0JA 2KQ3A 2LKIA 2N50A 3KLSX 1VQ6P 2UXBQ 2F0QA 3NY7B 4DV7L 3RZDH 1H9MA 4B3SL 2NVTB 1HRJA 2GN5A 4A3LG 1AUMA 4DXFA 2Y0SE 2JK8A 5M3MB 1N32L 1YHQP 2I07B 4S3SA 5I9PA 4DR7Q 3PO2B 4ME5A 2EPBA 1TWGB 2A68D 3NTKA 3G4SP 2D2CC 3T53B 4DAVA 3VR2A 3P05A 1VQHA 3KJOA 1B1ZA 2B2TC 1GOZA 2EYMA 2VLNA 5JEAJ 3UDFA 4U0FA 4IJHA 4IUNA 1H9RA 1BNZA 5E1FA 1M6EX 2K52A 3SE0A 3L0OA 4C56C 5IGFA 3I90A 1KAWA 2H5XA 5BN5A 1GKHA 1VQKA 3ND9A 7CEIA 4N8X1 4GOPB 5EBCA 1VMPA 4FNFA 2KHJA 3SXHA 4CDDC 1CSPA 2F52A 3VR6A 1U4PA 1X3PA 4EGVA 3CRKC 2KENA 1E2ZA 4RH6A 3GTQB 3QIAA 1RTNA 1J6QA 1YJNA 5I2YA 4DR6L 2N5IA 1IYJB 2PNHA 3OYYA 1JC7A 1O7YA 2JA7B 1J5EL 2KOSA 3DXJC 4LNQA 1K0SA 4DR3L 2NVTH 2VUMB 2XSCA 1C4QA 2B3GA 3B4QA 3J7AV 2MVVA 2N5HA 2ZTCA 3K6OA 1B7YB 5FJ8H 4A3IH 1Y8NB 4DNIA 3HOZB 1HNWQ 4FDBA 1PTOC 3CCRA 3PO2H 1I3QB 1DXMA 5IYBH 4CBVA 4BS9A 1PH1A 1FGUA 3I73A 3F2CA 1DOKA 3MXPA 4DUYL 4ABNA 4UP7A 2B2TA 1WCMB 1G6ZA 1Y69U 4LFBQ 1WTVA 1VQJA 4XRQA 5HGQA 3CF5A 4X3KA 5F2KA 2R61A 1S5FD 4HMIA 1N36L 1Y1VB 2KOOA 1E2VA 2UXDL 4I7ZC 4DV5L 1QB5D 2JSOA 3MC0B 1EY8A 1QZHA 4PWVB 4HN7A 4OHJA 5JVH3 1XNRL 2K50A 3C1FA 3S2HB 1SMYC 3L3OC 3S1QH 2XRQD 3D0FA 2WAQG 2VLOA 2OTLP 4JCVE 1A63A 1DOMA 5FLXL 1IL2A 2JB0A 1CHPD 2I5MX 4OELB 3K5OA 3DS5A 2N55A 5GROA 2UU9Q 2VUMH 4GN4B 4ZKCB 4FYDA 2KGAA 3I4MH 1EOQA 5EAYA 1IW7D 1JJGA 2C9OA 3TS0A 1DZ1A 3ULJA 5C4XB 1BCPD 5EPJA 1VQ5P 2KUMA 3DM3A 3RR5A 2RSOA 2JQOA 2KEEA 1RDPD 1KQSA 2JYLA 4X66L 1YNJD 3G29A 1WFQA 4HCEA 1TR5A 2FQ1A 2Y0SG 4DNRB 2OWOA 5I6WA 1PH5A 1HHVA 1SNPA 4QY7A 3CXCO 4GKJQ 1P16A 2KORA 2Z8LA 3I2ZA 1WTHA 2F0UA 1PH3A 2LKVA 1KD1C 2KGDA 1XX8A 3L9AX 4JI1L 4G7OC 3TN2A 1SE2A 3H3VH 2B2WC 2HHHQ 4KHPQ 4QUCA 3S2HH 2M8PA 4WJWA 2MY5A 5EKIA 2VB2X 1A8OA 1KD1Q 1JOOA 4YWLA 1KLPA 3N6RA 4YHHL 4X64Q 4JVZA 2NYZD 5KP8B 4IURA 5K36G 3MHBA 3AQQA 2V4DA 2RHQB 1U0LA 1JMCA 3K0XA 2EY6A 3ONAB 3AEVA 1LT6D 3CKIB 4E6IA 3HG9A 1PZJD 2Q8IB 2IJ0A 2VQEQ 4RGOS 1VQOP 1AZPA 3EN2A 4C3HB 2LTEA 5C4XH 4XQNA 3D4RA 5AJ3L 1K8MA 3OW7A 1WTPA 1KDAA 2K0YA 3S1MB 1VQPP 2NN6H 1VQMA 1Q82C 4EQNA 3R3OA 4J1MA 3O13A 1F77A 3TZUA 5C3EG 3SK5A 4B3RL 3MEHA 3TP5A 4DR2L 3HOWH 3CCJP 2ZTDA 5JPAA 1HFGA 1BBUA 5I2XA 2DJFC 3HKZE 1Q82Q 1D1DA 2BH2A 4DPGA 4DK0A 2JP1A 3J81i 1CKOA 3Q0AA 1IMPA 2B2WA 2NVXH 3J81E 2F4VQ 3D4WA 4WORA 1VDZA 1VQ4P 4DV3L 4B3MQ 2UUBQ 2QDLA 1I50B 1F9PA 1MSHA 2X6GA 5FLXc 4K5XA 2GDWA 2F0FA 3WOFA 4ZAIA 3G0VA 4A3KG 1SN8A 5C5MA 5EPLA 3LGJA 1JCKB 1FR2A 4KI0A 1C0AA 3NK9A 1Z6MA 2ZTEA 3STBD 4C3IH 4QIWE 4ZUJA 3QG1A 4PXHB 2JQ4A 5KP7B 5M3FH 3FKIB 1WI5A 2QEJC 2LS01 3VRLC 1RNIA 1F2YA 2EHSA 5LMNQ 1B8AA 4K5WA 3P75A 3DS2A 1E1TA 1OTCA 2IW3A 2YU9H 3M4PA 3VYTA 3D6CA 3UDXA 4C3HH 2X6LA 1JR0D 3A54A 4R9WA 2FJ2A 5IGGA 2R7ZG 1BOSA 1LUZA 3S2DH 3GZLA 1EFID 1S5DD 1I94L 5EKKA 1CT1D 4BPGA 2E2JB 4OIKA 3CCEP 1UUPA 1T5EA 1WJJA 3KDFB 1BO0A 4A3FH 1ZNVA 1PFMA 2V1CC 5DAUA 1NSNS 3RG2A 1X56A 2NZOA 1QVFA 2K5HA 1FJGL 4NEOA 2K4KA 2K5VA 1KDCA 3M3YB 3OIPA 1VF7A 5C4ZA 4LAAA 3H3VI 4N8FA 3I91A 5I9OA 2ALYB 1GVPA 5IGEA 1DM0B 4QMGA 4BBSG 5FO8B 4DXGA 4G4KA 4IALA 5KNDA 3CC2A 3Q8DA 4OX9Q 3LMOA 5IP9H 4ZYSA 1GUNA 4EX5A 2RKSA 4DAPA 4COCA 1GXGA 2B63B 5E4XA 2NVQB 1JJCB 2F3IA 3K80C 2EXDA 1MIUA 3SDZA 1EY5A 1R9TB 3HKSA 4A3DH 5D3DA 5FJ8G 1CKNA 3FKIH 5LL6S 4HJAA 3C2PA 1Z47A 4JI2Q 2Z46A 1HQBA 4JOIC 1PVOA 1CUKA 1ZEQX 4U0DA 3VR5A 5DM63 2KODA 2KHSA 1XTDA 2AQ1B 1HQMC 2NN6I 4DA2A 2MUYA 3CMAA 1H9SA 3E0JA 4PMCA 4JV5Q 2WP8J 4ILWA 1YHBA 2CG5B 1HNXQ 2F3VA 4DV2Q 4A3GG 4H13C 1TWAB 2IWHA 1Y14B 2JA8B 1STAA 2MFIA 3G6EP 3WDNA 3I8ZA 2IHFA 3I4LA 3K5LA 4GLAC 3I4NG 5BN4A 1PH4A 3K81C 2Z9HA 1EUJA 3J7ZC 4RGMA 1OXXK 1AE2A 2D0OA 3JC66 1SNOA 3PUVA 3S17B 2QDBA 1UAPA 1M4VA 4UY8C 1JB7A 3DPHA 2IY5B 5A2QE 3VA7A 1MBYA 4RCNA 1ZMBA 4HAEA 4IUVA 4IPCA 1K8GA 4A3LH 1ENFA 2SNSA 5LHY1 2EJFC 1NJIQ 1WTRA 2L6EA 1T9HA 3S15B 2KBNA 3DM1A 4UP9A 1N33L 2LSSA 3K0YA 3HKZG 5C0XG 3MFYA 1MGSA 2QGQA 2K92A 4GOPC 4XFXA 1MD2D 1STGA 4JOIA 1OXUA 2EQSA 3J7AF 4KHZA 1V9PA 4DR1L 1OR5A 1IL8A 4IZ6A 5M5XB 1PTOD 1YVCA 2CW0C 1RL2A 4K8JA 2D62A 2QEXP 4OEMB 1CZWA 2OXPA 4ZLTF 1BAJA 2AFEA 4NW2A 2VLQA 2G9HD 2O2LD 2CWAA 4V0BA 2BHVA 2GYKA 1KDBA 3SK6A 4R1JA 4YY3Q 1M1KQ 2K14A 1KAAA 2M00A 3TBIB 3GJNA 3GV6A 3M4QA 4JI3L 2K32A 3SHLA 2JE6I 4IUTA 4JI7L 2WAQB 1KRSA 1C9OA 2RHSB 1SFOB 3SGIA 3J81L 3S1NH 1AYIA 1EYCA 1STEA 2ES2A 2LIUA 4AH6A 1ET6A 3L7ZC 2VL6A 3C3LA 3GTJH 3PUWA 1GM5A 1X6OA 2L5TA 4ZCKA 4XQJA 1SMYD 4KHVA 2E75C 2ASBA 1A0IA 3E9IA 2B2VA 1EY4A 1GUGA 1HXYD 1Y8OB 3QR8A 5HGLA 4GOPA 4DV4L 1SROA 1UE1A 3G6JB 3AFQA 2GZJA 5CBAE 2PEJA 2CGQA 4PV1C 3MA2B 1HZCA 4BBRB 1EY0A 4PMWA 1A62A 2H4OA 3D31A 1B4OA 1IBML 2I0QA 1K8OA 3H3VC 4QGUA 5JPMC 3BVZA 1SYBA 3H09A 1BDOA 3FEWX 2Z44A 1RTOA 3GTOH 1VHNA 4XIGS 2A6EC 3TS2A 1BQQT 5DCKA 3C1EA 2BDOA 1VQ9P 3CP0A 1WOCA 1L1OB 1E22A 3H91A 3NQTA 3HOWG 3CC7P 3G1GA 4ODGA 3KF8A 1D7QA 2ERHA 1WYDA 3S14B 1SYFA 5M5WB 3PUZA 2JJQA 1XWEA 3K7UC 2O5IC 4DN4M 4CHTB 4NP5A 2PMZE 4JI6L 1E7ZA 2EJMA 1NQ4A 4JBJA 1WTXA 5CV5A 1LT3D 4DU9A 3CCSP 1MI2A 2JU1A 1D6EC 1IHZA 2F1MA 1TIID 2E5LQ 1J9OA 2FADA 1PH7A 4KKUA 2PEOA 4JI4L 1PHJA 2EYJA 4LFAQ 4LF4L 5BR8Q 2XZ0D 4PNYA 2RA4A 4RMFA 5EJWA 3U50C 2HIXA 2LXJA 5E3FA 3KF6B 2IX3A 4ALPA 1TS5A 5KYLA 3S1RB 3CCMP 2PZTA 2EY5A 3AB9A 2R92G 1JWUD 2CWPA 2MQHA 4A3CG 1G6PA 1EY7A 1FD7D 1O80A 1H95A 2K0XA 2NZ1D 2CQOA 5K5PA 4Q5VA 3HOVB 3P20A 2A74C 3TP7A 4QQBX 3NTEA 1RO0A 1H9JA 4EVOA 2K04A 3BU2A 1KC8C 2KWLA 5KP6B 3Q23A 1JB3A 1W2BA 1U4MA 1XNQL 2PW7A 3NEMA 4LFCL 1WVLA 3VA5A 1YIJA 4LF6L 4DUZQ 3J81c 3IKJA 1H9SB 5A2QL 4DR4Q 2F0TA 5CV8A 4HR7B 3CAMA 5K36H 3DWQA 2K05A 3NWTA 3RZDB 2SNMA 5JOBA 3T4AC 5IGBA 1TWHH 3HOYG 2PEQA 2L12A 5HURA 3F2UA 3I56A 4DAYB 1SNMA 5T1GA 1PLFA 2CNRA 3MEFA 4DV0L 1DONA 3PCOB 5EBDA 5IWAL 4J8QA 2UUCQ 1VQKP 4IUUA 1SNCA 1TS2A 1G91A 2WKCA 1KNAA 2XNAC 3BJUA 3I55A 1I4XA 1I6VC 2XV6A 3IAYA 2R7ZB 4H2XC 1AE3A 2Z4IA 3HFZB 1X3FA 3FPUB 4LW1A 1VMCA 2FHTA 4QL5A 3TQYA 1YJNP 5C3EH 2BCOA 1CZGA 1HUMA 1NAPA 3PMFA 1EY9A 1U4LA 4BA1I 4A3EG 3EJEA 2HT1A 4DV6L 2A1AA 2EIAA 3NP8A 3AFPA 3CD6A 3TEHB 5NUCA 3EBEA 1HR0Q 1QOHA 2GDYA 2XWBB 3NBHB 2NTSA 1NBWA 4HTHA 1LTBD 3KOJA 2FMCA 1C8CA 3BZKA 2HQEA 3G28A 3DHQA 1JWMD 4RHSA 3JAMi 4BBSB 3JAME 4JBMA 1VQ8A 3PGZA 4GR2A 4LMQD 4DR5L 1Q86Q 2K28A 3MZ5A 4FXGC 1GO3E 1J8IA 4A3KH 2DNCA 4IUPA 1EWIA 4OWTB 1V1OA 2CWOA 4BY7G 3DS4A 1HZ9A 1PYBA 3K5MA 4APVA 3GTPH 3V2TA 3A74A 4A3IB 3KK7A 1A15A 4UP8A 1X9NA 2NB0A 1QVGA 4FF1A 4COPA 1SRUA 2JA6G 1LLRD 4FVMA 2K5NA 3DWAA 2DJGC 4X62Q 4P71A 3PIPA 2UXBL 5IGDA 4FXDA 5JAVA 4TRDA 1G2TA 1WTWA 1HR0W 2R7ZH 3S16H 4N9TA 3CCQA 4DR7L 2XTIA 4Y7NB 3I4NB 4P2CB 5C4JH 3OPOA 2GVBA 4H7BA 4FF3A 2OQKA 4QB4A 2PQAB 2K5XA 4L5QA 2AVAA 2MF4A 2R93G 2FFKB 3DS3A 4UAIA 3EJDA 4B3TQ 1BXTA 2KOLA 5DLQE 2QW7A 3M1MA 3RG6C 1K0RA 2LOLA 2MGSA 3BYTB 4BBSH 2NWGA 3S1QB 3AU7A 1UEBA 1QJOA 1SNQA 3E6ZX 2F0OA 4NDXA 3CU7A 4J6HA 4PZ6A 2F0IA 3TP6A 3MTSA 1XXGA 1PRTB 1HJPA 2DN8A 1ENCA 4H0LC 2TMPA 1R4PB 3QO2A 4JW0A 1J5EQ 1A3TA 3A0JA 3I4MB 1JWSD 3KDFA 4WYMA 1EWHA 2KCNA 4K0KQ 1QVFO 3G48A 2J0TD 3NHHA 4PQXA 3KF8B 1II3A 3WBHA 2N88A 2F0LA 3KLSA 1WTQA 1Q46A 2FXQA 4CDFC 1K3RA 3NXWA 2E2IH 2L0QA 3J81j 3P7JA 4A3GH 3BDCA 4QIWB 3DS0A 2AWOA 2CW0D 1HNWL 1PH8A 4XT1B 3SVMA 3I70A 1HTPA 4FXKC 1FR3A 4Y7NH 3I4NH 1SDFA 5D65A 2EOTA 1EFWA 1V43A 2Q8RE 1UE7A 2K5QA 4DV5Q 1K83H 1FNVA 4LJZC 4LF5L 1RD9D 5BS2A 1X3GA 1B50A 3DEOA 1XNRQ 4AYBE 1FNWA 2VSQA 2OT2A 4DK1A 5C44G 1JORA 3R93A 1YHQA 4JK1C 5H1SE 1HQRD 2A6HC 2PNRC 4L6TB 5CYUA 5FKAC 4A3BH 2WFWA 3DTJA 1C7YA 1LABA 3G4SA 4O2DA 1IBKQ 2F0KA 3OTOL 5C0XH 1VQMP 1X3QA 3DUZA 1DCZA 3NPPA 2B39A 2N8NA 4LWCA 1EWCA 1LTID 1L0XB 5CZDB 1LO5D 1XMOL 2CQ8A 1ASYA 2GA4B 3F2BA 5F2DA 3LWEA 3R2IA 3GTMB 3VR4A 4A3JG 1TU2B 1TS3A 1OXVA 2VY3A 4Q0FA 4LF7L 4LUOA 2WACA 4GN3B 2LL8A
chains in the Genus database with same CATH topology
4IFDG 3G1IA 4WJ3M 4JI8Q 2ZJRA 4MNOA 1MJEA 4IJLA 1PFSA 2L15A 1JJ2A 2QA4A 3T1HQ 4BXXG 2OCEA 4X65Q 4GKJL 4LF8Q 1D8LA 4BY1G 1K73C 1FVIA 2HHHL 1YHAA 1L1OC 3FHWA 5HGOA 3CC4A 3GTMH 1YJWA 4X64L 4A3MG 1KIXA 1X55A 4NXML 4GNXC 1G291 2VQEL 3CC2P 1MKHA 5IYCG 1Y1WG 4XFZA 1Q1BA 1YEZA 1YZ6A 5C0XI 3CMAP 3H0GG 4A93G 3GD7A 4YWMA 4JBKA 1L1OA 4B3ML 3PV0A 2UUBL 2R92H 4AYBG 5FLMG 3U58A 4A3CH 2VQFQ 2E1MA 2PI2E 4GNXA 2RF4A 4JG2A 1RIPA 5LMNL 2JO0A 2P9XA 2ZJPA 1LTLA 2CFMA 3KF6A 3S24A 3JAMc 3HOYH 4U0CA 2AWNA 3DLLA 3I4OA 3CCVA 1LM0A 1S3OA 3GTGH 3HOUG 3CPWA 1W2BO 4GLXA 3PSIA 1VQLP 3GTLH 4OX9L 3G71A 2A8VA 2VS1A 4A3EH 1KXLA 5GQOA 4AIMA 2UXCQ 3NELA 1VCIA 5IP7G 5M3MG 1O7IA 3NENA 5J3BA 2YYZA 4JV5L 3CPFA 1HNXL 4DV2L 1YJ9P 2JEAI 2UUAL 4BY7H 4JI0L 3UDIA 1SLJA 4R4CA 3F8TA 1BVSA 4O0AA 3CW2C 4GN5A 4A3BG 3CCUA 2KHIA 2JA6H 2CKZB 1L2FA 1I6HH 4YCUA 4JC0A 5BS1A 1OXTA 3M4OH 1K30A 2JA7G 1TWFH 1PH6A 2R93H 2VW9A 1QVGO 3HOZG 1LYLA 2YTVA 1JE5A 4DK6C 1I5FA 1WCMG 4JI7Q 5I4TG 1SE8A 4YY3L 4DV1Q 1QRJA 4JI5Q 3PIOA 1Y1VG 2GVAA 2PQAA 5HY6A 4NB3A 2JA5G 5JJIA 3M85A 3ULPA 4IOAA 3CMEA 1N34Q 1IUQA 2PEKA 3E0EA 1X3EA 3J80i 2PEIA 3KFUA 4GR6A 5JEAG 3K8AA 4GKKQ 2D0PA 4JYAL 1HZBA 2ZM6Q 4C3JH 4LF9L 5C44H 3TRZA 1S72A 4R4IA 3I55P 5LMUQ 4GS3A 3U4VA 3ULLA 4GNXB 4JI6Q 4JBWA 1EQQA 1HH2P 3LRYA 4TVAB 4X6AH 3CD6P 4A3JH 4NXNQ 1HNZL 2ONTA 1KHIA 2E5LL 1NMGA 2AKWB 4LFAL 4GLVB 5BR8L 3OW2O 1IZ6A 4OWWB 1XJVA 2MNAA 1VS0A 3T1YQ 2EG5A 3E2DA 2ATWA 3CCLA 1VQNA 1CKMA 1VQEA 1TWCH 1KC8Q 4BXXH 2HIVA 1M74A 2OTJA 3W5OA 4BY1H 1VQBA 3RLOA 4HIMA 5JJKA 3RNUA 4OWXB 1XMQQ 1A8VA 1B70B 5GAGC 3PO3G 3PF5A 4OO1G 4A3MH 1VQGA 2Z45A 1VQIA 5C0XJ 1JJ2O 4ME3A 4HJ9A 1Q81C 1VQ9A 2LXKA 1ASZA 3W1BA 4AQYQ 5GADC 2XT1A 3KLWA 2UUCL 4XTCS 1Q81Q 1MJCA 5IYCH 1Y1WH 2ID0A 2CCZA 3M9BA 2IT1A 2Q2UA 3CCRP 1NE3A 4PZ7A 2AHOB 2LF4A 1IBLL 1W3SA 1E3PA 5M5YH 1S40A 3H0GH 3DS1A 4A93H 4DV7Q 5IY0A 3KYHC 4B3SQ 3K7AH 4U0AA 1V1QA 1N32Q 3F2DA 4U0BA 5FLMH 3W1GA 2WB1E 2YTXA 1VQ7A 4IFDI 1N8RC 4C2MH 2I5LX 4BA2I 1N8RQ 1Q8KA 4HIKA 2XGTA 2B63G 4X62L 2BA0A 1NMFA 1EIYB 4U0EA 3E9HA 3KJPA 1A43A 1YI2A 1UE6A 4DR6Q 3TREA 2KCTA 4B3TL 2JA8G 1YITA 3HOUH 3GO5A 4DR3Q 1HZAA 2AMCB 3GTKH 4MTNA 4DUYQ 2BUOA 4L5TA 1UWVA 1M6NA 5IP7H 2I5HA 4K0KL 4XROA 2QA4P 5M3MH 3HOXG 4OXPA 5F2OA 1Z9FA 1TWGH 1N36Q 2UXDQ 1U5KA 3HZQA 4H02A 3CPWO 1VQ6A 1Q12A 4LFBL 5IE8A 4LF5Q 1DGSA 4A75A 4P72A 2MO0A 3A5UA 3CC4P 1BKBA 4HIDA 1YJWP 4DKAC 4IPHA 4R4QA 3MXNB 3OW2A 3IRBA 4QNBA 3G26A 3OTOQ 4M0IA 2M8NA 3B6YA 2K75A 4IOCA 3GTQH 4TQUS 1E1OA 1XMOQ 3A5ZB 1IBKL 1SR3A 1P8LA 2MO1A 4LF7Q 2JA7H 1VQFA 4HJ8A 1NY4A 2VZAA 4X66Q 3J80c 4KLKA 2JEBI 2YV5A 3HOZH 1I3QH 3L2PA 2WB1G 2OARA 4LUVA 1WCMH 4BBRG 2E8GA 3F1ZA 1N9WA 4JI8L 4JI1Q 4DK3C 3M7NA 1Y1VH 4YHHQ 4HJ7A 4A4IA 4KHPL 2JA5H 3T1HL 3ZJYC 1K73Q 4X65L 2R7DA 4LF8L 4YCWA 5F2NA 1Q1EA 2YTYA 3VDYA 1GD7A 5AJ3Q 1E6JP 4R4TA 3G21A 4NXMQ 4PH1A 4B3RQ 1QUQA 4DR2Q 3CCVP 2OTLA 1RO2A 4DAMA 3MGEA 3ER0A 2DUDA 3B5IA 4QJFA 2PENA 4DV3Q 4A76A 4HIOA 5IYDG 3G71P 3HOVG 4WJ4A 1VQ5A 2A19A 2F4VL 3RZOH 1VQCA 3BZCA 5HGMA 1VQDA 4XFYA 3GDEA 3I7FA 1EQRA 4PH0A 1L0WA 2N49A 1I94Q 2JYGA 4POGA 4J15A 3CCUP 1EOVA 1VQAA 2VQFL 1FJGQ 1EIFA 2PY8A 1QZGA 3S1MH 2EIFA 5HGNA 1Q7YC 4PZ8A 4OONA 1VQOA 3UE1A 3RLNA 1Q7YQ 3PO3H 4Y52H 5ELNA 1VQPA 1XPOA 2PEMA 4IPYA 4P74A 1I50H 3CCJA 4POFA 5LMNW 5IT9c 2NZHA 4IPDA 4P73A 1E24A 3ICEA 1OXSC 1KL9A 4JI2L 4A3IG 4IFDJ 1VQ4A 3PO2G 1QVCA 1PYSB 5IYBG 3PUYA 1EYGA 2UXCL 2UUAQ 1NTGA 4HJ5A 2E2JH 4JI0Q 3CMEP 2EFJA 1AH9A 3UDGA 3H4EA 4NPSA 1N33Q 4LUZA 1NJIC 3M3YH 2BA1A 5GAHC 4DR1Q 3CCEA 1S72P 1XPUA 3PUXA 4YCVA 1IXRA 2B63H 2NVQH 3CXCA 3H0DA 2VUMG 3ERSX 3I4MG 2Q2TA 1R9TH 3RLFA 4JI3Q 1M1KC 2B29A 1TWAH 1K8AC 2JA8H 1VQLA 4OO1I 1X65A 1JT8A 1QUQB 1K8AQ 1YBYA 3S17H 1YNXA 4DV4Q 2VNUD 1SMXA 4UPAA 2ZJQA 2Z6KC 3RN5A 4DV1L 3CCLP 1VQNP 3G6EA 4JI5L 4RG1A 3J7A5 1PH9A 1YIJP 1X54A 1IBMQ 3S15H 1G51A 3HOXH 2OTJP 2XXMA 1UE5A 5E7NA 1YJ9A 2IX1A 3I56P 4JYAQ 1N34L 5M5XH 1CSQA 4LF9Q 1KRTA 5C4XG 1XPRA 4IO9A 2Q2IA 3RN2A 4GKKL 2NN6G 3PF4A 1PA6A 2ZM6L 2E2HH 1TXYA 4JI4Q 5LMUL 4LF4Q 2QEXA 2Z6KA 1SFOH 1EIAA 1HNZQ 2PI2A 4PG3A 1VQ8P 1FL0A 2C35B 3EIVA 4YWKA 3UE0A 4NXNL 5M3FG 4P75A 1M90C 4L5SA 4BBRH 2DGYA 2R7FA 1XNQQ 2BH8A 1PH2A 2Q2HA 4LFCQ 2HQLA 4LF6Q 1VQ7P 1M90Q 2RCNA 3T1YL 4A3FG 3CCQP 1CKNB 4DUZL 4DV0Q 5IWAQ 4DR4L 4EQ5A 5M5WH 3S14H 4L5RC 3CQZH 3STBC 1KQSO 2OQ0A 5GAEC 1XMQL 3HYBA 1YI2P 5IP9G 2IX0A 3CC7A 3WWVA 2Z0SA 2IHEA 5JJLA 3U4ZA 4DV6Q 1PV4A 4A3DG 2N78A 2NVYH 3FKIG 1YITP 3S1RH 4IPGA 3CCSA 1BBWA 4AQYL 2KCMA 2N3SA 3Q20A 2WAQE 2M8LA 4DR5Q 2JA9A 1IBLQ 5IYDH 1HR0L 3HOVH 3FP9A 4R4OA 1Q86C 2R6GA 1K9MC 4MZ9A 3H15A 3CCMA 5ELOA 1K9MQ 3H47A 3AYHB 1VQ6P 2UXBQ 4DV7L 3RZDH 4B3SL 2GN5A 4A3LG 1AUMA 2Y0SE 2JK8A 1N32L 1YHQP 4DR7Q 3G4SP 3P05A 1VQHA 3KJOA 5JEAJ 3UDFA 4U0FA 4IJHA 1M6EX 2K52A 3L0OA 1KAWA 2H5XA 1GKHA 1VQKA 4GOPB 2KHJA 1CSPA 2F52A 2KENA 1J6QA 1YJNA 4DR6L 1IYJB 2PNHA 3OYYA 1J5EL 4LNQA 4DR3L 2NVTH 2B3GA 2ZTCA 5FJ8H 1B7YB 4A3IH 4DNIA 1HNWQ 4FDBA 3CCRA 3PO2H 5IYBH 1PH1A 1FGUA 3F2CA 4DUYL 4UP7A 4LFBQ 1VQJA 4XRQA 5HGQA 3CF5A 5F2KA 1N36L 2UXDL 4DV5L 1QZHA 1XNRL 2K50A 3S1QH 3D0FA 2WAQG 4JCVE 2OTLP 1A63A 1IL2A 2I5MX 3DS5A 5GROA 2UU9Q 2VUMH 4GN4B 3I4MH 1EOQA 5EAYA 1JJGA 3TS0A 3ULJA 1VQ5P 3RR5A 3DM3A 2JQOA 1KQSA 2JYLA 4X66L 3G29A 1WFQA 2Y0SG 2OWOA 1PH5A 4QY7A 3CXCO 4GKJQ 1P16A 3I2ZA 1PH3A 1KD1C 4JI1L 3H3VH 2HHHQ 4KHPQ 3S2HH 2M8PA 1A8OA 1KD1Q 4YWLA 4YHHL 4X64Q 5K36G 3AQQA 2RHQB 1U0LA 1JMCA 3K0XA 3AEVA 2VQEQ 1VQOP 3EN2A 5C4XH 5AJ3L 1VQPP 1VQMA 1Q82C 5C3EG 4B3RL 4DR2L 3HOWH 3CCJP 2ZTDA 5JPAA 1BBUA 3HKZE 1Q82Q 1D1DA 2BH2A 4DPGA 3J81i 1CKOA 2NVXH 2F4VQ 1VQ4P 4DV3L 4B3MQ 2UUBQ 5FLXc 3G0VA 4A3KG 1SN8A 3LGJA 4KI0A 1C0AA 2ZTEA 3STBD 4C3IH 4QIWE 5M3FH 1WI5A 3VRLC 1RNIA 5LMNQ 1B8AA 3DS2A 1E1TA 1OTCA 2YU9H 3M4PA 3UDXA 4C3HH 2R7ZG 1LUZA 3S2DH 1I94L 3CCEP 4A3FH 1WJJA 3KDFB 2V1CC 1X56A 2NZOA 1QVFA 2K5HA 1FJGL 2K4KA 2K5VA 3H3VI 2ALYB 1GVPA 4BBSG 3CC2A 3Q8DA 4OX9Q 5IP9H 4EX5A 4COCA 1JJCB 2F3IA 3K80C 2EXDA 1MIUA 4A3DH 3HKSA 5FJ8G 1CKNA 3FKIH 4HJAA 1Z47A 4JI2Q 2Z46A 4JOIC 1PVOA 1CUKA 4U0DA 2KODA 1XTDA 2NN6I 3CMAA 4JV5Q 2WP8J 1YHBA 1HNXQ 4DV2Q 4A3GG 1Y14B 2MFIA 3G6EP 2IHFA 4GLAC 3I4NG 1PH4A 3K81C 1EUJA 3J7ZC 1OXXK 1AE2A 2D0OA 3JC66 3PUVA 4UY8C 1JB7A 3DPHA 2IY5B 1ZMBA 1K8GA 4IPCA 4A3LH 1NJIQ 2L6EA 1T9HA 2KBNA 4UP9A 1N33L 2LSSA 3HKZG 5C0XG 2QGQA 4GOPC 4XFXA 4JOIA 1OXUA 2EQSA 4KHZA 1V9PA 4DR1L 1YVCA 1RL2A 2D62A 2QEXP 1BAJA 2CWAA 2BHVA 4R1JA 4YY3Q 1M1KQ 2K14A 3M4QA 4JI3L 2JE6I 4JI7L 1KRSA 1C9OA 2RHSB 3SGIA 3S1NH 2ES2A 4AH6A 3L7ZC 2VL6A 3GTJH 3PUWA 1GM5A 1X6OA 2ASBA 1A0IA 3E9IA 5HGLA 4GOPA 4DV4L 1SROA 1UE1A 3AFQA 2PEJA 1HZCA 4PMWA 1A62A 3D31A 1IBML 2I0QA 4QGUA 2Z44A 3GTOH 4XIGS 3TS2A 5DCKA 1VQ9P 3CP0A 1WOCA 1L1OB 1E22A 3HOWG 3CC7P 3G1GA 1D7QA 1WYDA 3PUZA 2JJQA 3K7UC 2PMZE 4JI6L 1E7ZA 4JBJA 3CCSP 2E5LQ 1PH7A 2PEOA 4JI4L 1PHJA 4LFAQ 4LF4L 5BR8Q 4RMFA 3U50C 2HIXA 2LXJA 3KF6B 4ALPA 3CCMP 2R92G 2CWPA 2MQHA 4A3CG 1G6PA 1H95A 2CQOA 4QQBX 3NTEA 1RO0A 3BU2A 1KC8C 1W2BA 1XNQL 3NEMA 4LFCL 1YIJA 4LF6L 4DUZQ 3J81c 4DR4Q 3CAMA 1TWHH 3HOYG 2PEQA 3I56A 4DAYB 3MEFA 4DV0L 3PCOB 5IWAL 2UUCQ 1VQKP 3BJUA 3I55A 2XV6A 1AE3A 3HFZB 1X3FA 4LW1A 4QL5A 3TQYA 1YJNP 5C3EH 4BA1I 4A3EG 2HT1A 4DV6L 2A1AA 2EIAA 3AFPA 3CD6A 3TEHB 1HR0Q 3EBEA 3NBHB 1NBWA 3KOJA 3BZKA 3G28A 3JAMi 4JBMA 1VQ8A 3PGZA 4GR2A 4DR5L 1Q86Q 1GO3E 4A3KH 1EWIA 4OWTB 2CWOA 4BY7G 3DS4A 1HZ9A 1PYBA 4APVA 3GTPH 3A74A 4UP8A 1X9NA 1QVGA 4COPA 1SRUA 2JA6G 2K5NA 4X62Q 4P71A 3PIPA 2UXBL 1HR0W 2R7ZH 3S16H 3CCQA 4DR7L 2XTIA 5C4JH 2GVBA 2OQKA 2PQAB 4L5QA 2R93G 3DS3A 4B3TQ 5DLQE 3M1MA 3RG6C 1K0RA 4BBSH 1UEBA 4PZ6A 1HJPA 1J5EQ 3A0JA 3KDFA 4WYMA 4K0KQ 1QVFO 3G48A 3KF8B 3WBHA 1Q46A 2FXQA 1K3RA 2E2IH 3J81j 4A3GH 3DS0A 2AWOA 1HNWL 1PH8A 4Y7NH 3I4NH 1EFWA 1V43A 1UE7A 4DV5Q 1K83H 4LF5L 5BS2A 1X3GA 1XNRQ 4AYBE 5C44G 1YHQA 5H1SE 4A3BH 2WFWA 3DTJA 1C7YA 3G4SA 4O2DA 1IBKQ 3OTOL 1VQMP 2N8NA 4LWCA 1ASYA 1XMOL 3F2BA 4A3JG 1OXVA 2VY3A 4LF7L 4LUOA 4GN3B 2UU9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IX1 A;  4A93 H;  2ALY B;  4IFD G;  1GVP A;  4DV7 Q;  5IY0 A;  3KYH C;  4B3S Q;  3K7A H;  4JYA Q;  4BBS G;  4WJ3 M;  4JI8 Q;  2ZJR A;  1N34 L;  3CC2 A;  4MNO A;  3Q8D A;  5M5X H;  1CSQ A;  1V1Q A;  1KRT A;  4LF9 Q;  3F2D A;  4OX9 Q;  1N32 Q;  5IP9 H;  1MJE A;  5C4X G;  4EX5 A;  5FLM H;  1XPR A;  3W1G A;  2WB1 E;  2YTX A;  4IJL A;  4IO9 A;  1VQ7 A;  4IFD I;  1N8R C;  2Q2I A;  1PFS A;  1JJC B;  2F3I A;  3K80 C;  4C2M H;  3RN2 A;  2EXD A;  2NN6 G;  4GKK L;  1MIU A;  3PF4 A;  1PA6 A;  4A3D H;  3HKS A;  2L15 A;  5FJ8 G;  1CKN A;  3FKI H;  2ZM6 L;  4HJA A;  5E7N A;  2I5L X;  1Z47 A;  4JI2 Q;  4BA2 I;  2E2H H;  4JOI C;  1JJ2 A;  1PVO A;  1CUK A;  1Q8K A;  2QA4 A;  4HIK A;  3T1H Q;  1TXY A;  4BXX G;  1XTD A;  2OCE A;  2NN6 I;  4X65 Q;  4JI4 Q;  2XGT A;  3CMA A;  2B63 G;  4GKJ L;  5LMU L;  4X62 L;  4LF8 Q;  4LF4 Q;  4JV5 Q;  1D8L A;  2WP8 J;  4BY1 G;  2QEX A;  1YHB A;  2Z6K A;  2BA0 A;  1SFO H;  1HNX Q;  4DV2 Q;  1NMF A;  1K73 C;  1EIY B;  4A3G G;  1FVI A;  1HNZ Q;  1Y14 B;  2PI2 A;  2MFI A;  3E9H A;  3KJP A;  4PG3 A;  2HHH L;  2IHF A;  1YHA A;  1YI2 A;  1L1O C;  4GLA C;  3FHW A;  3I4N G;  1FL0 A;  2C35 B;  1PH4 A;  3EIV A;  1UE6 A;  3K81 C;  3CC4 A;  3GTM H;  1EUJ A;  3J7Z C;  1YJW A;  4X64 L;  4DR6 Q;  1OXX K;  4YWK A;  2UU9 L;  1AE2 A;  3UE0 A;  2D0O A;  3JC6 6;  3PUV A;  4A3M G;  3TRE A;  4NXN L;  4UY8 C;  2KCT A;  1JB7 A;  2IY5 B;  5M3F G;  1KIX A;  4B3T L;  2JA8 G;  1YIT A;  3HOU H;  3GO5 A;  4P75 A;  1X55 A;  4DR3 Q;  1HZA A;  1M90 C;  4IPC A;  4BBR H;  2DGY A;  1K8G A;  2AMC B;  4GNX C;  4L5S A;  1G29 1;  2R7F A;  2VQE L;  4A3L H;  1T9H A;  4MTN A;  1XNQ Q;  3GTK H;  2BH8 A;  2KBN A;  2Q2H A;  1PH2 A;  1MKH A;  4LFC Q;  2HQL A;  4UP9 A;  4LF6 Q;  5IYC G;  1Y1W G;  2LSS A;  1N33 L;  3HKZ G;  5C0X G;  1Q1B A;  2QGQ A;  2RCN A;  4DUY Q;  3T1Y L;  4L5T A;  1UWV A;  4GOP C;  4JOI A;  1OXU A;  2EQS A;  4A3F G;  1YEZ A;  1V9P A;  1YZ6 A;  4KHZ A;  4DR1 L;  1CKN B;  5IP7 H;  2I5H A;  4K0K L;  1YVC A;  5M3M H;  5C0X I;  3HOX G;  4DUZ L;  1RL2 A;  4DV0 Q;  5IWA Q;  4OXP A;  1Z9F A;  4DR4 L;  1TWG H;  2D62 A;  4EQ5 A;  5M5W H;  1N36 Q;  3S14 H;  2UXD Q;  4L5R C;  3H0G G;  1U5K A;  3CQZ H;  4A93 G;  4H02 A;  1VQ6 A;  3GD7 A;  3STB C;  2CWA A;  1Q12 A;  4LFB L;  5IE8 A;  4YWM A;  4JBK A;  1L1O A;  4LF5 Q;  1DGS A;  4R1J A;  4A75 A;  4YY3 Q;  2OQ0 A;  4B3M L;  4P72 A;  2MO0 A;  5GAE C;  1XMQ L;  3PV0 A;  2K14 A;  2UUB L;  2R92 H;  5IP9 G;  3A5U A;  4AYB G;  2IX0 A;  3CC7 A;  3WWV A;  5FLM G;  2Z0S A;  3U58 A;  3M4Q A;  4JI3 L;  1BKB A;  2JE6 I;  4HID A;  4A3C H;  4DKA C;  2IHE A;  4IPH A;  4R4Q A;  5JJL A;  4JI7 L;  3MXN B;  3U4Z A;  1KRS A;  1C9O A;  2RHS B;  2VQF Q;  4DV6 Q;  3IRB A;  3OW2 A;  3SGI A;  3S1N H;  1PV4 A;  4A3D G;  2N78 A;  2PI2 E;  2NVY H;  3FKI G;  2ES2 A;  3OTO Q;  4GNX A;  2RF4 A;  3B6Y A;  4AH6 A;  3L7Z C;  3S1R H;  2VL6 A;  4IPG A;  2K75 A;  4JG2 A;  1RIP A;  3GTJ H;  4IOC A;  3PUW A;  3CCS A;  1GM5 A;  1BBW A;  1X6O A;  5LMN L;  4AQY L;  2KCM A;  3GTQ H;  2N3S A;  2ZJP A;  2ASB A;  4TQU S;  1A0I A;  3E9I A;  2WAQ E;  1LTL A;  4DR5 Q;  1E1O A;  2CFM A;  2JA9 A;  1XMO Q;  1IBL Q;  5IYD H;  3A5Z B;  1HR0 L;  1IBK L;  4GOP A;  1SR3 A;  4DV4 L;  3HOV H;  1P8L A;  3FP9 A;  1SRO A;  3KF6 A;  3S24 A;  1UE1 A;  4R4O A;  3JAM c;  1Q86 C;  2MO1 A;  2R6G A;  3AFQ A;  1K9M C;  4MZ9 A;  1VQF A;  4HJ8 A;  4LF7 Q;  1NY4 A;  2VZA A;  3H15 A;  2JA7 H;  3CCM A;  1HZC A;  4PMW A;  1A62 A;  3HOY H;  4X66 Q;  3D31 A;  3J80 c;  5ELO A;  1IBM L;  2I0Q A;  4KLK A;  2JEB I;  2YV5 A;  4QGU A;  2AWN A;  3HOZ H;  3DLL A;  3I4O A;  1I3Q H;  3CCV A;  1LM0 A;  3AYH B;  1S3O A;  3L2P A;  3GTO H;  2WB1 G;  3GTG H;  4XIG S;  2UXB Q;  4LUV A;  3TS2 A;  1WCM H;  3HOU G;  4DV7 L;  3RZD H;  4B3S L;  2E8G A;  2GN5 A;  3F1Z A;  1N9W A;  3CP0 A;  4BBR G;  3CPW A;  4GLX A;  1WOC A;  3PSI A;  2Y0S E;  2JK8 A;  1L1O B;  1E22 A;  4JI8 L;  4JI1 Q;  3GTL H;  3HOW G;  4DK3 C;  4OX9 L;  1N32 L;  4DR7 Q;  1D7Q A;  1WYD A;  3M7N A;  3G71 A;  2A8V A;  1Y1V H;  2VS1 A;  3PUZ A;  4A3E H;  2JJQ A;  4YHH Q;  1KXL A;  3K7U C;  4HJ7 A;  5GQO A;  2PMZ E;  4AIM A;  4JI6 L;  2UXC Q;  1E7Z A;  1VQH A;  3NEL A;  1VCI A;  3KJO A;  5IP7 G;  4A4I A;  4JBJ A;  4KHP L;  5JEA J;  3UDF A;  2JA5 H;  4IJH A;  5M3M G;  1O7I A;  2E5L Q;  3T1H L;  2K52 A;  3ZJY C;  3NEN A;  1PH7 A;  3L0O A;  4X65 L;  4JI4 L;  1PHJ A;  2R7D A;  4LFA Q;  1KAW A;  4LF8 L;  2H5X A;  2YYZ A;  1GKH A;  4YCW A;  5J3B A;  2YTY A;  1Q1E A;  5BR8 Q;  1VQK A;  4LF4 L;  4JV5 L;  3CPF A;  3VDY A;  1HNX L;  4RMF A;  1GD7 A;  5AJ3 Q;  4DV2 L;  4GOP B;  3U50 C;  2HIX A;  2LXJ A;  3KF6 B;  2JEA I;  2KHJ A;  4ALP A;  2UUA L;  4BY7 H;  1CSP A;  2F52 A;  4JI0 L;  4R4T A;  2R92 G;  3UDI A;  2KEN A;  1SLJ A;  2CWP A;  4R4C A;  4NXM Q;  3F8T A;  1BVS A;  4O0A A;  3CW2 C;  1J6Q A;  2MQH A;  4GN5 A;  4A3C G;  4B3R Q;  1YJN A;  4A3B G;  1G6P A;  4DR6 L;  1QUQ A;  4DR2 Q;  1H95 A;  1IYJ B;  2CQO A;  2KHI A;  3CCU A;  2OTL A;  2PNH A;  3OYY A;  2JA6 H;  4QQB X;  2CKZ B;  1J5E L;  4DAM A;  1L2F A;  3BU2 A;  4LNQ A;  4DR3 L;  2NVT H;  1KC8 C;  1I6H H;  2B3G A;  4YCU A;  3ER0 A;  2DUD A;  4JC0 A;  4QJF A;  2ZTC A;  5FJ8 H;  1B7Y B;  4A3I H;  1W2B A;  4DV3 Q;  4DNI A;  1XNQ L;  1HNW Q;  4FDB A;  3NEM A;  4LFC L;  3CCR A;  4A76 A;  4HIO A;  3PO2 H;  1YIJ A;  5IYD G;  4LF6 L;  5IYB H;  4DUZ Q;  3J81 c;  3HOV G;  1OXT A;  1PH1 A;  1FGU A;  4WJ4 A;  3M4O H;  3F2C A;  4DUY L;  4DR4 Q;  4UP7 A;  1VQ5 A;  2JA7 G;  2A19 A;  1TWF H;  3CAM A;  2F4V L;  1PH6 A;  1VQC A;  3RZO H;  1TWH H;  3HOY G;  2R93 H;  3BZC A;  4LFB Q;  1VQJ A;  2VW9 A;  3I56 A;  4DAY B;  3HOZ G;  1LYL A;  5HGQ A;  1VQD A;  3CF5 A;  3MEF A;  4DV0 L;  2YTV A;  3PCO B;  1JE5 A;  3GDE A;  5IWA L;  4DK6 C;  1N36 L;  2UUC Q;  1I5F A;  2UXD L;  4DV5 L;  3BJU A;  3I7F A;  3I55 A;  1WCM G;  4JI7 Q;  1EQR A;  1L0W A;  3S15 H;  2N49 A;  1AE3 A;  3HFZ B;  1QZH A;  1X3F A;  1SE8 A;  4YY3 L;  1XNR L;  2K50 A;  4LW1 A;  4DV1 Q;  1I94 Q;  4POG A;  4JI5 Q;  4J15 A;  4QL5 A;  3TQY A;  5C3E H;  3PIO A;  3S1Q H;  1Y1V G;  2GVA A;  3D0F A;  2WAQ G;  4JCV E;  1EOV A;  4BA1 I;  4A3E G;  1A63 A;  1VQA A;  2VQF L;  1FJG Q;  4DV6 L;  2HT1 A;  1EIF A;  2A1A A;  1IL2 A;  2PQA A;  3AFP A;  5HY6 A;  3TEH B;  1HR0 Q;  2I5M X;  3EBE A;  3CD6 A;  1QZG A;  3NBH B;  4NB3 A;  3S1M H;  2EIF A;  5GRO A;  1NBW A;  2UU9 Q;  2JA5 G;  2VUM H;  3KOJ A;  4GN4 B;  5JJI A;  3BZK A;  1Q7Y C;  3I4M H;  3M85 A;  5EAY A;  3ULP A;  3JAM i;  4PZ8 A;  1JJG A;  3TS0 A;  4IOA A;  4JBM A;  1VQ8 A;  3PGZ A;  4OON A;  3CME A;  4DR5 L;  1N34 Q;  1VQO A;  3UE1 A;  1GO3 E;  3E0E A;  3ULJ A;  1X3E A;  3J80 i;  3RLN A;  3KFU A;  4A3K H;  3PO3 H;  1EWI A;  4OWT B;  3DM3 A;  3RR5 A;  4Y52 H;  2JQO A;  5ELN A;  5JEA G;  3K8A A;  4BY7 G;  4GKK Q;  1HZ9 A;  2D0P A;  1VQP A;  1PYB A;  4JYA L;  4APV A;  1XPO A;  3GTP H;  1KQS A;  1HZB A;  3A74 A;  4X66 L;  2ZM6 Q;  1WFQ A;  2Y0S G;  4C3J H;  4UP8 A;  4LF9 L;  1X9N A;  4P74 A;  2OWO A;  1I50 H;  5C44 H;  1QVG A;  3TRZ A;  3CCJ A;  4POF A;  5LMN W;  1PH5 A;  1SRU A;  4QY7 A;  4R4I A;  5IT9 c;  1S72 A;  2NZH A;  2JA6 G;  2K5N A;  4IPD A;  4P73 A;  1P16 A;  1E24 A;  4GKJ Q;  5LMU Q;  4X62 Q;  4P71 A;  4GS3 A;  3I2Z A;  3PIP A;  2UXB L;  3ICE A;  3U4V A;  1PH3 A;  1HR0 W;  1OXS C;  3ULL A;  1KD1 C;  2R7Z H;  4GNX B;  1KL9 A;  4JI6 Q;  4JI2 L;  4JBW A;  3S16 H;  4NXM L;  4JI1 L;  4A3I G;  1EQQ A;  3H3V H;  3CCQ A;  2HHH Q;  4KHP Q;  4IFD J;  1VQ4 A;  4DR7 L;  1HH2 P;  2XTI A;  3PO2 G;  3S2H H;  4TVA B;  1QVC A;  1PYS B;  5IYB G;  3PUY A;  4YWL A;  5C4J H;  2GVB A;  4YHH L;  4X6A H;  2OQK A;  4X64 Q;  5K36 G;  4A3J H;  1EYG A;  4NXN Q;  2PQA B;  3AQQ A;  4L5Q A;  2UXC L;  2RHQ B;  1HNZ L;  1U0L A;  2R93 G;  1JMC A;  3K0X A;  4B3T Q;  3AEV A;  1KHI A;  5DLQ E;  2UUA Q;  1NTG A;  2E5L L;  1K0R A;  1NMG A;  4HJ5 A;  2E2J H;  4JI0 Q;  2AKW B;  4BBS H;  2VQE Q;  4A3L G;  1UEB A;  1AH9 A;  4LFA L;  4GLV B;  3EN2 A;  4PZ6 A;  5BR8 L;  5C4X H;  3UDG A;  4NPS A;  5AJ3 L;  1N33 Q;  4LUZ A;  1NJI C;  1IZ6 A;  4OWW B;  3M3Y H;  1XJV A;  1HJP A;  2MNA A;  2BA1 A;  1VS0 A;  3T1Y Q;  1VQM A;  1Q82 C;  1J5E Q;  3A0J A;  2ATW A;  3CCL A;  3KDF A;  5GAH C;  1VQN A;  5C3E G;  4DR1 Q;  1CKM A;  3CCE A;  4B3R L;  4K0K Q;  3G48 A;  1VQE A;  4DR2 L;  3HOW H;  2ZTD A;  3KF8 B;  1BBU A;  1TWC H;  4BXX H;  3HKZ E;  2HIV A;  2BH2 A;  1Q46 A;  1XPU A;  2OTJ A;  3PUX A;  4YCV A;  1IXR A;  4DPG A;  2B63 H;  2FXQ A;  2NVQ H;  3W5O A;  3CXC A;  4BY1 H;  1K3R A;  1VQB A;  2E2I H;  3J81 i;  2VUM G;  1CKO A;  3J81 j;  3ERS X;  3I4M G;  2NVX H;  3RLO A;  4HIM A;  2Q2T A;  2F4V Q;  1R9T H;  4A3G H;  5JJK A;  3RNU A;  4DV3 L;  3RLF A;  4OWX B;  2AWO A;  4B3M Q;  1XMQ Q;  1HNW L;  2UUB Q;  1PH8 A;  1A8V A;  1B70 B;  5FLX c;  4Y7N H;  3I4N H;  5GAG C;  4A3K G;  4JI3 Q;  1SN8 A;  1EFW A;  3PO3 G;  1V43 A;  3PF5 A;  1M1K C;  3LGJ A;  1UE7 A;  2B29 A;  4KI0 A;  4OO1 G;  1C0A A;  4A3M H;  2ZTE A;  1K83 H;  3STB D;  1VQG A;  4C3I H;  4DV5 Q;  4QIW E;  4LF5 L;  1VQI A;  5C0X J;  1TWA H;  5M3F H;  1K8A C;  1WI5 A;  1X3G A;  4ME3 A;  2JA8 H;  4HJ9 A;  1Q81 C;  3S17 H;  1VQ9 A;  2LXK A;  1ASZ A;  1XNR Q;  4AYB E;  3W1B A;  5C44 G;  1VQL A;  5LMN Q;  1B8A A;  4AQY Q;  1YHQ A;  1E1T A;  5GAD C;  1X65 A;  3KLW A;  5H1S E;  1QUQ B;  1OTC A;  2YU9 H;  2UUC L;  3M4P A;  4OO1 I;  1JT8 A;  3UDX A;  4C3H H;  4A3B H;  2WFW A;  1YBY A;  4XTC S;  1C7Y A;  1MJC A;  1YNX A;  4O2D A;  5IYC H;  2ID0 A;  3G4S A;  4DV4 Q;  1Y1W H;  1IBK Q;  1LUZ A;  3OTO L;  2R7Z G;  3S2D H;  2VNU D;  1SMX A;  4UPA A;  2CCZ A;  2ZJQ A;  2Z6K C;  3RN5 A;  4DV1 L;  1I94 L;  3G6E A;  3M9B A;  4A3F H;  2IT1 A;  2N8N A;  1WJJ A;  3KDF B;  4LWC A;  4RG1 A;  4JI5 L;  2Q2U A;  3J7A 5;  2V1C C;  1PH9 A;  1NE3 A;  1X54 A;  2AHO B;  4PZ7 A;  1IBM Q;  1XMO L;  1G51 A;  1IBL L;  1ASY A;  1X56 A;  2NZO A;  1W3S A;  2K5H A;  3HOX H;  3F2B A;  2K4K A;  1FJG L;  1QVF A;  4A3J G;  1E3P A;  2K5V A;  1OXV A;  2VY3 A;  3H3V I;  4LF7 L;  5M5Y H;  1S40 A;  4LUO A;  1UE5 A;  4GN3 B;  3H0G H;  1YJ9 A; 
#chains in the Genus database with same CATH topology
 4IFD G;  4R8N A;  1D1K A;  3G1I A;  1EEF D;  4WJ3 M;  4JI8 Q;  2ZJR A;  4MNO A;  4OL7 A;  3HOW B;  3I72 A;  1MHW C;  1MJE A;  1KAB A;  5G3L D;  4ZK9 B;  4IJL A;  2L1B A;  4K8I A;  1PFS A;  1SYE A;  2A6E D;  1LAC A;  2NVX B;  2L15 A;  2ZXR A;  3JAM L;  2G9D A;  1JJ2 A;  3GP7 A;  2BE5 C;  2PW5 A;  2QA4 A;  3T1H Q;  4BXX G;  4HCS A;  3DEP A;  1TY2 A;  2OCE A;  4X65 Q;  2WPT A;  2RCF A;  3OIQ A;  4GKJ L;  4B08 A;  1F2M A;  1WD0 A;  3QJY A;  4LF8 Q;  2GZI A;  1D8L A;  4BY1 G;  5ELC A;  4C3I B;  1HCZ A;  3K57 A;  5DNF A;  1K73 C;  5M3F B;  2FVE A;  1FVI A;  1X32 A;  1DV5 A;  1JOK A;  2HHH L;  5IGC A;  1YHA A;  1V1P A;  2X2B A;  1L1O C;  3FHW A;  5HGO A;  3GZM A;  2YU9 B;  3CC4 A;  3GTM H;  3K5N A;  1YJW A;  4X64 L;  4A3M G;  1QG7 A;  2FQ0 A;  1LTR D;  3S2D B;  3ERQ A;  3MFG A;  1KIX A;  5JEA H;  2IPK D;  3FPP A;  1X55 A;  3MXG A;  2OEO A;  4A3F B;  4NXM L;  2PZU A;  4GNX C;  1G29 1;  3RMH A;  1T8K A;  3CC2 P;  2VQE L;  5CV7 A;  1H9K A;  3VYS A;  5C6A A;  1MKH A;  3BDO A;  3DWP A;  5IYC G;  1Y1W G;  1CK1 A;  4XFZ A;  2D5D A;  1AP0 A;  1ML0 D;  1Q1B A;  1PTO F;  1A6X A;  3QB3 A;  1EIG A;  2AQ2 B;  1YEZ A;  1YZ6 A;  5IIF A;  1JOQ A;  3U9S A;  1HTL D;  5C0X I;  1E2W A;  1PDQ A;  2QIL A;  3CMA P;  2A69 C;  3Q6S A;  3H0G G;  3GTG B;  1C48 A;  2D9U A;  4A93 G;  1WD1 A;  3TDQ A;  3GD7 A;  4A3D B;  4CJ2 C;  4YWM A;  2CH4 W;  1L1O A;  4JBK A;  2CH4 A;  2E76 C;  2G5D A;  4B3M L;  3PV0 A;  2UUB L;  2R92 H;  4AYB G;  1I4G A;  2XVS A;  5FLM G;  1STY A;  3U58 A;  2AQ3 B;  4LK1 C;  3I3C A;  4A3C H;  1O78 A;  3NTI A;  3T13 A;  2K1B A;  2EY1 A;  2VQF Q;  2E1M A;  1ZYR C;  2PI2 E;  1EYA A;  4GNX A;  2RF4 A;  2ENB A;  4JG2 A;  1RIP A;  2CHB D;  1LT5 D;  5LMN L;  2JO0 A;  2SEB D;  2P9X A;  4X3T A;  1PYW D;  4K14 A;  2ZJP A;  1FNU A;  2KOP A;  1EEI D;  1LTL A;  5EPK A;  5CBE E;  2CFM A;  1B9N A;  2FVF A;  1SSO A;  3GV3 A;  3IFD A;  3KF6 A;  3S24 A;  4R8I A;  3JAM c;  4KN7 C;  1EQT A;  4BY7 B;  3VR3 A;  4KN4 C;  4I65 A;  2SOB A;  2QKI C;  4Z9C B;  5FO7 B;  3HOY H;  2F0E A;  3KLR A;  4U0C A;  1IYV A;  3NBI A;  2AWN A;  1SYD A;  3DLL A;  3I4O A;  4KD3 A;  3CCV A;  1LM0 A;  4G7H C;  3BS1 A;  1S3O A;  3GTG H;  2FIN B;  1TT2 A;  2NTT A;  2E2D C;  2N98 A;  3HOU G;  2FVA A;  3CPW A;  1W2B O;  4YIJ A;  3PSI A;  2PMZ B;  4GLX A;  2ZXP A;  1VQL P;  1Q3L A;  3GKL C;  4DFA A;  3GTL H;  3N52 A;  5D3I B;  4OX9 L;  3QWN A;  3G71 A;  1U9R A;  2A8V A;  2VS1 A;  3M4O B;  4A3E H;  4IUQ A;  1F9R A;  1KXL A;  3HEJ A;  1S4Z A;  5GQO A;  5CR3 A;  1WTO A;  4AIM A;  2UXC Q;  3NEL A;  1VCI A;  5IP7 G;  3A56 A;  4DAY A;  5M3M G;  5ELD A;  1O7I A;  3NEN A;  1PFB A;  2C5C A;  3MVV A;  2XN9 C;  2YYZ A;  5J3B A;  2F4I A;  4JV5 L;  4NMZ A;  3CPF A;  1HNX L;  1SE3 A;  4DV2 L;  3S1N B;  2O5J C;  1YJ9 P;  3S9W A;  2JEA I;  1GUT A;  2WV6 D;  2UUA L;  4BY7 H;  4K6D A;  1XYI A;  3GTJ B;  4QCL A;  4JI0 L;  1ONL A;  3UDI A;  4XYQ A;  1ET9 A;  1SLJ A;  4R4C A;  1EZ6 A;  1BVS A;  3F8T A;  4O0A A;  3CW2 C;  3Q24 A;  4GN5 A;  1CQV A;  4A3B G;  3FDT A;  1TQO A;  3CCU A;  2KHI A;  1BXI A;  2B2V C;  2JA6 H;  2N6Z A;  3NBH A;  1BF4 A;  2CKZ B;  1L2F A;  1I6H H;  4WRD A;  4YCU A;  1DNY A;  4JC0 A;  3BZD B;  4UHP B;  4KY7 A;  5BS1 A;  1OXT A;  3M4O H;  3GTO B;  1K30 A;  3HS0 C;  2JA7 G;  3OWE B;  1TWF H;  1STB A;  1ESF A;  1PRT C;  4DG9 A;  1DOL A;  1LTA D;  3OMC A;  1PH6 A;  3X3M A;  4G7Z C;  2R93 H;  2K2Q A;  4TKO B;  2VW9 A;  1F2L A;  1PXU A;  5FOB B;  3Q22 A;  1QVG O;  1UEA B;  4M1U B;  3HOZ G;  1B3A A;  1LYL A;  1V1P B;  2YTV A;  1I4R A;  1JE5 A;  4DK6 C;  2NBF A;  1I5F A;  2K94 A;  1CI3 M;  1WCM G;  4JI7 Q;  5I4T G;  1KTK A;  4IZ8 A;  1SE8 A;  4YY3 L;  2CVR A;  4DV1 Q;  1QRJ A;  5KYI A;  2GDX A;  1Y8P B;  1PTO H;  4JI5 Q;  3G7L A;  2M5R A;  2A6H D;  3PIO A;  2JBG A;  2HUG A;  2QF7 A;  4ZRZ A;  1Y1V G;  2GVA A;  1TY0 A;  3MWY W;  5KRU A;  2PQA A;  5HY6 A;  1UJZ A;  3ZYY X;  4NB3 A;  2AUK A;  2JA5 G;  5JJI A;  1GUO A;  3M85 A;  3ULP A;  1DJR D;  2Y0S B;  4IOA A;  2KGE A;  3CME A;  1N34 Q;  4C1N I;  3KUP A;  4UHV A;  1IUQ A;  2K01 A;  2PEK A;  3E0E A;  1X3E A;  3J80 i;  2PEI A;  3KFU A;  2AFD A;  3J80 E;  3OWF A;  1EU3 A;  4GR6 A;  4KY6 A;  2EZV A;  5JEA G;  3K8A A;  4GKK Q;  1GUS A;  3R2T A;  2D0P A;  1S5B D;  4JYA L;  1OO9 B;  1ZXT A;  1A2T A;  2K93 A;  1HZB A;  2ZM6 Q;  5C4H A;  4C3J H;  4N9P A;  4LF9 L;  2I46 A;  1X3O A;  2L22 A;  4XT3 B;  2KW2 A;  5C44 H;  3TRZ A;  1TWC B;  1NCV A;  4R4I A;  1S72 A;  5DEH A;  3I55 P;  5LMU Q;  1DYQ A;  4GS3 A;  4BY1 B;  2EE1 A;  4FO2 A;  3U4V A;  1FGB D;  1D5X C;  3ULL A;  4MN3 A;  1TWH B;  4GNX B;  3NE5 B;  4JI6 Q;  4JBW A;  1K28 A;  1EQQ A;  2BE5 D;  4BPF A;  1HH2 P;  3LRY A;  4TVA B;  1CEI A;  5KEE A;  1ROD A;  2B8G A;  4X6A H;  3CD6 P;  4A3J H;  2DY8 A;  4NXN Q;  1HNZ L;  4R0M A;  1UNK A;  2FAC A;  2B2U C;  2ONT A;  1KHI A;  4IFD H;  2E5L L;  1NMG A;  1RJT A;  1BR9 A;  2AKW B;  2B2Y C;  5C3E B;  2L55 A;  1NNX A;  4LFA L;  4GLV B;  5BR8 L;  1L0I A;  3OW2 O;  2PO4 A;  3MXN A;  2EJG C;  1IZ6 A;  5I6Y A;  4OWW B;  1XJV A;  2MNA A;  1VS0 A;  5CC4 A;  3T1Y Q;  2EG5 A;  3E2D A;  1VKU A;  2ATW A;  4HSV A;  4O1N A;  5TSS A;  2F0N A;  3CCL A;  5J1Z A;  1VQN A;  1CKM A;  1Z6H A;  3A55 A;  4DF7 A;  1VQE A;  1CA6 A;  4C1N K;  1TWC H;  3NQI A;  1KC8 Q;  4BXX H;  5ISR A;  1EY6 A;  2HIV A;  4A3K B;  3ITP A;  1M74 A;  2OTJ A;  5M5Y B;  3W5O A;  4BY1 H;  1VQB A;  4KK7 A;  2PZW A;  4A93 B;  1HA5 A;  3GTP B;  1KNE A;  3RLO A;  1Q90 A;  4HIM A;  5JJK A;  3FVQ A;  3RNU A;  4OWX B;  1XMQ Q;  4MRT C;  1A8V A;  1B70 B;  1SBB B;  3E5S A;  3CHB D;  5GAG C;  2A69 D;  4RA8 A;  3PO3 G;  1E0B A;  3PF5 A;  1L0H A;  3A7L A;  1EIH A;  4C2M B;  4OO1 G;  2B2U A;  4A3M H;  2K6A A;  1VQG A;  2Z45 A;  3S16 B;  1VQI A;  5C0X J;  4F7X A;  3BVM A;  1JJ2 O;  2B2Y A;  1B44 D;  4ME3 A;  4HJ9 A;  1Q81 C;  1VQ9 A;  2LXK A;  1ASZ A;  2MVU A;  2EVB A;  3W1B A;  2DNW A;  4AQY Q;  4ULL A;  2NO8 A;  5GAD C;  2XT1 A;  3KLW A;  5C4J B;  2UUC L;  2X69 A;  1I4H A;  1ZYR D;  4XTC S;  1Q81 Q;  1AW7 A;  1MJC A;  2K7V A;  5IYC H;  1Y1W H;  2ID0 A;  2CCZ A;  1QNK A;  1BCP F;  4DGZ A;  4HMJ A;  1RCV D;  3M9B A;  2IT1 A;  2Q2U A;  3CCR P;  1SND A;  1NE3 A;  4PZ7 A;  2AHO B;  2H1E A;  2LF4 A;  1IBL L;  3GQB A;  1W3S A;  2WII B;  1AEX A;  1E3P A;  5M5Y H;  1S40 A;  2HCC A;  1S5E D;  2PNG A;  3DS1 A;  3H0G H;  3HRZ C;  4A93 H;  5G3L F;  4DV7 Q;  5IY0 A;  3KYH C;  1STH A;  4B3S Q;  3K7A H;  4U0A A;  1VF5 C;  2RVL A;  1NR2 A;  2LFN A;  1GPJ A;  1V1Q A;  5EKL A;  3URY A;  3GTK B;  3F2D A;  1N32 Q;  4U0B A;  4UDU C;  2F0V A;  2L9F A;  5FLM H;  2EYO A;  3W1G A;  2WB1 E;  2YTX A;  1VQ7 A;  4IFD I;  1I4Q A;  1N8R C;  1CA5 A;  4C2M H;  2E2I B;  4CJ0 B;  3QOL A;  3SK8 A;  3DMU A;  4RHR A;  4A3G B;  2KVM A;  4KJN A;  3R8B A;  5IT9 E;  2I5L X;  4BA2 I;  5HVC A;  4FP5 D;  1N8R Q;  2GZE A;  1Q8K A;  4HIK A;  2F0G A;  1PFN A;  1XTC D;  3J80 L;  2XGT A;  1RF2 D;  2B63 G;  4X62 L;  5CGK A;  3EJI A;  3SR1 A;  2PPB C;  1K83 B;  2BA0 A;  1NMF A;  3A8I E;  1EIY B;  5T1I A;  4F8M A;  4U0E A;  3U9O A;  4QF4 A;  3E9H A;  3KJP A;  1A43 A;  1YI2 A;  3MAQ A;  2ZXO A;  1UE6 A;  4DR6 Q;  4A3B B;  4RAU C;  1CTM A;  5D14 A;  3TRE A;  3HKZ B;  3NSW A;  2KR5 A;  2KCT A;  2BDN A;  2XWJ B;  4DNT B;  4B3T L;  2JA8 G;  2K33 A;  1YIT A;  3EQL C;  3HOU H;  3GO5 A;  4DR3 Q;  1HZA A;  5A35 A;  2AMC B;  4QKO A;  2L0C A;  3GTK H;  4MTN A;  2JGP A;  2J4X A;  1K3B C;  4H2W C;  4CDE C;  4DUY Q;  2BUO A;  4L5T A;  1UWV A;  2VB3 X;  3OMG A;  1M6N A;  5IP7 H;  1ZKO A;  2I5H A;  3M7G A;  4K0K L;  4XRO A;  1L0Y B;  2QA4 P;  2DNE A;  5M3M H;  3HOX G;  3W2D A;  4KMU C;  4ZQ3 A;  2DY7 A;  4OXP A;  5F2O A;  1Z9F A;  1TWG H;  1N36 Q;  4KV6 A;  5KIX A;  4JPB W;  2UXD Q;  4CA3 A;  3HZQ A;  1U5K A;  4H02 A;  1PRT D;  3CPW O;  1VQ6 A;  4XDX A;  1Q12 A;  4LFB L;  5IE8 A;  2O4X A;  2WKD A;  4LF5 Q;  4C3J G;  1DGS A;  1SEB D;  4A75 A;  3V05 A;  4P72 A;  2MO0 A;  1IKM A;  1BBX C;  3A5U A;  3C46 A;  1EZ8 A;  2N6Y A;  5AFW A;  3CC4 P;  1BKB A;  4FF2 A;  4HID A;  1YJW P;  4DKA C;  4IPH A;  1BCP B;  2KG9 A;  4R4Q A;  4H2Y C;  3MXN B;  3OW2 A;  3IRB A;  2MJ8 A;  3PQI A;  3M4Y A;  1V8Q A;  4QNB A;  3G26 A;  3OTO Q;  4M0I A;  2M8N A;  2SDF A;  3B6Y A;  2K75 A;  2JA5 B;  4IOC A;  1GXD C;  1CM9 A;  3GTQ H;  1B9M A;  2HD3 A;  1D1I A;  4TQU S;  5EQ0 A;  4RWS C;  1E1O A;  1JQY D;  2BOS A;  1XMO Q;  3A5Z B;  1IBK L;  2KED A;  1SR3 A;  2KGC A;  1P8L A;  2OF1 A;  3HZX A;  2LY7 A;  1ILP A;  1F9Q A;  2MO1 A;  1BUV T;  4LF7 Q;  2JA7 H;  1VQF A;  5C3X A;  4HJ8 A;  1NY4 A;  2VZA A;  5E4W C;  3IL8 A;  4HSP A;  2NUC A;  4X66 Q;  2LIW A;  2JU2 A;  4F37 A;  5J39 A;  3J80 c;  2A5H A;  4KLK A;  2JEB I;  2YV5 A;  1SYC A;  4TSS A;  3HOZ H;  5ELF A;  1I3Q H;  1G2S A;  4KTA A;  2TSS A;  2GZF A;  3L2P A;  5EJD A;  5EGT A;  2WB1 G;  3OOC A;  2OAR A;  4LUV A;  4BWG B;  1WCM H;  1ICW A;  2E8G A;  4BBR G;  3F1Z A;  1N9W A;  1IYU A;  4JI8 L;  4JI1 Q;  1NUC A;  1HUN A;  4DK3 C;  3CE7 A;  1G8Z D;  4HED A;  3PIO 3;  3M7N A;  1Q8I A;  1Y1V H;  4RCO A;  1ICF B;  4YHH Q;  4HJ7 A;  2JYO A;  3D3R A;  2L4N A;  3A8K E;  1TKW B;  3T51 B;  3NTH A;  2F0W A;  4IQZ A;  3KBX A;  3RZO B;  2K5D A;  1F80 D;  4A4I A;  4KHP L;  2JA5 H;  2R92 B;  1SJE D;  2R3Z A;  4ID6 A;  2Z1C A;  3T1H L;  3ZJY C;  3D4D A;  1K73 Q;  4X65 L;  4EQP A;  2R7D A;  4LF8 L;  4YCW A;  5F2N A;  2KG6 A;  1O7Z A;  1Q1E A;  2YTY A;  1QNU A;  2RBM A;  3IFT A;  3VDY A;  1GD7 A;  5AJ3 Q;  1PZI D;  2FHS C;  1EMV A;  5IT9 L;  5CMD A;  1EYD A;  1E6J P;  3J7Y W;  4R4T A;  2F0H A;  3A8J E;  3G21 A;  3FRP B;  4B9X A;  5HV8 A;  4PH1 A;  4U67 3;  4NXM Q;  2MR8 A;  4B3R Q;  3OSO A;  2RDF A;  1QUQ A;  1CHQ D;  4DR2 Q;  4PMB A;  3CCV P;  3H94 A;  2OTL A;  3ND8 A;  1RO2 A;  3HP3 A;  2Z4H A;  5LL6 X;  4G57 A;  4DAM A;  1QIL A;  1GXH A;  4KD4 A;  3MGE A;  5HGT A;  3HOY B;  3ER0 A;  2DUD A;  2LMC B;  3B5I A;  1LT4 D;  4QJF A;  2PEN A;  4DV3 Q;  2PCF B;  3NWS A;  4A76 A;  4HIO A;  1B3Q A;  4OIJ A;  5IYD G;  3G71 P;  3HOV G;  3LX0 A;  4WJ4 A;  3PO3 B;  1VQ5 A;  2A19 A;  4CDC C;  2F4V L;  1STN A;  2LPK A;  5JJZ A;  2XZ1 C;  1VQC A;  3RZO H;  1JE4 A;  4K2L A;  3BZC A;  3GTL B;  5HGM A;  4XYO A;  1VQD A;  1SJH D;  4F87 A;  4XFY A;  4F88 A;  3GDE A;  1SYG A;  4A3E B;  1ILQ A;  5KGU A;  2F0M A;  2WIN B;  3I7F A;  1EQR A;  4PH0 A;  2ICE C;  1L0W A;  2N49 A;  2F03 A;  5CV9 A;  3T16 A;  4MHE A;  4QUF A;  4CKE A;  2JN4 A;  2MPM A;  1I94 Q;  3SEB A;  2JYG A;  4POG A;  2EHT A;  2CQA A;  4CKC A;  2M9V A;  4J15 A;  2L4B A;  3VYU A;  3CCU P;  2HDL A;  1EOV A;  5ELB A;  1VQA A;  2VQF L;  1FJG Q;  1EIF A;  2JXM B;  2PY8 A;  1QZG A;  4HKG A;  3S1M H;  2EIF A;  5HGN A;  1CQF A;  1Q7Y C;  5IOD A;  4PZ8 A;  4OON A;  1VQO A;  1TVX A;  3UE1 A;  1EL0 A;  1UNS A;  1YNN C;  2JA6 B;  3RLN A;  1Q7Y Q;  1T5X D;  3PO3 H;  1HY8 A;  5FO9 B;  5M9O A;  4Y52 H;  5ELN A;  4MIU A;  2B8F A;  5C3W A;  4OO1 H;  1VQP A;  1I6H B;  1XPO A;  1D5M C;  2PEM A;  1R4Q B;  4IPY A;  1TS4 A;  2EDG A;  4P74 A;  3TZD A;  1I50 H;  1RKN A;  3CCJ A;  4POF A;  5LMN W;  2ROQ A;  4CGY B;  5IT9 c;  2NZH A;  4IPD A;  2A68 C;  4P73 A;  1E24 A;  1TWF B;  3ICE A;  1W6J A;  5ELE A;  1OXS C;  1ENA A;  4GZY C;  1KL9 A;  2R93 B;  4JI2 L;  1KLG D;  4MTK A;  4A3I G;  3HGB A;  1GHJ A;  4IFD J;  1VQ4 A;  2EXZ A;  2F0S A;  3PO2 G;  1PMR A;  1QVC A;  1PYS B;  5IYB G;  1AZQ A;  4KY5 A;  1QCB D;  2KCC A;  3PUY A;  2J7Z A;  2MR7 A;  4X3S A;  1EYG A;  1SAP A;  2UXC L;  2UUA Q;  1NTG A;  1EOT A;  1QWY A;  3RD4 A;  1PTO B;  4HJ5 A;  2E2J H;  4JI0 Q;  3A7A B;  3CME P;  3UI2 A;  2RQX A;  2EFJ A;  3K58 A;  1AH9 A;  4K5V A;  3UDG A;  3H4E A;  4NPS A;  1N33 Q;  4LUZ A;  1NJI C;  2QNW A;  3M3Y H;  3PIP 3;  2PYK A;  2BA1 A;  5JVG 3;  3K59 A;  1FYC A;  1GHK A;  5GAH C;  2HDM A;  4DR1 Q;  3CCE A;  1ACP A;  2ICI A;  1S5C D;  4M8A A;  4RKB A;  1S72 P;  4CKB A;  2HCI A;  3HOX B;  3EA6 A;  1W6K A;  3D6W A;  1XPU A;  3PUX A;  4YCV A;  1IXR A;  2B63 H;  5BN3 A;  2EYH A;  2NVQ H;  3CXC A;  3H0D A;  3TME A;  1MZ8 A;  2VUM G;  1O7L A;  2L11 A;  3ERS X;  3I4M G;  2Q2T A;  4WFN 3;  1A3U A;  1R9T H;  3SK4 A;  2PQE A;  4C3J B;  3RLF A;  1E0H A;  4V19 0;  4RGN A;  5C44 B;  2L9H A;  3EJB A;  3T56 B;  4L8J A;  2FQ2 A;  3EFX D;  4JI3 Q;  5CV6 A;  1M1K C;  2B29 A;  2IL8 A;  3AMU A;  1CFM A;  1EU4 A;  1TWA H;  1K8A C;  2JA8 H;  4U68 A;  2E2H B;  3BDL A;  1NR4 A;  2EY2 A;  1D2B A;  1VQL A;  1B53 A;  1A3V A;  1I4P A;  1X65 A;  4OO1 I;  1JT8 A;  1QUQ B;  1LTS D;  2AUJ D;  2VLP A;  2KG8 A;  1K8A Q;  3X3N A;  2AF8 A;  1YBY A;  4A3J B;  2EYF A;  1IMQ A;  1YNX A;  2XRS D;  3S17 H;  4DV4 Q;  4RFB A;  2VNU D;  3KBG A;  1SMX A;  4UPA A;  2ZJQ A;  2P5Z X;  2Z6K C;  3RN5 A;  4DV1 L;  3CCL P;  1EQV A;  1VQN P;  3G6E A;  4JI5 L;  4RG1 A;  3J7A 5;  1PH9 A;  1IW7 C;  1AFP A;  1IKL A;  1YIJ P;  1LV9 A;  1X54 A;  1IBM Q;  4L63 B;  3S15 H;  1G51 A;  3D8G A;  3ERO A;  3HOX H;  2M2L A;  2OTJ P;  2VXW A;  2XXM A;  1BCP C;  2F3W A;  1UE5 A;  2WB1 B;  5E7N A;  1YJ9 A;  2IX1 A;  5EW5 E;  4K2K A;  3I56 P;  4JYA Q;  2Q8T A;  3TP8 A;  1YNJ C;  1N34 L;  2QCP X;  1CSQ A;  5M5X H;  1KRT A;  4LF9 Q;  3CRL C;  3TSS A;  5C4X G;  1XPR A;  3BVG A;  4IO9 A;  2Q2I A;  3RN2 A;  4GKK L;  2NN6 G;  5FK9 C;  4B9W A;  3PF4 A;  3BYY B;  3MXU A;  1PA6 A;  3FMC A;  1RHP A;  2ZM6 L;  4CJ1 B;  3V96 A;  2E2H H;  2RSN A;  1GUW A;  1M8A A;  1TXY A;  3VYR A;  1KLU D;  4JI4 Q;  5LMU L;  5I4D A;  4LF4 Q;  4I7A A;  4A3M B;  2QEX A;  2Z6K A;  3CQZ B;  1SFO H;  1EIA A;  4XXE A;  2MP1 A;  1HNZ Q;  2PI2 A;  3U43 A;  4PG3 A;  4RKL A;  2EYP A;  1VQ8 P;  4OGQ C;  1HA6 A;  3RUZ A;  2LML A;  3LWU A;  1FL0 A;  2C35 B;  3EIV A;  2RDG A;  1SE4 A;  1B2T A;  4YWK A;  2UU9 L;  3UE0 A;  1Y1W B;  5J22 A;  1SXT A;  4KKS A;  4NXN L;  4C3I G;  2F0P A;  4BPH A;  4RGT A;  2NVY B;  5M3F G;  1F9S A;  4FF4 A;  2KOQ A;  4P75 A;  1M90 C;  4L5S A;  4X3U A;  2DGY A;  2JAZ A;  4BBR H;  2FMM A;  2R7F A;  2K0D X;  1JIC A;  4EQO A;  3P1H A;  5COR A;  1LTT D;  4C3H G;  2BH8 A;  4XQQ A;  1PH2 A;  1HPC A;  2Q2H A;  4LFC Q;  1XNQ Q;  2HQL A;  5KNB A;  4LF6 Q;  1VQ7 P;  3WOE A;  1Z7T A;  1M90 Q;  1ESR A;  2RCN A;  3H0G B;  3T1Y L;  3E3X A;  1GJX A;  3LNN A;  3H6M A;  5IOC A;  3K7A B;  2MHV A;  4A3F G;  3CCQ P;  1AF8 A;  1LTG D;  1CKN B;  2Z6B A;  3OHX C;  1A2U A;  1U4R A;  1PRT F;  5JPN C;  1MSG A;  2XIW A;  4AYB B;  4DUZ L;  2KEC A;  4DV0 Q;  2K5W A;  5IWA Q;  4DR4 L;  4EQ5 A;  5M5W H;  2KA7 A;  3S14 H;  4L5R C;  3CQZ H;  5FLX E;  3STB C;  1KQS O;  5COY A;  2OQ0 A;  5GAE C;  1XMQ L;  4K6L A;  3HYB A;  1YI2 P;  3NUC A;  5IP9 G;  4ZUI A;  2IX0 A;  3CC7 A;  3WWV A;  2Z0S A;  4H44 C;  5L37 A;  2IHE A;  1AN8 A;  1PZK D;  2ZT9 C;  2FAE A;  5JJL A;  5C5L A;  2F0D A;  4IN3 A;  2EYL A;  3U4Z A;  4NKL A;  2GZG A;  4DV6 Q;  5CV4 A;  1PV4 A;  4A3D G;  2N78 A;  2NVY H;  3FKI G;  1YIT P;  3BG3 A;  3S1R H;  2E74 C;  4IPG A;  3CCS A;  1D5Z C;  1BBW A;  4AQY L;  2KCM A;  2N3S A;  3Q20 A;  2WAQ E;  2M8L A;  4DR5 Q;  2JA9 A;  3W3A A;  1DD2 A;  1IBL Q;  5IYD H;  1HR0 L;  3HOV H;  1F2Z A;  3FP9 A;  1QE6 A;  4KJO A;  2K03 A;  2RDH A;  2R6G A;  4R4O A;  1Q86 C;  5KNC A;  4MZ9 A;  1K9M C;  3H15 A;  3HOU B;  3CCM A;  4ZKB B;  5DM7 3;  4O42 A;  5ELO A;  2MD9 A;  3EVQ A;  2A73 B;  1YNN D;  1HFN A;  3QOJ A;  1K9M Q;  4KKT A;  3H47 A;  2KJX A;  3AYH B;  2F0J A;  2KQ3 A;  2LKI A;  2N50 A;  3KLS X;  1VQ6 P;  2UXB Q;  2F0Q A;  3NY7 B;  4DV7 L;  3RZD H;  1H9M A;  4B3S L;  2NVT B;  1HRJ A;  2GN5 A;  4A3L G;  1AUM A;  4DXF A;  2Y0S E;  2JK8 A;  5M3M B;  1N32 L;  1YHQ P;  2I07 B;  4S3S A;  5I9P A;  4DR7 Q;  3PO2 B;  4ME5 A;  2EPB A;  1TWG B;  2A68 D;  3NTK A;  3G4S P;  2D2C C;  3T53 B;  4DAV A;  3VR2 A;  3P05 A;  1VQH A;  3KJO A;  1B1Z A;  2B2T C;  1GOZ A;  2EYM A;  2VLN A;  5JEA J;  3UDF A;  4U0F A;  4IJH A;  4IUN A;  1H9R A;  1BNZ A;  5E1F A;  1M6E X;  2K52 A;  3SE0 A;  3L0O A;  4C56 C;  5IGF A;  3I90 A;  1KAW A;  2H5X A;  5BN5 A;  1GKH A;  1VQK A;  3ND9 A;  7CEI A;  4N8X 1;  4GOP B;  5EBC A;  1VMP A;  4FNF A;  2KHJ A;  3SXH A;  4CDD C;  1CSP A;  2F52 A;  3VR6 A;  1U4P A;  1X3P A;  4EGV A;  3CRK C;  2KEN A;  1E2Z A;  4RH6 A;  3GTQ B;  3QIA A;  1RTN A;  1J6Q A;  1YJN A;  5I2Y A;  4DR6 L;  2N5I A;  1IYJ B;  2PNH A;  3OYY A;  1JC7 A;  1O7Y A;  2JA7 B;  1J5E L;  2KOS A;  3DXJ C;  4LNQ A;  1K0S A;  4DR3 L;  2NVT H;  2VUM B;  2XSC A;  1C4Q A;  2B3G A;  3B4Q A;  3J7A V;  2MVV A;  2N5H A;  2ZTC A;  3K6O A;  1B7Y B;  5FJ8 H;  4A3I H;  1Y8N B;  4DNI A;  3HOZ B;  1HNW Q;  4FDB A;  1PTO C;  3CCR A;  3PO2 H;  1I3Q B;  1DXM A;  5IYB H;  4CBV A;  4BS9 A;  1PH1 A;  1FGU A;  3I73 A;  3F2C A;  1DOK A;  3MXP A;  4DUY L;  4ABN A;  4UP7 A;  2B2T A;  1WCM B;  1G6Z A;  1Y69 U;  4LFB Q;  1WTV A;  1VQJ A;  4XRQ A;  5HGQ A;  3CF5 A;  4X3K A;  5F2K A;  2R61 A;  1S5F D;  4HMI A;  1N36 L;  1Y1V B;  2KOO A;  1E2V A;  2UXD L;  4I7Z C;  4DV5 L;  1QB5 D;  2JSO A;  3MC0 B;  1EY8 A;  1QZH A;  4PWV B;  4HN7 A;  4OHJ A;  5JVH 3;  1XNR L;  2K50 A;  3C1F A;  3S2H B;  1SMY C;  3L3O C;  3S1Q H;  2XRQ D;  3D0F A;  2WAQ G;  2VLO A;  2OTL P;  4JCV E;  1A63 A;  1DOM A;  5FLX L;  1IL2 A;  2JB0 A;  1CHP D;  2I5M X;  4OEL B;  3K5O A;  3DS5 A;  2N55 A;  5GRO A;  2UU9 Q;  2VUM H;  4GN4 B;  4ZKC B;  4FYD A;  2KGA A;  3I4M H;  1EOQ A;  5EAY A;  1IW7 D;  1JJG A;  2C9O A;  3TS0 A;  1DZ1 A;  3ULJ A;  5C4X B;  1BCP D;  5EPJ A;  1VQ5 P;  2KUM A;  3DM3 A;  3RR5 A;  2RSO A;  2JQO A;  2KEE A;  1RDP D;  1KQS A;  2JYL A;  4X66 L;  1YNJ D;  3G29 A;  1WFQ A;  4HCE A;  1TR5 A;  2FQ1 A;  2Y0S G;  4DNR B;  2OWO A;  5I6W A;  1PH5 A;  1HHV A;  1SNP A;  4QY7 A;  3CXC O;  4GKJ Q;  1P16 A;  2KOR A;  2Z8L A;  3I2Z A;  1WTH A;  2F0U A;  1PH3 A;  2LKV A;  1KD1 C;  2KGD A;  1XX8 A;  3L9A X;  4JI1 L;  4G7O C;  3TN2 A;  1SE2 A;  3H3V H;  2B2W C;  2HHH Q;  4KHP Q;  4QUC A;  3S2H H;  2M8P A;  4WJW A;  2MY5 A;  5EKI A;  2VB2 X;  1A8O A;  1KD1 Q;  1JOO A;  4YWL A;  1KLP A;  3N6R A;  4YHH L;  4X64 Q;  4JVZ A;  2NYZ D;  5KP8 B;  4IUR A;  5K36 G;  3MHB A;  3AQQ A;  2V4D A;  2RHQ B;  1U0L A;  1JMC A;  3K0X A;  2EY6 A;  3ONA B;  3AEV A;  1LT6 D;  3CKI B;  4E6I A;  3HG9 A;  1PZJ D;  2Q8I B;  2IJ0 A;  2VQE Q;  4RGO S;  1VQO P;  1AZP A;  3EN2 A;  4C3H B;  2LTE A;  5C4X H;  4XQN A;  3D4R A;  5AJ3 L;  1K8M A;  3OW7 A;  1WTP A;  1KDA A;  2K0Y A;  3S1M B;  1VQP P;  2NN6 H;  1VQM A;  1Q82 C;  4EQN A;  3R3O A;  4J1M A;  3O13 A;  1F77 A;  3TZU A;  5C3E G;  3SK5 A;  4B3R L;  3MEH A;  3TP5 A;  4DR2 L;  3HOW H;  3CCJ P;  2ZTD A;  5JPA A;  1HFG A;  1BBU A;  5I2X A;  2DJF C;  3HKZ E;  1Q82 Q;  1D1D A;  2BH2 A;  4DPG A;  4DK0 A;  2JP1 A;  3J81 i;  1CKO A;  3Q0A A;  1IMP A;  2B2W A;  2NVX H;  3J81 E;  2F4V Q;  3D4W A;  4WOR A;  1VDZ A;  1VQ4 P;  4DV3 L;  4B3M Q;  2UUB Q;  2QDL A;  1I50 B;  1F9P A;  1MSH A;  2X6G A;  5FLX c;  4K5X A;  2GDW A;  2F0F A;  3WOF A;  4ZAI A;  3G0V A;  4A3K G;  1SN8 A;  5C5M A;  5EPL A;  3LGJ A;  1JCK B;  1FR2 A;  4KI0 A;  1C0A A;  3NK9 A;  1Z6M A;  2ZTE A;  3STB D;  4C3I H;  4QIW E;  4ZUJ A;  3QG1 A;  4PXH B;  2JQ4 A;  5KP7 B;  5M3F H;  3FKI B;  1WI5 A;  2QEJ C;  2LS0 1;  3VRL C;  1RNI A;  1F2Y A;  2EHS A;  5LMN Q;  1B8A A;  4K5W A;  3P75 A;  3DS2 A;  1E1T A;  1OTC A;  2IW3 A;  2YU9 H;  3M4P A;  3VYT A;  3D6C A;  3UDX A;  4C3H H;  2X6L A;  1JR0 D;  3A54 A;  4R9W A;  2FJ2 A;  5IGG A;  2R7Z G;  1BOS A;  1LUZ A;  3S2D H;  3GZL A;  1EFI D;  1S5D D;  1I94 L;  5EKK A;  1CT1 D;  4BPG A;  2E2J B;  4OIK A;  3CCE P;  1UUP A;  1T5E A;  1WJJ A;  3KDF B;  1BO0 A;  4A3F H;  1ZNV A;  1PFM A;  2V1C C;  5DAU A;  1NSN S;  3RG2 A;  1X56 A;  2NZO A;  1QVF A;  2K5H A;  1FJG L;  4NEO A;  2K4K A;  2K5V A;  1KDC A;  3M3Y B;  3OIP A;  1VF7 A;  5C4Z A;  4LAA A;  3H3V I;  4N8F A;  3I91 A;  5I9O A;  2ALY B;  1GVP A;  5IGE A;  1DM0 B;  4QMG A;  4BBS G;  5FO8 B;  4DXG A;  4G4K A;  4IAL A;  5KND A;  3CC2 A;  3Q8D A;  4OX9 Q;  3LMO A;  5IP9 H;  4ZYS A;  1GUN A;  4EX5 A;  2RKS A;  4DAP A;  4COC A;  1GXG A;  2B63 B;  5E4X A;  2NVQ B;  1JJC B;  2F3I A;  3K80 C;  2EXD A;  1MIU A;  3SDZ A;  1EY5 A;  1R9T B;  3HKS A;  4A3D H;  5D3D A;  5FJ8 G;  1CKN A;  3FKI H;  5LL6 S;  4HJA A;  3C2P A;  1Z47 A;  4JI2 Q;  2Z46 A;  1HQB A;  4JOI C;  1PVO A;  1CUK A;  1ZEQ X;  4U0D A;  3VR5 A;  5DM6 3;  2KOD A;  2KHS A;  1XTD A;  2AQ1 B;  1HQM C;  2NN6 I;  4DA2 A;  2MUY A;  3CMA A;  1H9S A;  3E0J A;  4PMC A;  4JV5 Q;  2WP8 J;  4ILW A;  1YHB A;  2CG5 B;  1HNX Q;  2F3V A;  4DV2 Q;  4A3G G;  4H13 C;  1TWA B;  2IWH A;  1Y14 B;  2JA8 B;  1STA A;  2MFI A;  3G6E P;  3WDN A;  3I8Z A;  2IHF A;  3I4L A;  3K5L A;  4GLA C;  3I4N G;  5BN4 A;  1PH4 A;  3K81 C;  2Z9H A;  1EUJ A;  3J7Z C;  4RGM A;  1OXX K;  1AE2 A;  2D0O A;  3JC6 6;  1SNO A;  3PUV A;  3S17 B;  2QDB A;  1UAP A;  1M4V A;  4UY8 C;  1JB7 A;  3DPH A;  2IY5 B;  5A2Q E;  3VA7 A;  1MBY A;  4RCN A;  1ZMB A;  4HAE A;  4IUV A;  4IPC A;  1K8G A;  4A3L H;  1ENF A;  2SNS A;  5LHY 1;  2EJF C;  1NJI Q;  1WTR A;  2L6E A;  1T9H A;  3S15 B;  2KBN A;  3DM1 A;  4UP9 A;  1N33 L;  2LSS A;  3K0Y A;  3HKZ G;  5C0X G;  3MFY A;  1MGS A;  2QGQ A;  2K92 A;  4GOP C;  4XFX A;  1MD2 D;  1STG A;  4JOI A;  1OXU A;  2EQS A;  3J7A F;  4KHZ A;  1V9P A;  4DR1 L;  1OR5 A;  1IL8 A;  4IZ6 A;  5M5X B;  1PTO D;  1YVC A;  2CW0 C;  1RL2 A;  4K8J A;  2D62 A;  2QEX P;  4OEM B;  1CZW A;  2OXP A;  4ZLT F;  1BAJ A;  2AFE A;  4NW2 A;  2VLQ A;  2G9H D;  2O2L D;  2CWA A;  4V0B A;  2BHV A;  2GYK A;  1KDB A;  3SK6 A;  4R1J A;  4YY3 Q;  1M1K Q;  2K14 A;  1KAA A;  2M00 A;  3TBI B;  3GJN A;  3GV6 A;  3M4Q A;  4JI3 L;  2K32 A;  3SHL A;  2JE6 I;  4IUT A;  4JI7 L;  2WAQ B;  1KRS A;  1C9O A;  2RHS B;  1SFO B;  3SGI A;  3J81 L;  3S1N H;  1AYI A;  1EYC A;  1STE A;  2ES2 A;  2LIU A;  4AH6 A;  1ET6 A;  3L7Z C;  2VL6 A;  3C3L A;  3GTJ H;  3PUW A;  1GM5 A;  1X6O A;  2L5T A;  4ZCK A;  4XQJ A;  1SMY D;  4KHV A;  2E75 C;  2ASB A;  1A0I A;  3E9I A;  2B2V A;  1EY4 A;  1GUG A;  1HXY D;  1Y8O B;  3QR8 A;  5HGL A;  4GOP A;  4DV4 L;  1SRO A;  1UE1 A;  3G6J B;  3AFQ A;  2GZJ A;  5CBA E;  2PEJ A;  2CGQ A;  4PV1 C;  3MA2 B;  1HZC A;  4BBR B;  1EY0 A;  4PMW A;  1A62 A;  2H4O A;  3D31 A;  1B4O A;  1IBM L;  2I0Q A;  1K8O A;  3H3V C;  4QGU A;  5JPM C;  3BVZ A;  1SYB A;  3H09 A;  1BDO A;  3FEW X;  2Z44 A;  1RTO A;  3GTO H;  1VHN A;  4XIG S;  2A6E C;  3TS2 A;  1BQQ T;  5DCK A;  3C1E A;  2BDO A;  1VQ9 P;  3CP0 A;  1WOC A;  1L1O B;  1E22 A;  3H91 A;  3NQT A;  3HOW G;  3CC7 P;  3G1G A;  4ODG A;  3KF8 A;  1D7Q A;  2ERH A;  1WYD A;  3S14 B;  1SYF A;  5M5W B;  3PUZ A;  2JJQ A;  1XWE A;  3K7U C;  2O5I C;  4DN4 M;  4CHT B;  4NP5 A;  2PMZ E;  4JI6 L;  1E7Z A;  2EJM A;  1NQ4 A;  4JBJ A;  1WTX A;  5CV5 A;  1LT3 D;  4DU9 A;  3CCS P;  1MI2 A;  2JU1 A;  1D6E C;  1IHZ A;  2F1M A;  1TII D;  2E5L Q;  1J9O A;  2FAD A;  1PH7 A;  4KKU A;  2PEO A;  4JI4 L;  1PHJ A;  2EYJ A;  4LFA Q;  4LF4 L;  5BR8 Q;  2XZ0 D;  4PNY A;  2RA4 A;  4RMF A;  5EJW A;  3U50 C;  2HIX A;  2LXJ A;  5E3F A;  3KF6 B;  2IX3 A;  4ALP A;  1TS5 A;  5KYL A;  3S1R B;  3CCM P;  2PZT A;  2EY5 A;  3AB9 A;  2R92 G;  1JWU D;  2CWP A;  2MQH A;  4A3C G;  1G6P A;  1EY7 A;  1FD7 D;  1O80 A;  1H95 A;  2K0X A;  2NZ1 D;  2CQO A;  5K5P A;  4Q5V A;  3HOV B;  3P20 A;  2A74 C;  3TP7 A;  4QQB X;  3NTE A;  1RO0 A;  1H9J A;  4EVO A;  2K04 A;  3BU2 A;  1KC8 C;  2KWL A;  5KP6 B;  3Q23 A;  1JB3 A;  1W2B A;  1U4M A;  1XNQ L;  2PW7 A;  3NEM A;  4LFC L;  1WVL A;  3VA5 A;  1YIJ A;  4LF6 L;  4DUZ Q;  3J81 c;  3IKJ A;  1H9S B;  5A2Q L;  4DR4 Q;  2F0T A;  5CV8 A;  4HR7 B;  3CAM A;  5K36 H;  3DWQ A;  2K05 A;  3NWT A;  3RZD B;  2SNM A;  5JOB A;  3T4A C;  5IGB A;  1TWH H;  3HOY G;  2PEQ A;  2L12 A;  5HUR A;  3F2U A;  3I56 A;  4DAY B;  1SNM A;  5T1G A;  1PLF A;  2CNR A;  3MEF A;  4DV0 L;  1DON A;  3PCO B;  5EBD A;  5IWA L;  4J8Q A;  2UUC Q;  1VQK P;  4IUU A;  1SNC A;  1TS2 A;  1G91 A;  2WKC A;  1KNA A;  2XNA C;  3BJU A;  3I55 A;  1I4X A;  1I6V C;  2XV6 A;  3IAY A;  2R7Z B;  4H2X C;  1AE3 A;  2Z4I A;  3HFZ B;  1X3F A;  3FPU B;  4LW1 A;  1VMC A;  2FHT A;  4QL5 A;  3TQY A;  1YJN P;  5C3E H;  2BCO A;  1CZG A;  1HUM A;  1NAP A;  3PMF A;  1EY9 A;  1U4L A;  4BA1 I;  4A3E G;  3EJE A;  2HT1 A;  4DV6 L;  2A1A A;  2EIA A;  3NP8 A;  3AFP A;  3CD6 A;  3TEH B;  5NUC A;  3EBE A;  1HR0 Q;  1QOH A;  2GDY A;  2XWB B;  3NBH B;  2NTS A;  1NBW A;  4HTH A;  1LTB D;  3KOJ A;  2FMC A;  1C8C A;  3BZK A;  2HQE A;  3G28 A;  3DHQ A;  1JWM D;  4RHS A;  3JAM i;  4BBS B;  3JAM E;  4JBM A;  1VQ8 A;  3PGZ A;  4GR2 A;  4LMQ D;  4DR5 L;  1Q86 Q;  2K28 A;  3MZ5 A;  4FXG C;  1GO3 E;  1J8I A;  4A3K H;  2DNC A;  4IUP A;  1EWI A;  4OWT B;  1V1O A;  2CWO A;  4BY7 G;  3DS4 A;  1HZ9 A;  1PYB A;  3K5M A;  4APV A;  3GTP H;  3V2T A;  3A74 A;  4A3I B;  3KK7 A;  1A15 A;  4UP8 A;  1X9N A;  2NB0 A;  1QVG A;  4FF1 A;  4COP A;  1SRU A;  2JA6 G;  1LLR D;  4FVM A;  2K5N A;  3DWA A;  2DJG C;  4X62 Q;  4P71 A;  3PIP A;  2UXB L;  5IGD A;  4FXD A;  5JAV A;  4TRD A;  1G2T A;  1WTW A;  1HR0 W;  2R7Z H;  3S16 H;  4N9T A;  3CCQ A;  4DR7 L;  2XTI A;  4Y7N B;  3I4N B;  4P2C B;  5C4J H;  3OPO A;  2GVB A;  4H7B A;  4FF3 A;  2OQK A;  4QB4 A;  2PQA B;  2K5X A;  4L5Q A;  2AVA A;  2MF4 A;  2R93 G;  2FFK B;  3DS3 A;  4UAI A;  3EJD A;  4B3T Q;  1BXT A;  2KOL A;  5DLQ E;  2QW7 A;  3M1M A;  3RG6 C;  1K0R A;  2LOL A;  2MGS A;  3BYT B;  4BBS H;  2NWG A;  3S1Q B;  3AU7 A;  1UEB A;  1QJO A;  1SNQ A;  3E6Z X;  2F0O A;  4NDX A;  3CU7 A;  4J6H A;  4PZ6 A;  2F0I A;  3TP6 A;  3MTS A;  1XXG A;  1PRT B;  1HJP A;  2DN8 A;  1ENC A;  4H0L C;  2TMP A;  1R4P B;  3QO2 A;  4JW0 A;  1J5E Q;  1A3T A;  3A0J A;  3I4M B;  1JWS D;  3KDF A;  4WYM A;  1EWH A;  2KCN A;  4K0K Q;  1QVF O;  3G48 A;  2J0T D;  3NHH A;  4PQX A;  3KF8 B;  1II3 A;  3WBH A;  2N88 A;  2F0L A;  3KLS A;  1WTQ A;  1Q46 A;  2FXQ A;  4CDF C;  1K3R A;  3NXW A;  2E2I H;  2L0Q A;  3J81 j;  3P7J A;  4A3G H;  3BDC A;  4QIW B;  3DS0 A;  2AWO A;  2CW0 D;  1HNW L;  1PH8 A;  4XT1 B;  3SVM A;  3I70 A;  1HTP A;  4FXK C;  1FR3 A;  4Y7N H;  3I4N H;  1SDF A;  5D65 A;  2EOT A;  1EFW A;  1V43 A;  2Q8R E;  1UE7 A;  2K5Q A;  4DV5 Q;  1K83 H;  1FNV A;  4LJZ C;  4LF5 L;  1RD9 D;  5BS2 A;  1X3G A;  1B50 A;  3DEO A;  1XNR Q;  4AYB E;  1FNW A;  2VSQ A;  2OT2 A;  4DK1 A;  5C44 G;  1JOR A;  3R93 A;  1YHQ A;  4JK1 C;  5H1S E;  1HQR D;  2A6H C;  2PNR C;  4L6T B;  5CYU A;  5FKA C;  4A3B H;  2WFW A;  3DTJ A;  1C7Y A;  1LAB A;  3G4S A;  4O2D A;  1IBK Q;  2F0K A;  3OTO L;  5C0X H;  1VQM P;  1X3Q A;  3DUZ A;  1DCZ A;  3NPP A;  2B39 A;  2N8N A;  4LWC A;  1EWC A;  1LTI D;  1L0X B;  5CZD B;  1LO5 D;  1XMO L;  2CQ8 A;  1ASY A;  2GA4 B;  3F2B A;  5F2D A;  3LWE A;  3R2I A;  3GTM B;  3VR4 A;  4A3J G;  1TU2 B;  1TS3 A;  1OXV A;  2VY3 A;  4Q0F A;  4LF7 L;  4LUO A;  2WAC A;  4GN3 B;  2LL8 A; 
#chains in the Genus database with same CATH homology
 4IFD G;  3G1I A;  4WJ3 M;  4JI8 Q;  2ZJR A;  4MNO A;  1MJE A;  4IJL A;  1PFS A;  2L15 A;  1JJ2 A;  2QA4 A;  3T1H Q;  4BXX G;  2OCE A;  4X65 Q;  4GKJ L;  4LF8 Q;  1D8L A;  4BY1 G;  1K73 C;  1FVI A;  2HHH L;  1YHA A;  1L1O C;  3FHW A;  5HGO A;  3CC4 A;  3GTM H;  1YJW A;  4X64 L;  4A3M G;  1KIX A;  1X55 A;  4NXM L;  4GNX C;  1G29 1;  2VQE L;  3CC2 P;  1MKH A;  5IYC G;  1Y1W G;  4XFZ A;  1Q1B A;  1YEZ A;  1YZ6 A;  5C0X I;  3CMA P;  3H0G G;  4A93 G;  3GD7 A;  4YWM A;  4JBK A;  1L1O A;  4B3M L;  3PV0 A;  2UUB L;  2R92 H;  4AYB G;  5FLM G;  3U58 A;  4A3C H;  2VQF Q;  2E1M A;  2PI2 E;  4GNX A;  2RF4 A;  4JG2 A;  1RIP A;  5LMN L;  2JO0 A;  2P9X A;  2ZJP A;  1LTL A;  2CFM A;  3KF6 A;  3S24 A;  3JAM c;  3HOY H;  4U0C A;  2AWN A;  3DLL A;  3I4O A;  3CCV A;  1LM0 A;  1S3O A;  3GTG H;  3HOU G;  3CPW A;  1W2B O;  4GLX A;  3PSI A;  1VQL P;  3GTL H;  4OX9 L;  3G71 A;  2A8V A;  2VS1 A;  4A3E H;  1KXL A;  5GQO A;  4AIM A;  2UXC Q;  3NEL A;  1VCI A;  5IP7 G;  5M3M G;  1O7I A;  3NEN A;  5J3B A;  2YYZ A;  4JV5 L;  3CPF A;  1HNX L;  4DV2 L;  1YJ9 P;  2JEA I;  2UUA L;  4BY7 H;  4JI0 L;  3UDI A;  1SLJ A;  4R4C A;  3F8T A;  1BVS A;  4O0A A;  3CW2 C;  4GN5 A;  4A3B G;  3CCU A;  2KHI A;  2JA6 H;  2CKZ B;  1L2F A;  1I6H H;  4YCU A;  4JC0 A;  5BS1 A;  1OXT A;  3M4O H;  1K30 A;  2JA7 G;  1TWF H;  1PH6 A;  2R93 H;  2VW9 A;  1QVG O;  3HOZ G;  1LYL A;  2YTV A;  1JE5 A;  4DK6 C;  1I5F A;  1WCM G;  4JI7 Q;  5I4T G;  1SE8 A;  4YY3 L;  4DV1 Q;  1QRJ A;  4JI5 Q;  3PIO A;  1Y1V G;  2GVA A;  2PQA A;  5HY6 A;  4NB3 A;  2JA5 G;  5JJI A;  3M85 A;  3ULP A;  4IOA A;  3CME A;  1N34 Q;  1IUQ A;  2PEK A;  3E0E A;  1X3E A;  3J80 i;  2PEI A;  3KFU A;  4GR6 A;  5JEA G;  3K8A A;  4GKK Q;  2D0P A;  4JYA L;  1HZB A;  2ZM6 Q;  4C3J H;  4LF9 L;  5C44 H;  3TRZ A;  1S72 A;  4R4I A;  3I55 P;  5LMU Q;  4GS3 A;  3U4V A;  3ULL A;  4GNX B;  4JI6 Q;  4JBW A;  1EQQ A;  1HH2 P;  3LRY A;  4TVA B;  4X6A H;  3CD6 P;  4A3J H;  4NXN Q;  1HNZ L;  2ONT A;  1KHI A;  2E5L L;  1NMG A;  2AKW B;  4LFA L;  4GLV B;  5BR8 L;  3OW2 O;  1IZ6 A;  4OWW B;  1XJV A;  2MNA A;  1VS0 A;  3T1Y Q;  2EG5 A;  3E2D A;  2ATW A;  3CCL A;  1VQN A;  1CKM A;  1VQE A;  1TWC H;  1KC8 Q;  4BXX H;  2HIV A;  1M74 A;  2OTJ A;  3W5O A;  4BY1 H;  1VQB A;  3RLO A;  4HIM A;  5JJK A;  3RNU A;  4OWX B;  1XMQ Q;  1A8V A;  1B70 B;  5GAG C;  3PO3 G;  3PF5 A;  4OO1 G;  4A3M H;  1VQG A;  2Z45 A;  1VQI A;  5C0X J;  1JJ2 O;  4ME3 A;  4HJ9 A;  1Q81 C;  1VQ9 A;  2LXK A;  1ASZ A;  3W1B A;  4AQY Q;  5GAD C;  2XT1 A;  3KLW A;  2UUC L;  4XTC S;  1Q81 Q;  1MJC A;  5IYC H;  1Y1W H;  2ID0 A;  2CCZ A;  3M9B A;  2IT1 A;  2Q2U A;  3CCR P;  1NE3 A;  4PZ7 A;  2AHO B;  2LF4 A;  1IBL L;  1W3S A;  1E3P A;  5M5Y H;  1S40 A;  3H0G H;  3DS1 A;  4A93 H;  4DV7 Q;  5IY0 A;  3KYH C;  4B3S Q;  3K7A H;  4U0A A;  1V1Q A;  1N32 Q;  3F2D A;  4U0B A;  5FLM H;  3W1G A;  2WB1 E;  2YTX A;  1VQ7 A;  4IFD I;  1N8R C;  4C2M H;  2I5L X;  4BA2 I;  1N8R Q;  1Q8K A;  4HIK A;  2XGT A;  2B63 G;  4X62 L;  2BA0 A;  1NMF A;  1EIY B;  4U0E A;  3E9H A;  3KJP A;  1A43 A;  1YI2 A;  1UE6 A;  4DR6 Q;  3TRE A;  2KCT A;  4B3T L;  2JA8 G;  1YIT A;  3HOU H;  3GO5 A;  4DR3 Q;  1HZA A;  2AMC B;  3GTK H;  4MTN A;  4DUY Q;  2BUO A;  4L5T A;  1UWV A;  1M6N A;  5IP7 H;  2I5H A;  4K0K L;  4XRO A;  2QA4 P;  5M3M H;  3HOX G;  4OXP A;  5F2O A;  1Z9F A;  1TWG H;  1N36 Q;  2UXD Q;  1U5K A;  3HZQ A;  4H02 A;  3CPW O;  1VQ6 A;  1Q12 A;  4LFB L;  5IE8 A;  4LF5 Q;  1DGS A;  4A75 A;  4P72 A;  2MO0 A;  3A5U A;  3CC4 P;  1BKB A;  4HID A;  1YJW P;  4DKA C;  4IPH A;  4R4Q A;  3MXN B;  3OW2 A;  3IRB A;  4QNB A;  3G26 A;  3OTO Q;  4M0I A;  2M8N A;  3B6Y A;  2K75 A;  4IOC A;  3GTQ H;  4TQU S;  1E1O A;  1XMO Q;  3A5Z B;  1IBK L;  1SR3 A;  1P8L A;  2MO1 A;  4LF7 Q;  2JA7 H;  1VQF A;  4HJ8 A;  1NY4 A;  2VZA A;  4X66 Q;  3J80 c;  4KLK A;  2JEB I;  2YV5 A;  3HOZ H;  1I3Q H;  3L2P A;  2WB1 G;  2OAR A;  4LUV A;  1WCM H;  4BBR G;  2E8G A;  3F1Z A;  1N9W A;  4JI8 L;  4JI1 Q;  4DK3 C;  3M7N A;  1Y1V H;  4YHH Q;  4HJ7 A;  4A4I A;  4KHP L;  2JA5 H;  3T1H L;  3ZJY C;  1K73 Q;  4X65 L;  2R7D A;  4LF8 L;  4YCW A;  5F2N A;  1Q1E A;  2YTY A;  3VDY A;  1GD7 A;  5AJ3 Q;  1E6J P;  4R4T A;  3G21 A;  4NXM Q;  4PH1 A;  4B3R Q;  1QUQ A;  4DR2 Q;  3CCV P;  2OTL A;  1RO2 A;  4DAM A;  3MGE A;  3ER0 A;  2DUD A;  3B5I A;  4QJF A;  2PEN A;  4DV3 Q;  4A76 A;  4HIO A;  5IYD G;  3G71 P;  3HOV G;  4WJ4 A;  1VQ5 A;  2A19 A;  2F4V L;  3RZO H;  1VQC A;  3BZC A;  5HGM A;  1VQD A;  4XFY A;  3GDE A;  3I7F A;  1EQR A;  4PH0 A;  1L0W A;  2N49 A;  1I94 Q;  2JYG A;  4POG A;  4J15 A;  3CCU P;  1EOV A;  1VQA A;  2VQF L;  1FJG Q;  1EIF A;  2PY8 A;  1QZG A;  3S1M H;  2EIF A;  5HGN A;  1Q7Y C;  4PZ8 A;  4OON A;  1VQO A;  3UE1 A;  3RLN A;  1Q7Y Q;  3PO3 H;  4Y52 H;  5ELN A;  1VQP A;  1XPO A;  2PEM A;  4IPY A;  4P74 A;  1I50 H;  3CCJ A;  4POF A;  5LMN W;  5IT9 c;  2NZH A;  4IPD A;  4P73 A;  1E24 A;  3ICE A;  1OXS C;  1KL9 A;  4JI2 L;  4A3I G;  4IFD J;  1VQ4 A;  3PO2 G;  1QVC A;  1PYS B;  5IYB G;  3PUY A;  1EYG A;  2UXC L;  2UUA Q;  1NTG A;  4HJ5 A;  2E2J H;  4JI0 Q;  3CME P;  2EFJ A;  1AH9 A;  3UDG A;  3H4E A;  4NPS A;  1N33 Q;  4LUZ A;  1NJI C;  3M3Y H;  2BA1 A;  5GAH C;  4DR1 Q;  3CCE A;  1S72 P;  1XPU A;  3PUX A;  4YCV A;  1IXR A;  2B63 H;  2NVQ H;  3CXC A;  3H0D A;  2VUM G;  3ERS X;  3I4M G;  2Q2T A;  1R9T H;  3RLF A;  4JI3 Q;  1M1K C;  2B29 A;  1TWA H;  1K8A C;  2JA8 H;  1VQL A;  4OO1 I;  1X65 A;  1JT8 A;  1QUQ B;  1K8A Q;  1YBY A;  3S17 H;  1YNX A;  4DV4 Q;  2VNU D;  1SMX A;  4UPA A;  2ZJQ A;  2Z6K C;  3RN5 A;  4DV1 L;  3CCL P;  1VQN P;  3G6E A;  4JI5 L;  4RG1 A;  3J7A 5;  1PH9 A;  1YIJ P;  1X54 A;  1IBM Q;  3S15 H;  1G51 A;  3HOX H;  2OTJ P;  2XXM A;  1UE5 A;  5E7N A;  1YJ9 A;  2IX1 A;  3I56 P;  4JYA Q;  1N34 L;  5M5X H;  1CSQ A;  4LF9 Q;  1KRT A;  5C4X G;  1XPR A;  4IO9 A;  2Q2I A;  3RN2 A;  4GKK L;  2NN6 G;  3PF4 A;  1PA6 A;  2ZM6 L;  2E2H H;  1TXY A;  4JI4 Q;  5LMU L;  4LF4 Q;  2QEX A;  2Z6K A;  1SFO H;  1EIA A;  1HNZ Q;  2PI2 A;  4PG3 A;  1VQ8 P;  1FL0 A;  2C35 B;  3EIV A;  4YWK A;  3UE0 A;  4NXN L;  5M3F G;  4P75 A;  1M90 C;  4L5S A;  4BBR H;  2DGY A;  2R7F A;  1XNQ Q;  2BH8 A;  1PH2 A;  2Q2H A;  4LFC Q;  2HQL A;  4LF6 Q;  1VQ7 P;  1M90 Q;  2RCN A;  3T1Y L;  4A3F G;  3CCQ P;  1CKN B;  4DUZ L;  4DV0 Q;  5IWA Q;  4DR4 L;  4EQ5 A;  5M5W H;  3S14 H;  4L5R C;  3CQZ H;  3STB C;  1KQS O;  2OQ0 A;  5GAE C;  1XMQ L;  3HYB A;  1YI2 P;  5IP9 G;  2IX0 A;  3CC7 A;  3WWV A;  2Z0S A;  2IHE A;  5JJL A;  3U4Z A;  4DV6 Q;  1PV4 A;  4A3D G;  2N78 A;  2NVY H;  3FKI G;  1YIT P;  3S1R H;  4IPG A;  3CCS A;  1BBW A;  4AQY L;  2KCM A;  2N3S A;  3Q20 A;  2WAQ E;  2M8L A;  4DR5 Q;  2JA9 A;  1IBL Q;  5IYD H;  1HR0 L;  3HOV H;  3FP9 A;  4R4O A;  1Q86 C;  2R6G A;  1K9M C;  4MZ9 A;  3H15 A;  3CCM A;  5ELO A;  1K9M Q;  3H47 A;  3AYH B;  1VQ6 P;  2UXB Q;  4DV7 L;  3RZD H;  4B3S L;  2GN5 A;  4A3L G;  1AUM A;  2Y0S E;  2JK8 A;  1N32 L;  1YHQ P;  4DR7 Q;  3G4S P;  3P05 A;  1VQH A;  3KJO A;  5JEA J;  3UDF A;  4U0F A;  4IJH A;  1M6E X;  2K52 A;  3L0O A;  1KAW A;  2H5X A;  1GKH A;  1VQK A;  4GOP B;  2KHJ A;  1CSP A;  2F52 A;  2KEN A;  1J6Q A;  1YJN A;  4DR6 L;  1IYJ B;  2PNH A;  3OYY A;  1J5E L;  4LNQ A;  4DR3 L;  2NVT H;  2B3G A;  2ZTC A;  5FJ8 H;  1B7Y B;  4A3I H;  4DNI A;  1HNW Q;  4FDB A;  3CCR A;  3PO2 H;  5IYB H;  1PH1 A;  1FGU A;  3F2C A;  4DUY L;  4UP7 A;  4LFB Q;  1VQJ A;  4XRQ A;  5HGQ A;  3CF5 A;  5F2K A;  1N36 L;  2UXD L;  4DV5 L;  1QZH A;  1XNR L;  2K50 A;  3S1Q H;  3D0F A;  2WAQ G;  4JCV E;  2OTL P;  1A63 A;  1IL2 A;  2I5M X;  3DS5 A;  5GRO A;  2UU9 Q;  2VUM H;  4GN4 B;  3I4M H;  1EOQ A;  5EAY A;  1JJG A;  3TS0 A;  3ULJ A;  1VQ5 P;  3RR5 A;  3DM3 A;  2JQO A;  1KQS A;  2JYL A;  4X66 L;  3G29 A;  1WFQ A;  2Y0S G;  2OWO A;  1PH5 A;  4QY7 A;  3CXC O;  4GKJ Q;  1P16 A;  3I2Z A;  1PH3 A;  1KD1 C;  4JI1 L;  3H3V H;  2HHH Q;  4KHP Q;  3S2H H;  2M8P A;  1A8O A;  1KD1 Q;  4YWL A;  4YHH L;  4X64 Q;  5K36 G;  3AQQ A;  2RHQ B;  1U0L A;  1JMC A;  3K0X A;  3AEV A;  2VQE Q;  1VQO P;  3EN2 A;  5C4X H;  5AJ3 L;  1VQP P;  1VQM A;  1Q82 C;  5C3E G;  4B3R L;  4DR2 L;  3HOW H;  3CCJ P;  2ZTD A;  5JPA A;  1BBU A;  3HKZ E;  1Q82 Q;  1D1D A;  2BH2 A;  4DPG A;  3J81 i;  1CKO A;  2NVX H;  2F4V Q;  1VQ4 P;  4DV3 L;  4B3M Q;  2UUB Q;  5FLX c;  3G0V A;  4A3K G;  1SN8 A;  3LGJ A;  4KI0 A;  1C0A A;  2ZTE A;  3STB D;  4C3I H;  4QIW E;  5M3F H;  1WI5 A;  3VRL C;  1RNI A;  5LMN Q;  1B8A A;  3DS2 A;  1E1T A;  1OTC A;  2YU9 H;  3M4P A;  3UDX A;  4C3H H;  2R7Z G;  1LUZ A;  3S2D H;  1I94 L;  3CCE P;  4A3F H;  1WJJ A;  3KDF B;  2V1C C;  1X56 A;  2NZO A;  1QVF A;  2K5H A;  1FJG L;  2K4K A;  2K5V A;  3H3V I;  2ALY B;  1GVP A;  4BBS G;  3CC2 A;  3Q8D A;  4OX9 Q;  5IP9 H;  4EX5 A;  4COC A;  1JJC B;  2F3I A;  3K80 C;  2EXD A;  1MIU A;  4A3D H;  3HKS A;  5FJ8 G;  1CKN A;  3FKI H;  4HJA A;  1Z47 A;  4JI2 Q;  2Z46 A;  4JOI C;  1PVO A;  1CUK A;  4U0D A;  2KOD A;  1XTD A;  2NN6 I;  3CMA A;  4JV5 Q;  2WP8 J;  1YHB A;  1HNX Q;  4DV2 Q;  4A3G G;  1Y14 B;  2MFI A;  3G6E P;  2IHF A;  4GLA C;  3I4N G;  1PH4 A;  3K81 C;  1EUJ A;  3J7Z C;  1OXX K;  1AE2 A;  2D0O A;  3JC6 6;  3PUV A;  4UY8 C;  1JB7 A;  3DPH A;  2IY5 B;  1ZMB A;  1K8G A;  4IPC A;  4A3L H;  1NJI Q;  2L6E A;  1T9H A;  2KBN A;  4UP9 A;  1N33 L;  2LSS A;  3HKZ G;  5C0X G;  2QGQ A;  4GOP C;  4XFX A;  4JOI A;  1OXU A;  2EQS A;  4KHZ A;  1V9P A;  4DR1 L;  1YVC A;  1RL2 A;  2D62 A;  2QEX P;  1BAJ A;  2CWA A;  2BHV A;  4R1J A;  4YY3 Q;  1M1K Q;  2K14 A;  3M4Q A;  4JI3 L;  2JE6 I;  4JI7 L;  1KRS A;  1C9O A;  2RHS B;  3SGI A;  3S1N H;  2ES2 A;  4AH6 A;  3L7Z C;  2VL6 A;  3GTJ H;  3PUW A;  1GM5 A;  1X6O A;  2ASB A;  1A0I A;  3E9I A;  5HGL A;  4GOP A;  4DV4 L;  1SRO A;  1UE1 A;  3AFQ A;  2PEJ A;  1HZC A;  4PMW A;  1A62 A;  3D31 A;  1IBM L;  2I0Q A;  4QGU A;  2Z44 A;  3GTO H;  4XIG S;  3TS2 A;  5DCK A;  1VQ9 P;  3CP0 A;  1WOC A;  1L1O B;  1E22 A;  3HOW G;  3CC7 P;  3G1G A;  1D7Q A;  1WYD A;  3PUZ A;  2JJQ A;  3K7U C;  2PMZ E;  4JI6 L;  1E7Z A;  4JBJ A;  3CCS P;  2E5L Q;  1PH7 A;  2PEO A;  4JI4 L;  1PHJ A;  4LFA Q;  4LF4 L;  5BR8 Q;  4RMF A;  3U50 C;  2HIX A;  2LXJ A;  3KF6 B;  4ALP A;  3CCM P;  2R92 G;  2CWP A;  2MQH A;  4A3C G;  1G6P A;  1H95 A;  2CQO A;  4QQB X;  3NTE A;  1RO0 A;  3BU2 A;  1KC8 C;  1W2B A;  1XNQ L;  3NEM A;  4LFC L;  1YIJ A;  4LF6 L;  4DUZ Q;  3J81 c;  4DR4 Q;  3CAM A;  1TWH H;  3HOY G;  2PEQ A;  3I56 A;  4DAY B;  3MEF A;  4DV0 L;  3PCO B;  5IWA L;  2UUC Q;  1VQK P;  3BJU A;  3I55 A;  2XV6 A;  1AE3 A;  3HFZ B;  1X3F A;  4LW1 A;  4QL5 A;  3TQY A;  1YJN P;  5C3E H;  4BA1 I;  4A3E G;  2HT1 A;  4DV6 L;  2A1A A;  2EIA A;  3AFP A;  3CD6 A;  3TEH B;  1HR0 Q;  3EBE A;  3NBH B;  1NBW A;  3KOJ A;  3BZK A;  3G28 A;  3JAM i;  4JBM A;  1VQ8 A;  3PGZ A;  4GR2 A;  4DR5 L;  1Q86 Q;  1GO3 E;  4A3K H;  1EWI A;  4OWT B;  2CWO A;  4BY7 G;  3DS4 A;  1HZ9 A;  1PYB A;  4APV A;  3GTP H;  3A74 A;  4UP8 A;  1X9N A;  1QVG A;  4COP A;  1SRU A;  2JA6 G;  2K5N A;  4X62 Q;  4P71 A;  3PIP A;  2UXB L;  1HR0 W;  2R7Z H;  3S16 H;  3CCQ A;  4DR7 L;  2XTI A;  5C4J H;  2GVB A;  2OQK A;  2PQA B;  4L5Q A;  2R93 G;  3DS3 A;  4B3T Q;  5DLQ E;  3M1M A;  3RG6 C;  1K0R A;  4BBS H;  1UEB A;  4PZ6 A;  1HJP A;  1J5E Q;  3A0J A;  3KDF A;  4WYM A;  4K0K Q;  1QVF O;  3G48 A;  3KF8 B;  3WBH A;  1Q46 A;  2FXQ A;  1K3R A;  2E2I H;  3J81 j;  4A3G H;  3DS0 A;  2AWO A;  1HNW L;  1PH8 A;  4Y7N H;  3I4N H;  1EFW A;  1V43 A;  1UE7 A;  4DV5 Q;  1K83 H;  4LF5 L;  5BS2 A;  1X3G A;  1XNR Q;  4AYB E;  5C44 G;  1YHQ A;  5H1S E;  4A3B H;  2WFW A;  3DTJ A;  1C7Y A;  3G4S A;  4O2D A;  1IBK Q;  3OTO L;  1VQM P;  2N8N A;  4LWC A;  1ASY A;  1XMO L;  3F2B A;  4A3J G;  1OXV A;  2VY3 A;  4LF7 L;  4LUO A;  4GN3 B;  2UU9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...