2DGYA

Solution structure of the eukaryotic initiation factor 1a in mgc11102 protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
111
Chain Sequence
b'GSSGSSGEHIVPSNQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGC11102 protein
publication title Solution structure of the eukaryotic initiation factor 1A in MGC11102 protein
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 10
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.180 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2dgyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2dgyA01
3GDEA 1HZCA 3E9IA 3ER0A 3OTOL 3JAMi 3BZCA 3GTLH 1QVFA 5GROA 4X62Q 2B63H 2KBNA 4JG2A 3GTOH 1G51A 1UE5A 2OTLA 3CC4A 1JJCB 4YHHQ 1OXUA 4TVAB 4DR4L 3CXCA 1IXRA 3H3VH 5FLXc 4Y7NH 3RR5A 5M3FG 1OXXK 1Q46A 3M9BA 3HKSA 4AYBG 2MNAA 3PIOA 3BJUA 4DV3Q 3K7UC 2DGYA 1V43A 2UUAQ 3GTMH 3I56A 3G6EA 1NY4A 1EIFA 1E22A 3GTGH 4DV0Q 3K81C 5IP7H 5IT9c 3M85A 3HOYH 3T1YQ 4UPAA 2CFMA 2IHFA 3PSIA 1VQLA 3W5OA 2UXDQ 1NBWA 4IFDI 4IPHA 3E9HA 4YCVA 4NXNL 2K52A 4JOIC 1EQRA 4P72A 5H1SE 5GAEC 3KF6A 1SFOH 1IBKL 1WYDA 1GKHA 4X6AH 2BA1A 2Y0SG 3K0XA 3TRZA 4A3IG 3E0EA 4JI3L 2D62A 2HHHL 1TWCH 2PI2E 4GNXC 1S72A 1GVPA 1T9HA 4R4TA 1CUKA 4MZ9A 1CKMA 1PVOA 5C4XG 4HIDA 3HOVG 4L5RC 3UDIA 2JA7G 4B3RQ 4LUVA 1NMGA 4GNXB 4GLAC 4X66L 1N33L 4IFDG 1C0AA 1SE8A 1A62A 3H15A 2RHQB 3RLOA 4JI2L 4GN5A 4LFCQ 2B63G 2N3SA 2XTIA 2BH2A 3RLNA 1FL0A 1QVCA 1Q82C 3A0JA 5IWAQ 1XMOL 1KC8C 2ES2A 1Q1EA 1RL2A 4QJFA 4XIGS 1D7QA 3KJOA 1PH4A 1Y14B 4YWKA 2QA4A 1N36L 3DM3A 5GADC 5AJ3Q 2ZTEA 4B3ML 4JI4Q 4DV4Q 1VQCA 3SGIA 3T1HQ 1R9TH 1C7YA 4GKJQ 2JA9A 2JEBI 2ASBA 2A8VA 1HNZQ 4HIOA 3ULLA 4DAYB 2YTVA 3OYYA 2Q2IA 3HOYG 1HZBA 1YHQA 1VQDA 2QGQA 3I4NH 3CCRA 1MJEA 5IYCH 3S2HH 1WFQA 2N8NA 1GM5A 1HR0Q 1IBLL 4LFBQ 1HNWL 3HOXH 1XNRL 2WFWA 1L0WA 2C35B 2ZTDA 4X65Q 1YITA 1TWGH 1Q86C 1IBMQ 4FDBA 1HH2P 4A76A 2CCZA 1YVCA 3F1ZA 3HOWH 3ULJA 5M3MH 4DNIA 4KI0A 2R7DA 1VQJA 4A3JG 2VUMG 1FJGQ 5JJIA 2Q2HA 3CC7A 3S17H 4DUZL 1G291 4IO9A 1SLJA 2B3GA 4BBSH 1VQBA 3CP0A 1EOVA 3G4SA 4LFAL 4UY8C 1QZHA 3KDFA 3I4OA 1N32L 2NVXH 4UP9A 2K75A 2A19A 3RZDH 2WB1E 2FXQA 3H0GH 1YJ9A 1UE1A 4DV1Q 3RZOH 1HR0W 5K36G 2L15A 1XNQL 4HJ7A 3RLFA 4LF5L 1N34Q 1K83H 2JE6I 1KRTA 2ZM6L 3CPFA 2JA5G 4OX9L 3ULPA 4DV5L 5DLQE 5FJ8G 5IYDG 2E2JH 4IPDA 3A5ZB 4A3BH 2Z6KA 2A1AA 3AQQA 3STBD 5IYCG 2ZTCA 5GAGC 2JA8H 2EQSA 1OXVA 2R93G 2AWOA 1YJNA 4LWCA 4DK6C 3PV0A 1PH7A 4JI1Q 3CC2A 4QY7A 3RN2A 4POGA 4KHPL 2HIVA 3F2BA 3ERSX 3CCMA 3U4VA 1KRSA 3GTKH 2PQAA 3HKZE 4B3SQ 3PO3H 4AQYQ 4LW1A 5E7NA 5BR8Q 4Y52H 2E5LQ 4TQUS 4A3DH 1A8VA 4LF4Q 1TWFH 3TS0A 5GQOA 4WJ3M 1HJPA 3L7ZC 4YY3Q 3S1MH 3L0OA 4C3IH 1VQHA 4X64L 4LF6L 4RMFA 2R7ZH 1EWIA 5C44H 2ZJPA 3FKIG 4LF9L 1XPOA 1Y1WG 2R7FA 1XPRA 4IPCA 1KQSA 1VQ6A 1NE3A 1J5EL 4JV5Q 1S40A 2K4KA 5C3EG 1B8AA 2F3IA 2BH8A 2NVQH 1PH2A 1PH9A 4DR6Q 2K5VA 4AH6A 2R92G 4BY7H 2PMZE 1KD1C 4ALPA 3GTQH 4R4QA 4GKKQ 4LF7Q 3TS2A 4OO1I 4GLVB 1EUJA 4A3GH 4JYAQ 3K7AH 4JI6L 4A3CH 1N9WA 2VQFQ 2VZAA 3M4PA 4UP7A 1JJ2A 2JA8G 4PZ6A 4B3TQ 3JC66 4DR5Q 1L1OA 2MO0A 2JJQA 5LMUL 4GOPA 1PFSA 3UDGA 3M3YH 4DV2L 3EBEA 4A3MG 1MKHA 3JAMc 4PZ7A 3CMEA 2OCEA 3KOJA 4A3KG 1XMQQ 1LYLA 1YNXA 3RN5A 4A3DG 1VQIA 4OO1G 1JJGA 3PGZA 3HOUH 1X3FA 4NXNQ 4X62L 2F4VQ 1Y1VH 1GD7A 2VW9A 1VQ5A 4YWMA 3UDFA 3U58A 4EQ5A 2VQEQ 3CCQA 1XPUA 3S2DH 4A75A 1PYBA 4APVA 3H3VI 4JI3Q 1VCIA 4A3LH 3PUYA 5IE8A 2UUCQ 1X3EA 2IY5B 2AMCB 2GVBA 2RHSB 4BBRG 4DV3L 2HQLA 2UUAL 3F2CA 2WAQG 3ZJYC 2UXBQ 2N78A 1Q8KA 1K3RA 3BZKA 4DV0L 4X66Q 2I5HA 1N33Q 4JI2Q 3NELA 3PUWA 3T1YL 1PH6A 4K0KL 2ID0A 3W1GA 4A3CG 3PCOB 1WCMH 4DUYQ 3IRBA 4GN3B 1PH1A 1QUQA 2I0QA 1SN8A 5IP9H 4A3FH 3HOZH 2K14A 1HNXQ 2ATWA 1VQ4A 1NJIC 5ELNA 1I3QH 4B3MQ 3CF5A 2NVTH 2IX1A 3M7NA 4JI8Q 2MFIA 1XTDA 4PG3A 4BY1H 5IP7G 4KLKA 4NXML 4B3RL 2CWPA 1XJVA 2ALYB 4JI0L 3BU2A 1WI5A 1TWAH 4LFCL 3GTJH 3RNUA 1CKNA 1NMFA 1Z47A 4HJ9A 3MEFA 3CD6A 5IWAL 3J81j 2ZJRA 4DR2Q 4C3JH 4DR3L 3NENA 5LMNQ 1PH3A 5J3BA 2NZHA 3PUXA 2NN6I 3M4QA 2N49A 4R1JA 4JI4L 3KYHC 4DV4L 3T1HL 1HZ9A 1MIUA 3PF5A 1TXYA 1YHAA 4WJ4A 3S1QH 1HNZL 3D0FA 1Q81C 4P71A 2Q2TA 4LF8Q 1IYJB 5ELOA 1BVSA 1OXSC 3GO5A 3K8AA 3J81i 1VQ9A 2ZJQA 1OTCA 1N32Q 2NVYH 1HR0L 4LFBL 5C0XJ 4LNQA 3S1RH 1S3OA 3J7A5 4X65L 5JJLA 3HOZG 2K5HA 3PUZA 5IP9G 1IBML 2Q2UA 4AYBE 1YJWA 3CCJA 2UXCL 2NN6G 1L1OB 1CSPA 2MO1A 1VQOA 1I94Q 1WJJA 3KJPA 2F52A 1FJGL 2UUBQ 2V1CC 4OX9Q 2JEAI 4ME3A 5LMNW 4DV5Q 3I4NG 4DV6Q 1MJCA 1AH9A 4IOCA 3M4OH 4DR7L 3D31A 1QZGA 1BBUA 3AFPA 1P8LA 1N8RC 1E7ZA 1DGSA 3HOXG 3PO2H 2CKZB 4JOIA 5IYBH 1W3SA 2VY3A 3TEHB 2Y0SE 3KF6B 3FP9A 4IJLA 4DV7Q 1CSQA 2JK8A 2YTXA 3HOWG 4A4IA 5M3MG 3CQZH 4C3HH 5M5XH 3MXNB 3F2DA 4GNXA 1PV4A 5JEAJ 3I4MH 2Z0SA 2E8GA 1VQ7A 4MTNA 3WWVA 1ASYA 3CAMA 1UWVA 5IY0A 3A74A 4P73A 4LF9Q 3J80i 2AHOB 2YU9H 4DR1L 4OWWB 1V9PA 4BBSG 3KF8B 2MQHA 1V1QA 1WOCA 1GO3E 1H95A 1ASZA 1VQPA 1PH8A 3S16H 5C0XI 5M5WH 2UU9L 1A0IA 2GVAA 4RG1A 1U5KA 1BBWA 1JE5A 4DK3C 2RF4A 3H0GG 3L2PA 1EQQA 1CKOA 2I5MX 1K73C 2R6GA 1QUQB 4DKAC 3OTOQ 4JI5L 2IT1A 2H5XA 3I55A 2KCTA 4B3SL 4AQYL 5BR8L 2E5LL 1YEZA 1LTLA 2YTYA 4JBJA 1PYSB 2EXDA 3CW2C 2D0PA 4PZ8A 4HJ8A 4A3BG 1YBYA 4UP8A 1VQGA 4DR4Q 1Q12A 4POFA 5C0XG 4NB3A 4JV5L 4A3IH 4JI7L 2YV5A 5C4JH 5IYBG 4YCUA 3W1BA 1X6OA 5C4XH 3HOVH 3PO3G 4BXXH 1I6HH 1UE7A 3U4ZA 2JA7H 1W2BA 1M90C 3I4MG 2CWAA 2WP8J 4GS3A 3G71A 4GKKL 3AYHB 2E2HH 4LF7L 5JJKA 2R7ZG 1G6PA 2GN5A 1YHBA 2JQOA 3UE0A 5C44G 3CCUA 1PA6A 4JC0A 5M5YH 2E2IH 3AEVA 4JYAL 2VS1A 1IBKQ 4YHHL 4L5SA 2VQFL 2OTJA 4HIMA 4LUOA 2WB1G 1JB7A 3ICEA 2HHHQ 1RIPA 3KDFB 4B3TL 2JA6G 4O2DA 4DR5L 3GTPH 4JBKA 4R4CA 2LSSA 1KHIA 1Q1BA 4L5TA 4BY7G 1U0LA 4BA1I 5JEAG 1XMQL 1VQ8A 1X3GA 1HZAA 1YZ6A 2Z6KC 3B6YA 2UXDL 4K0KQ 1KAWA 1PHJA 4A3GG 2F4VL 1XMOQ 3UDXA 1X56A 3K80C 2VQEL 2OQKA 1K8AC 2AWNA 1J6QA 1N36Q 3VDYA 1VQNA 4AIMA 3HKZG 1UE6A 4EX5A 4A3JH 4DPGA 2UUCL 3J7ZC 2VUMH 4LUZA 4PMWA 2JA6H 4IJHA 4MNOA 2HT1A 5HY6A 1KIXA 4R4IA 2PQAB 4BXXG 2UXBL 4NXMQ 4QQBX 3CCVA 4P74A 4HJ5A 1P16A 1VQFA 1K8GA 3HOUG 1X9NA 1M1KC 1IBLQ 1LUZA 1Y1VG 3LGJA 2KHIA 4JI0Q 1HNWQ 2PNHA 2DUDA 3S1NH 3F8TA 1XNRQ 2B29A 3HFZB 1UEBA 1D8LA 2LXJA 2IHEA 4DUYL 4DR3Q 3S14H 2HIXA 4A3LG 3U50C 1HNXL 1VS0A 1B70B 5AJ3L 2RCNA 3NEMA 1X65A 1Q7YC 1YI2A 3I7FA 4KHZA 1TWHH 2BA0A 4GKJL 4L5QA 4DUZQ 4NPSA 4JI8L 2KHJA 1IL2A 2JA5H 4OWXB 5FJ8H 5IYDH 4LFAQ 1JT8A 2K5NA 2K50A 4QGUA 4QIWE 3Q8DA 4A3EH 2R93H 4OWTB 1L1OC 3PUVA 1KL9A 4P75A 4YWLA 5EAYA 1WCMG 3DLLA 1AE3A 4IPGA 4GOPC 1A63A 1B7YB 2NZOA 4A3FG 2VL6A 4DR2L 1SROA 1E1OA 1XNQQ 2UXCQ 5LMNL 3CPWA 4LF5Q 2ZM6Q 4GOPB 4J15A 5HGQA 3STBC 4BY1G 1SR3A 3J81c 1JMCA 3CMAA 1Z9FA 3CCLA 4DR7Q 2PI2A 2I5LX 3KFUA 1EIYB 3FKIH 4LF8L 3GD7A 1Y1WH 4GLXA 1K0RA 4KHPQ 3EIVA 1E3PA 1E1TA 1FGUA 1FVIA 5C3EH 4C2MH 4GN4B 5FLMH 3OW2A 1E24A 1EYGA 1VQKA 2QEXA 4DV1L 4XTCS 3S15H 2R92H 4A93H 1X54A 3A5UA 4OONA 1N34L 1I50H 2WAQE 3G48A 1OXTA 1I94L 2OQ0A 4X64Q 4YCWA 2UUBL 4LF6Q 4DR1Q 4DV6L 1X55A 1J5EQ 1VQAA 3UE1A 4DAMA 4A3EG 4HJAA 1PH5A 2UU9Q 3CCSA 5M3FH 2IX0A 1O7IA 4JI1L 3S24A 2D0OA 4OXPA 2OWOA 4BA2I 2KCMA 3CCEA 4A3MH 3AFQA 3I2ZA 4DV7L 2XGTA 2YYZA 5GAHC 1LM0A 1QVGA 4JI5Q 2KENA 4H02A 4JBMA 4A3KH 2AKWB 4O0AA 1IZ6A 1I5FA 1VQEA 3FHWA 3NBHB 4JCVE 3J80c 1K9MC 3PIPA 4LF4L 1AE2A 4IFDJ 2VNUD 2LXKA 4JBWA 4YY3L 1EFWA 4HIKA 4JI6Q 1SMXA 1VQMA 2CQOA 1SRUA 1NTGA 4R4OA 3PO2G 3TREA 1KXLA 3KLWA 4JI7Q 5LMUQ 4IOAA 1CKNB 4DV2Q 1C9OA 4QL5A 5FLMG 3EN2A 4DR6L 4BBRH 1YIJA 1BKBA 3PF4A 2EIFA 4A93G 1L2FA 3TQYA
chains in the Genus database with same CATH superfamily
4XXEA 2ERHA 1HZCA 2CW0D 3BVMA 3E9IA 3ER0A 3JAMi 3S1NB 3GTOH 2OTLA 4WYMA 1GPJA 3NP8A 4C3JB 1JJCB 3N6RA 4FP5D 2ENBA 4TVAB 4DR4L 1EMVA 1JORA 4Y7NH 1EWCA 3RR5A 3RUZA 5M3FG 1KD1Q 1Q46A 1K8MA 3PIOA 2OTJP 1TWHB 3BJUA 3K7UC 2DGYA 2UUAQ 3GTMH 3I56A 1QJOA 3I3CA 2EYOA 1EIFA 1AW7A 3MVVA 4G57A 4XROA 2L4BA 5KP7B 4KV6A 4UPAA 2OEOA 3W5OA 4A3EB 3I56P 2NVYB 4NXNL 5EW5E 1EY7A 1T8KA 3G21A 2Z4IA 5GAEC 3U43A 3PIP3 1GUWA 4U0EA 2QDLA 4A3IG 3GP7A 5CBAE 4JI3L 2D62A 2HHHL 1TWCH 4GNXC 1S72A 1GVPA 5KNBA 4XFZA 5C4XG 3G29A 4XT1B 4B3RQ 1B1ZA 4X66L 4IFDG 4JI2L 3H15A 3RLOA 4GN5A 4LFCQ 2XTIA 1Q82C 3CCVP 2B2TA 2ES2A 4C2MB 1Q1EA 1RL2A 1D7QA 1PH4A 3MC0B 1CT1D 1V1OA 3DM3A 5AJ3Q 2ZTEA 2V4DA 3T1HQ 1R9TH 3DEPA 2JEBI 1MGSA 1HNZQ 1L0IA 3ULLA 5JOBA 4DAYB 5FLXE 4HIOA 1QRJA 3HOYG 2WV6D 1VQDA 1MJEA 2XNAC 4CJ0B 1GM5A 4CDDC 1IBLL 3EROA 4AYBB 2C35B 4A3MB 1JB3A 1TWGH 3IL8A 1YNJD 2N6ZA 2CCZA 1RJTA 3H91A 1LV9A 1S5ED 5CZDB 2Q2HA 1RNIA 3S17H 3GKLC 1H9RA 1I4GA 2F0VA 2RDHA 1NNXA 4U0CA 4LFAL 3MXGA 3KDFA 1N32L 2RVLA 2N50A 1QOHA 4X3TA 2A19A 1YJ9A 4FXGC 5IGEA 2WAQB 2F3VA 2VB2X 5D3IB 2KEDA 2F0UA 2HQEA 3HZXA 3GTOB 4G7OC 5FK9C 3K5MA 1JWSD 5FJ8G 5IYDG 4MRTC 2Z6KA 5IYCG 2JA8H 1SYBA 2EQSA 1HHVA 5C0XH 4BPHA 4IPYA 3PV0A 1PH7A 1X3OA 4JI1Q 4QY7A 3F2BA 3GTMB 3CCMA 2Z45A 1PTOD 2K04A 3GTKH 4WRDA 3FPUB 3HKZE 3PO3H 4AQYQ 2A6HC 4Y52H 4A3DH 3CCMP 4PMBA 1A8VA 2AVAA 1KDBA 1JOOA 4V190 1N8RQ 4OIJA 1DONA 1HJPA 1VQHA 1W6JA 4RGNA 2ZJPA 4IPCA 1KQSA 1NE3A 4CKCA 1M8AA 1S40A 1TWCB 3R8BA 1PH2A 1PH9A 1HTPA 2RBMA 3TDQA 1WD1A 2PMZE 5JEAH 1W2BO 1SNMA 4R4QA 5HGTA 4L6TB 4LF7Q 1PMRA 3TS2A 4RHSA 1SNCA 4A3GH 2L1BA 3G7LA 4K5WA 4OGQC 3BDOA 4A3CH 1K73Q 4FVMA 1M4VA 3JC66 4PXHB 2MO0A 4GOPA 2EYLA 1XXGA 4XDXA 3M3YH 1EL0A 1R9TB 3JAMc 4KMUC 2JA5B 5JAVA 4K8IA 3RN5A 2L0CA 5HGLA 2GZGA 4OO1G 1JJGA 3G6EP 3PGZA 4RCNA 4NXNQ 3HOUH 2F4VQ 4EQ5A 1LO5D 1B44D 1TWGB 4U0FA 1YNND 2VQEQ 1XPUA 2L9FA 4APVA 5E3FA 4JI3Q 3VA5A 4CGYB 3IKJA 4A3LH 2QILA 2K2QA 2KG9A 2UUCQ 2GZIA 2RHSB 4DV3L 3S17B 3F2CA 3ERQA 1K3RA 3BZKA 1SE3A 4X66Q 4JI2Q 2PW7A 1WCMH 2JN4A 2FVEA 4GN3B 1SN8A 4A3FH 3HOZH 1HNXQ 2XZ0D 2XIWA 2F0DA 1NJIC 1CQFA 1I3QH 1FD7D 4NMZA 1DOMA 1VHNA 2EIAA 2NVTH 5HVCA 5F2OA 2F0KA 2QA4P 1XTDA 4PG3A 4RCOA 1ZYRC 5IP7G 4BY1H 4KLKA 2JYLA 1AEXA 2JA8B 1I4XA 3SK4A 1K8AQ 4B9WA 2BOSA 4C1NI 1ENCA 2ZT9C 3CD6A 5IWAL 2Q8TA 2ZJRA 3GTKB 1UNSA 3EJIA 3PO3B 1B53A 4A3DB 2SOBA 3CD6P 1UEAB 3CPWO 1B9NA 1MIUA 1TXYA 1SYGA 2RSNA 4HR7B 5E1FA 1Q81C 4P71A 4LF8Q 2F0SA 2F0NA 2ZJQA 1OTCA 1N32Q 1JC7A 1EIAA 3ZYYX 4LNQA 2Z6BA 3G4SP 4BBRB 2DNEA 5JJLA 2CQAA 3DWPA 1ESFA 1Q81Q 2DNWA 2A6EC 3FMCA 4B9XA 2B39A 5C5MA 1CSPA 2MO1A 1VQOA 1I94Q 3KJPA 1FJGL 2KGCA 4CDEC 4A3GB 3NWTA 4ME3A 5LMNW 4DV6Q 1MJCA 1J8IA 1VQOP 4XYQA 1HUNA 5ELBA 1QZGA 4M0IA 2HD3A 1E7ZA 1OR5A 1R4QB 3HOXG 1ZXTA 3PO2H 4JOIA 4ZYSA 3M3YB 3HKZB 2EY2A 1W3SA 2Y0SE 3FP9A 3GTGB 1JCKB 4XRQA 2KG6A 1CSQA 3BS1A 2YTXA 4FF2A 5M3MG 1UUPA 1Y8PB 4C3HH 1PV4A 3IAYA 2GDWA 3W2DA 3HOUB 4MTNA 1ICWA 1V1PA 3DXJC 4OL7A 2B2TC 4OWWB 1DM0B 4V0BA 4BBSG 2MQHA 2LL8A 5NUCA 1H95A 5C0XI 2GVAA 4OELB 4DK3C 1BBWA 2PMZB 1R4PB 3UI2A 5CGKA 1EQQA 1F2YA 3LMOA 3Q6SA 5J39A 3OTOQ 3OIQA 3I55A 4B3SL 1BXIA 3SK5A 1YEZA 4JBJA 3KUPA 4IALA 3Q23A 1TY2A 4PZ8A 4HJ8A 5ELEA 4KTAA 3HOZB 1HQMC 4A3FB 2Z4HA 4PMCA 3MXPA 1I3QB 1F9SA 5C4JH 5HGNA 1K9MQ 2DY8A 2KA7A 4M1UB 5CV5A 4BY1B 3I4NB 1ICFB 3U4ZA 2JA7H 1STNA 2LTEA 1STEA 3VR3A 4GKKL 5KNCA 3DS4A 4C3IG 2R7ZG 1G6PA 2JQOA 5C44G 4OIKA 1MSHA 1M74A 5M5YH 4HMJA 2VS1A 1IBKQ 1EIHA 4J1MA 5TSSA 2QF7A 3CCQP 4O2DA 4CHTB 3OMGA 3NK9A 2K1BA 4BY7G 4F37A 2Z6KC 2UXDL 2KUMA 2E76C 2LMLA 3BDLA 3TP7A 4IUVA 1HTLD 2XV6A 2OQKA 2MVUA 5JVH3 4DK1A 2QEJC 1VQNA 3T51B 1KLUD 1HFGA 2PYKA 4A3JH 2VUMH 1ET6A 1DOKA 2N5IA 4PMWA 5IGCA 1VQNP 4R4IA 2PQAB 3OWEB 4A3BB 4LMQD 4P74A 5KP8B 2XT1A 1D1IA 1Z6MA 3PO2B 5C5LA 1BCPF 2PNHA 2F0IA 4UAIA 1WTXA 1XNRQ 2B29A 4IUTA 1G8ZD 4DUYL 3S14H 2N88A 4C3HB 5K36H 4L8JA 1B70B 1L0HA 1ESRA 2X69A 1Q7YC 2K33A 4KHZA 3S1MB 1F2ZA 4N9TA 2RA4A 4MN3A 4DUZQ 4JI8L 1RODA 4OWXB 3VYTA 4R8IA 3TP8A 3PIO3 3NBIA 1S5BD 1PYWD 2O4XA 4QIWE 3E0JA 4OWTB 3K57A 3PUVA 4GOPC 2VL6A 4DR2L 1G2TA 4ZUIA 2SNMA 5LMNL 1PRTB 2ZM6Q 3CCJP 4RKBA 1CA6A 4K6LA 1Q86Q 4GLXA 2Y0SB 1K0RA 2KCCA 4U68A 2K5DA 1E1TA 2OF1A 3T4AC 2WKCA 4C3JG 5FLMH 5C3EH 3OOCA 1EYGA 1VQKA 2QEXA 1DNYA 2JA7B 3VA7A 1X54A 2IW3A 1STHA 2K5XA 2A69C 4DK0A 1I50H 3G48A 1Y1VB 3K58A 2KOQA 3QOLA 5M5YB 3NQIA 4PQXA 2SEBD 3MTSA 1ZMBA 2PNGA 3UE1A 4DAMA 4A3EG 1GUTA 3E6ZX 1K3BC 5EPJA 2D0OA 5A2QL 2F03A 4DV7L 2YYZA 3L9AX 5E4XA 4KD4A 4A3KH 2AKWB 4O0AA 1IZ6A 3R93A 3FHWA 4LF4L 4JK1C 1CEIA 2WIIB 4JI6Q 1SMXA 1LT6D 1CQVA 2CQOA 2PENA 3CXCO 3D6WA 4QUCA 2DJFC 1WTVA 4KY7A 1CKNB 4DV2Q 5EKKA 4QL5A 4A3JB 2VUMB 3SXHA 1EZ6A 1I4HA 2K0DX 1YIJA 3QG1A 4BPGA 1STYA 4KJNA 1PFNA 2KBNA 1YIJP 2K93A 1VMPA 1UE5A 3CC4A 2JXMB 3S14B 2G9HD 1OXXK 3M9BA 3HKSA 4AYBG 2MNAA 2PEOA 4K5XA 1A43A 2QDBA 1MBYA 3HZQA 1B4OA 3H6MA 4DV0Q 2E2DC 1ZEQX 3K81C 3M85A 1WTOA 3T1YQ 1PFBA 1STAA 2CFMA 2IHFA 3PSIA 2UXDQ 1TQOA 3WDNA 4F87A 3Q20A 2Z46A 3A7AB 5CV7A 2DN8A 1EQRA 4JOIC 2F0HA 5H1SE 2CWOA 1D5ZC 1SFOH 2JGPA 2F0LA 3TRZA 3T16A 3OIPA 5IOCA 1D5XC 2A73B 1X3PA 4YIJA 1NMGA 4GNXB 3KF8A 2NO8A 4H2WC 2RHQB 3MHBA 3EA6A 2JP1A 5J1ZA 4PH0A 1EY8A 3X3NA 2XRSD 4H2YC 4QJFA 1GUOA 4QMGA 4XIGS 4BWGB 1RDPD 4DNRB 1I50B 2NN6H 2A8VA 4QIWB 3FRPB 1YI2P 5K5PA 1LTBD 1YHQA 3S2HH 1HR0Q 2N8NA 5JPAA 2GA4B 2WFWA 1YITA 2ZTDA 2WACA 2JYGA 1D5MC 2KORA 1YVCA 3I8ZA 1D1KA 4FXDA 1YITP 1VQJA 1E2WA 2OXPA 2XVSA 1G291 2L12A 2PEJA 2F0TA 4IO9A 1SLJA 2KOPA 2B3GA 5KP6B 3CE7A 1EOVA 2EOTA 3CMAP 4U0AA 2NVXH 2KW2A 4UP9A 5LL6X 2K92A 1NCVA 2C5CA 2K28A 2PW5A 3HOVB 5CYUA 2EYHA 3I72A 2SDFA 3RZOH 5EGTA 3RG6C 2L15A 3RLFA 5KIXA 3A8IE 4H44C 1K83H 2JE6I 4MIUA 1KABA 2K05A 2JA5G 4OX9L 3K6OA 5COYA 4DV5L 3A5ZB 3AQQA 2A1AA 2ZTCA 5GAGC 4GR2A 1SNPA 5FO7B 3GTPB 4DK6C 4KHPL 3RN2A 1UAPA 2BE5D 2LIUA 4COCA 2KOOA 5DAUA 4LF4Q 4LF6L 4RMFA 1EWIA 4LF9L 3FKIG 5C3XA 5C6AA 1SFOB 1XPOA 1Y1WG 2MF4A 1VQ6A 4JV5Q 1VQMP 4N8X1 1GUSA 3J81E 1XYIA 3CKIB 1B8AA 2LY7A 4AH6A 2R92G 1KD1C 3GTQH 1S4ZA 2FQ0A 3WOFA 2JU2A 3SDZA 3TP6A 4ID6A 4GLVB 3V05A 2CH4A 4ODGA 1NAPA 3A7LA 5F2KA 2JA8G 3E5SA 4UP7A 4DAVA 5HURA 2OTLP 1LTTD 4B3TQ 4DR5Q 2KGAA 1L1OA 5LMUL 4FNFA 4FXKC 4PZ7A 3KOJA 1DXMA 3NTKA 4A3DG 3S2HB 1ZKOA 2R93B 1VQIA 5FO8B 1H9MA 1X3FA 2LOLA 4X62L 1VQ5A 2A68C 1VMCA 3SK8A 3J80E 3S2DH 4A75A 1MZ8A 1WTQA 4NP5A 4EQOA 2K01A 1VQ5P 3F2UA 1WD0A 5CV4A 1M90Q 1F9PA 2IY5B 2FHTA 5KRUA 2GVBA 4BBRG 5JJZA 3ND8A 3ZJYC 2UXBQ 4DXGA 1S72P 4GR6A 4RHRA 5EKLA 2KJXA 5CBEE 4I7ZC 4K2KA 1LTID 3G0VA 2NVXB 2QNWA 1KNEA 3QIAA 4CJ2C 3PQIA 4A3CG 2ONTA 1Y69U 2H1EA 3RZOB 3RG2A 3TSSA 5IP9H 2ATWA 4F7XA 3HEJA 1K83B 1B9MA 5T1IA 3CF5A 1QNKA 1ACPA 4G4KA 2NBFA 3M7NA 2MFIA 4CKEA 2AF8A 1G91A 5BS2A 1F2LA 2PEKA 3JAML 1WI5A 1TWAH 2I07B 5JPMC 3KLRA 5IT9E 2XZ1C 1F9RA 1D6EC 3NENA 2NN6I 1M1KQ 4DV4L 4JI4L 1HZ9A 2F4IA 3PF5A 5C4HA 3SR1A 3J7AF 1IYJB 5ELOA 2EYPA 3K8AA 3J81i 2EVBA 4LFBL 5C0XJ 5IGGA 3S1RH 1S3OA 3J7A5 3OW2O 4X65L 3HOZG 1IBML 3GTQB 1YJWA 3MWYW 2N98A 1YJ9P 1L1OB 1WJJA 1JICA 2F52A 5L37A 4OX9Q 1YJWP 5JPNC 4DV5Q 3I4NG 3M4OH 4HAEA 4P2CB 1CI3M 2DY7A 2FVAA 2OARA 4Y7NB 1K28A 1P8LA 1AYIA 1N8RC 1DZ1A 4HCEA 3BYYB 4HSVA 1RTNA 5IYBH 2L4NA 2VY3A 4IJLA 4WJWA 1KAAA 3HOWG 5M5XH 1FNVA 5JEAJ 2FHSC 1VQ7A 3WWVA 1ASYA 2JU1A 4X3KA 5IY0A 1PDQA 4LF9Q 2EPBA 3J80i 1LT3D 2YU9H 1HFNA 1VQ7P 3S2DB 4PH1A 1BUVT 2JA6H 4K8JA 3H0GG 1CKOA 2I5MX 1K73C 4QB4A 4JI5L 4EGVA 4CDCC 4N9PA 1LT4D 5BR8L 2E5LL 5EPLA 1LTLA 2YTYA 4B08A 4UHPB 1PYSB 2A6HD 3CW2C 4A3BG 1ENAA 3CRKC 2EE1A 4DR4Q 1ET9A 1EZ8A 4A3IH 4JI7L 2YV5A 2GZJA 1LT5D 4YCUA 1ILPA 2EYFA 2L9HA 5KYIA 2M5RA 4H2XC 5C4XH 4C3HG 1I6HH 4LAAA 4ZAIA 3MEHA 4IFDH 2E2HH 1TWAB 5JJKA 2GN5A 3UE0A 3CCUA 3GZLA 4JC0A 4JYAL 3NTHA 1GHJA 2VQFL 1G6ZA 2WB1G 1JB7A 3TZDA 2HHHQ 1WVLA 3KDFB 4R4CA 3J7YW 1Q1BA 4L5TA 1QILA 1U0LA 4BA1I 1XMQL 1HZAA 3OWFA 1U4LA 1NR2A 4F8MA 3B4QA 2J0TD 5T1GA 2L55A 1K8AC 1J6QA 4ME5A 3VDYA 4AIMA 5BN3A 1FR2A 1JQYD 4ZRZA 1CHQD 1UE6A 2HT1A 3G1IA 3M4OB 3FVQA 4HJ5A 1VQFA 4DN4M 1X9NA 1LACA 5EJDA 1SMYC 1IBLQ 1Y1VG 2KHIA 1SDFA 1SJHD 2VSQA 2O5JC 1CFMA 4CA3A 1UEBA 1VF5C 1B50A 1TR5A 1SNDA 1GOZA 2HIXA 5M5XB 2G9DA 5DM73 3ITPA 5KGUA 1RHPA 1AUMA 2KHJA 2YU9B 1A2TA 1FNUA 2PZTA 5FLXL 1KC8Q 5FJ8H 5IYDH 4LFAQ 1JT8A 4UDUC 1ZYRD 3Q8DA 4IUUA 2EZVA 2JA6B 3D4WA 1L1OC 4YWLA 1KL9A 2K32A 3HGBA 5IGFA 4EVOA 1A63A 1RD9D 4WORA 2NZOA 3R2TA 1RKNA 1SROA 2AFEA 3P7JA 4GOPB 4J15A 3MA2B 2BUOA 3STBC 1EEID 1SR3A 3J81c 1JMCA 4OEMB 4JW0A 2PI2A 3C46A 1LTRD 3GD7A 1K0SA 4ZUJA 4KY6A 4A3IB 1E3PA 1FVIA 5C4XB 4DV1L 1M6NA 1I6HB 3S15H 4A93H 1FR3A 4DAPA 3A5UA 1CA5A 4R9WA 1BQQT 1HY8A 2E2HB 4PWVB 1HCZA 2A6ED 2OQ0A 3HRZC 2UUBL 2LKVA 2MGSA 4TKOB 3S9WA 4HJAA 3CCSA 2EHTA 5ISRA 1O7IA 3C3LA 4RGTA 2MUYA 2XGTA 5GAHC 4ZLTF 4HMIA 2XXMA 3NQTA 4JI5Q 3J80c 1QVFO 1K9MC 3P20A 3PIPA 1EFID 2VNUD 4JBWA 4NKLA 4YY3L 3I55P 2J7ZA 1EFWA 1WCMB 1SRUA 1NTGA 5BN4A 1EWHA 5I6WA 3DS2A 3E2DA 3KBXA 3KBGA 1ZNVA 4JI7Q 2TMPA 2F0WA 2NVTB 3DHQA 1S5DD 5FLMG 1EY5A 1GUNA 4DR6L 2FMCA 3KLSA 4DXFA 1L2FA 3QJYA 3GDEA 3GTLH 2B2YA 3BZCA 3EQLC 3LX0A 2B63H 4JG2A 1F2MA 1AP0A 1G51A 4UHVA 1OXUA 2L0QA 3CXCA 1IXRA 4XYOA 3H3VH 5FLXc 1SSOA 2F3WA 2F0GA 2F0EA 4DV3Q 1V43A 1NY4A 2HCCA 4DGZA 5IP7H 5IT9c 4IFDI 4IPHA 2K52A 1LABA 4TSSA 3KF6A 3V96A 5J22A 1B3QA 1GKHA 2BA1A 2ZXPA 2L6EA 3K0XA 4RH6A 3J7AV 1T5XD 1EU4A 1VF7A 2X6LA 4E6IA 1EY6A 1BBXC 2CVRA 4MZ9A 1CKMA 2F0OA 1NUCA 1H9SA 4HIDA 3HOVG 3UDIA 2R61A 3QB3A 4LUVA 1C0AA 1N33L 1SE8A 3DEOA 3G1GA 2N3SA 1V1PB 1SYEA 3RLNA 1FL0A 1QVCA 1XX8A 3A0JA 1LLRD 5IWAQ 1XMOL 5I4DA 2GZFA 3KJOA 3S15B 1Y14B 4A93B 1VKUA 4YWKA 1A6XA 1N36L 5GADC 5CC4A 1VQCA 1C7YA 1TS3A 2ASBA 1SYDA 1LTAD 1H9JA 3OYYA 1HZBA 4RWSC 2QGQA 2IPKD 3MAQA 3CCRA 2Z1CA 1WFQA 1HNWL 3HOXH 1L0WA 1Q90A 2RCFA 1Q86C 4BS9A 2PNRC 2KECA 1KLGD 3AB9A 2VLNA 3BVGA 4PV1C 5M3MH 2RDGA 1FJGQ 5JJIA 3D6CA 3ND9A 1WTWA 4BBSH 3EFXD 3CP0A 1RTOA 3I4OA 5EPKA 5C4JB 2LPKA 2AQ2B 2JO0A 1ILQA 5LL6S 2FXQA 1RCVD 3H94A 1UE1A 2VB3X 4DV1Q 1GHKA 3GTLB 1XNQL 4RA8A 4LF5L 2PEIA 1VQKP 2B63B 2QEXP 2F0FA 3RD4A 1EEFD 1BXTA 2VLPA 4IPDA 2E2JH 2DJGC 2R93G 3DWQA 1OXVA 1BAJA 2AWOA 4G7HC 1AZQA 3EJBA 4FF4A 1LTSD 3N52A 1PRTF 5HGMA 3MZ5A 1KRSA 1QE6A 5CV8A 1U4RA 2TSSA 4B3SQ 2K03A 4LW1A 5E7NA 4TQUS 3NY7B 1IUQA 4WJ3M 3TS0A 4YY3Q 2A69D 4C3IH 4X64L 3D3RA 2R7ZH 1W6KA 1XTCD 5C44H 4R8NA 2RQXA 1JJ2O 1J5EL 3I73A 2WKDA 2K4KA 5I2YA 2PZUA 2NVQH 4S3SA 4DR6Q 2K5VA 4BY7H 2RKSA 3EJEA 5I6YA 4GKKQ 1EOQA 1BOSA 2EDGA 5KYLA 4OO1I 2KVMA 1EUJA 3K7AH 1BO0A 3C1FA 1PZID 4WFN3 5ELFA 2PZWA 3CC4P 2JJQA 3UDGA 1PFSA 4DFAA 4A3MG 3EBEA 1MKHA 1X32A 3CMEA 1YNXA 4CJ1B 1S5FD 4DG9A 1PTOH 1BCPC 1EQTA 3HOXB 1GD7A 2VW9A 4YWMA 1STGA 3K0YA 3TMEA 1PYBA 4C1NK 3MXNA 3H3VI 1VCIA 3PUYA 1E0HA 2AMCB 2HQLA 2UUAL 2WAQG 1EYDA 4HN7A 1Q8KA 3HP3A 1N33Q 4KKUA 1AF8A 2KOSA 3NELA 1PH6A 2ID0A 2X2BA 5C3EB 4DUYQ 3IRBA 1PH1A 4XQJA 1QUQA 2MY5A 2K14A 1VQ4A 5ELNA 4IUQA 2C9OA 3NBHA 2IX1A 2JSOA 2MHVA 1Z7TA 4JI8Q 5HV8A 1MHWC 3BYTB 2E2JB 4NXML 4B3RL 1EIGA 3JAME 4JI0L 3BU2A 4LFCL 3RNUA 2ZXRA 2PQEA 1YHQP 3QWNA 1NMFA 4HJ9A 3MEFA 4DR2Q 1FGBD 1I4RA 4C3JH 3AU7A 3DWAA 4A3KB 2EY6A 5LMNQ 4I65A 2B2YC 2XRQD 3M4QA 2JAZA 3PUXA 4R1JA 4ILWA 3KYHC 3T1HL 1EYAA 1GXHA 4C3IB 2R7ZB 3S1QH 5C44B 1HNZL 1E0BA 1BVSA 2CNRA 2M8LA 1OXSC 3GO5A 1VQ9A 2NVYH 5G3LD 1KNAA 2NVQB 1RO0A 1QCBD 5DCKA 1RF2D 3H0DA 1VQ9P 1PRTD 3PUZA 5IP9G 2B8FA 3GV3A 4O42A 4BY7B 4AYBE 3CRLC 3E3XA 2FAEA 3H3VC 2FVFA 2LFNA 1AH9A 2K6AA 1IW7D 3D4DA 3OSOA 3AFPA 1DGSA 2NWGA 1A3VA 2CKZB 1AZPA 3NTEA 3TEHB 4DV7Q 4A4IA 3MXNB 2EXZA 3I4MH 1CM9A 2LIWA 2CG5B 1UWVA 3A74A 2IJ0A 4XQQA 4P73A 2Q8RE 2IX3A 2CH4W 1IKMA 4RFBA 4DR1L 2A5HA 4X3SA 1V9PA 3KF8B 2KGDA 1WOCA 1GO3E 1ASZA 1VQPA 3S16H 5M5WH 2UU9L 1TIID 3SEBA 4RG1A 1U5KA 1JE5A 4CDFC 3L2PA 1VQ6P 2CW0C 4ABNA 1HA5A 2R6GA 1QUQB 2ICIA 4DAYA 4DKAC 4DA2A 3VR5A 2JQ4A 2IT1A 2F0JA 2KCTA 1IHZA 1Q3LA 4AQYL 3SE0A 1SYCA 4EQNA 1DOLA 1JOKA 4IURA 1VDZA 1A3TA 4L63B 2EXDA 2PEQA 5CV9A 1Q12A 3D8GA 4O1NA 5C0XG 2MR7A 3R3OA 2KEEA 1O78A 1I4PA 5IYBG 2NTSA 5A35A 1J9OA 4U0BA 3PO3G 4BXXH 1W2BA 1M90C 2CWAA 2WP8J 4ZK9B 3VYRA 3AYHB 4LF7L 2E74C 1YHBA 2E2IH 1Y8NB 1EU3A 2JB0A 2E75C 4YHHL 4L5SA 2OTJA 4HIMA 4LUOA 1A8OA 3ICEA 1RIPA 4M8AA 2JA6G 1II3A 2LSSA 3NTIA 3WOEA 2JBGA 3G28A 3LWEA 3S1QB 5JEAG 5IODA 3VR4A 3W3AA 1X3GA 1YZ6A 1C4QA 1PHJA 5KNDA 4A3GG 2F4VL 3UDXA 1X56A 3K80C 2VQEL 2L5TA 2M2LA 2AWNA 5F2NA 2A68D 2EJFC 3HKZG 4ULLA 1FNWA 4DPGA 2KHSA 2B8GA 2EY5A 2X6GA 4LUZA 3J7ZC 1CZWA 5D65A 2UUCL 5IGDA 1KIXA 1G2SA 4NXMQ 4QQBX 5I2XA 2B2UA 2PO4A 3CCVA 1P16A 1K8GA 3HOUG 2EYJA 1HA6A 1M1KC 5CV6A 4JI0Q 4KKSA 2DUDA 1KDCA 5FKAC 1YNJC 1U4PA 3HFZB 2DNCA 1D8LA 2LXJA 1PZKD 2QCPX 3U9SA 4A3LG 2ICEC 2AUKA 3U50C 1HNXL 1VS0A 3I4MB 2GDYA 3NHHA 4NEOA 2FFKB 4GKJL 1WTPA 1M6EX 1Q82Q 1IL2A 3I90A 4HSPA 2JA5H 1K8OA 3NPPA 1F77A 2K5NA 2K50A 2PEMA 3BDCA 4KD3A 5M5WB 3S16B 3M4YA 3DLLA 1WCMG 3DS0A 1AE3A 3EJDA 1I4QA 2M8PA 1B7YB 3GZMA 1EYCA 5ELDA 4A3FG 1EY9A 4NW2A 2MD9A 1BF4A 2D5DA 4IZ6A 3CPWA 4J8QA 5HGQA 4F88A 5C4ZA 4BY1G 3NSWA 3BVZA 1HQBA 3EVQA 3I91A 1AN8A 1PFMA 3KLSX 3FKIH 4XT3B 3TN2A 5M9OA 1EIYB 1Y1WH 4LF8L 2FQ1A 1PTOC 3OMCA 4KHPQ 2BDOA 3FDTA 1B3AA 1ML0D 3A55A 4GN4B 2KODA 1E24A 1L0YB 2WINB 5CR3A 1HRJA 2MJ8A 1QVGO 2R92H 3FEWX 1N34L 4I7AA 3WBHA 1OXTA 1I94L 5CORA 2RSOA 2E2IB 4YCWA 4LF6Q 3SVMA 4DR1Q 4DV6L 2LS01 1X55A 2NTTA 3LWUA 3CHBD 2F0MA 2UU9Q 1EY0A 1JR0D 5M3FH 2GDXA 2IX0A 4BA2I 3S24A 3H09A 5FO9B 1DJRD 4H7BA 3CCEA 1OO9B 3DUZA 3VYSA 2AQ3B 2KENA 4H02A 4JBMA 3BG3A 2OT2A 1VQEA 3CCEP 4JCVE 3A8KE 2I46A 1A15A 2BDNA 4IFDJ 2EFJA 2F0QA 2D2CC 4R4OA 3PO2G 3MGEA 4U673 1KXLA 5LMUQ 4Q0FA 2JYOA 1IKLA 3L3OC 1C9OA 5KEEA 3J81L 1B2TA 4QF4A 1SXTA 4KKTA 5CMDA 4BBRH 4A93G 1BKBA 4XFXA 2NZ1D 3TQYA 3OTOL 2EY1A 1QVFA 5GROA 4X62Q 1YNNC 4HTHA 1V8QA 4GZYC 1JWMD 1TS2A 4YHHQ 3CCUP 2HUGA 4KN4C 1MI2A 2B2VA 4Z9CB 1JOQA 3NXWA 3PMFA 2KR5A 3G6EA 3GTGH 1E22A 5C3WA 1UJZA 1DCZA 3TBIB 3HOYH 1CZGA 1VQLA 3DM1A 1NBWA 1IYUA 4YCVA 3E9HA 4P72A 3S1RB 2LMCB 1CK1A 1DD2A 1VQLP 5EKIA 4FO2A 1IBKL 3LRYA 1WYDA 2IL8A 1GJXA 3IFDA 1X3QA 2Y0SG 3J80L 4X6AH 1BR9A 3GV6A 3E0EA 3MFYA 1A3UA 2HDMA 2PI2E 1T9HA 4R4TA 1CUKA 4K2LA 1PVOA 1SBBB 4RKLA 4L5RC 1HXYD 2JA7G 1TS4A 2CHBD 3RMHA 3FKIB 4GLAC 3CU7A 1Y1WB 1A62A 2B63G 4ZCKA 3Q0AA 2BH2A 1E2ZA 1KC8C 3Q24A 1KLPA 2R92B 2QA4A 3URYA 4XQNA 3OPOA 4B3ML 4RAUC 4DV4Q 4JI4Q 3SGIA 4GKJQ 2JA9A 4H0LC 1O80A 4ZKCB 3OW7A 3K59A 2YTVA 2Q2IA 3I4NH 2CGQA 5IYCH 4IZ8A 4LFBQ 2MP1A 2B2WA 3GQBA 1NJIQ 5M3FB 1WTRA 2QKIC 1XNRL 2D9UA 1PLFA 1TVXA 1SMYD 2MPMA 5IT9L 4X65Q 4QKOA 1IBMQ 2F0PA 1EOTA 4FDBA 3G26A 1HH2P 4A76A 2HCIA 3F1ZA 3HOWH 3ULJA 4DNIA 4KI0A 2Z44A 2R7DA 4A3JG 2VUMG 2NB0A 3CC7A 1K30A 4DUZL 2FINB 3HS0C 1VQBA 3CC7P 3G4SA 4UY8C 1QZHA 2EJMA 3IFTA 1SYFA 2K75A 3RZDH 2WB1E 3H0GH 3AMUA 5K36G 1HR0W 4K6DA 1XWEA 4HJ7A 2K7VA 5I9PA 1N34Q 4LK1C 1KRTA 1FYCA 2ZM6L 3CPFA 3D4RA 3ULPA 5DLQE 3QO2A 3H4EA 4A3BH 3STBD 1F9QA 5DNFA 1KQSO 3T56B 1YJNA 4LWCA 4QCLA 2KGEA 5IIFA 3CC2A 4POGA 5A2QE 2HIVA 3ERSX 3C1EA 2GYKA 3U4VA 4NDXA 3ONAB 3CCSP 1YJNP 2PQAA 2HDLA 3CC2P 5BR8Q 3HOYB 2B2UC 2E5LQ 2EYMA 2K0XA 2FMMA 3A56A 1TWFH 4KY5A 1SE2A 5GQOA 4OO1H 3L7ZC 5BS1A 1F80D 1ONLA 3S1MH 3L0OA 1WTHA 1O7YA 2XN9C 4BPFA 5D14A 2R7FA 3QOJA 1XPRA 3DS3A 5HGOA 4X3UA 1QNUA 4K5VA 5C3EG 1E6JP 2BH8A 2F3IA 5D3DA 2L11A 2E1MA 3R2IA 4ALPA 2WPTA 1EY4A 4JYAQ 4OHJA 2AFDA 4JI6L 1N9WA 2K0YA 2VQFQ 2VZAA 2PCFB 2MR8A 2EHSA 2P9XA 3M4PA 2XWBB 1JJ2A 3T13A 1QB5D 4PZ6A 2N5HA 2LKIA 2P5ZX 4DV2L 3A54A 4U0DA 2OCEA 5LHY1 2XWJB 4A3KG 1XMQQ 1LYLA 1C8CA 1Y1VH 3VR2A 2KG8A 3UDFA 3U58A 5JVG3 2SNSA 3CCQA 3FPPA 1BCPB 3HOWB 1BNZA 3MFGA 2K5QA 1T5EA 4TRDA 5IE8A 1X3EA 2N78A 4DV0L 4IN3A 1TT2A 4HEDA 3P05A 2I5HA 3PUWA 3T1YL 2O5IC 4K0KL 1IMQA 5EQ0A 3G6JB 3W1GA 2O2LD 2BHVA 4IUPA 5DM63 3RZDB 3PCOB 3DS5A 3H0GB 2I0QA 3OHXC 3KK7A 2RDFA 2FQ2A 2M9VA 4LJZC 4B3MQ 4ZQ3A 3P75A 1GXDC 2Z8LA 5I4TG 5EBDA 4KN7C 2A74C 1SAPA 4CBVA 2CWPA 2KOLA 5IGBA 1XJVA 3T53B 2ALYB 1HUMA 3GTJH 1CKNA 1JE4A 2NUCA 3CCRP 1Z47A 2G5DA 3J81j 4EQPA 1MSGA 2K5WA 1KDAA 4DR3L 3H47A 5E4WC 1PH3A 5J3BA 1UNKA 2NZHA 1TWFB 2N49A 1O7ZA 3SK6A 4WJ4A 1YHAA 5EBCA 2M8NA 3D0FA 1KTKA 2Q2TA 4PNYA 1SEBD 4Q5VA 2WB1B 1MD2D 1HR0L 5BN5A 3V2TA 2B2VC 2MVVA 1Q7YQ 4HKGA 2NYZD 3NE5B 2K5HA 4H13C 2N55A 2Q2UA 3C2PA 1AFPA 3CCJA 2UXCL 2NN6G 1QWYA 4KK7A 4G7ZC 2Q8IB 1NSNS 2UUBQ 2V1CC 2JEAI 3DPHA 4IOCA 4DR7L 2VLQA 3D31A 1TY0A 3I4LA 1BBUA 4DU9A 5G3LF 2VXWA 3KF6B 1TU2B 3Q22A 1DYQA 2JK8A 3HYBA 5EJWA 2VLOA 3CQZH 3F2DA 1RO2A 4GNXA 1E2VA 2PY8A 2E8GA 2Z0SA 3MXUA 1GUGA 3QR8A 1H9KA 3CAMA 1H9SB 2AHOB 1STBA 1V1QA 3VR6A 1PH8A 2AQ1B 2BCOA 1A0IA 2RF4A 2L22A 1O7LA 2KCNA 3K5NA 2H5XA 1A2UA 3K5OA 3LNNA 2FADA 4DNTB 2EJGC 2B2WC 1CTMA 3K5LA 2D0PA 1YBYA 4UP8A 1VQGA 4POFA 3X3MA 4NB3A 1IMPA 4JV5L 4IQZA 1Q8IA 3W1BA 1X6OA 2QW7A 2K94A 7CEIA 3HOVH 1UE7A 3VYUA 3I4MG 3G71A 4GS3A 2PPBC 3CMEP 3GTJB 2CQ8A 2R3ZA 1PA6A 3AEVA 3DTJA 3G71P 4K14A 5M3MB 4HCSA 4B3TL 3BZDB 4DR5L 3GTPH 5ELCA 3DMUA 5F2DA 4JBKA 1KHIA 2N6YA 3NUCA 1EQVA 1NQ4A 1VQ8A 4R0MA 4BBSB 3B6YA 2M00A 1TS5A 4K0KQ 4RGOS 1KAWA 3TP5A 1VQ8P 1XMOQ 1BCPD 1QG7A 1C48A 1N36Q 1L0XB 2XSCA 1IYVA 4EX5A 2KQ3A 1VQ4P 3NWSA 4IJHA 4MNOA 5DEHA 5HY6A 4BXXG 4COPA 2UXBL 2F1MA 2FJ2A 3U9OA 3O13A 1LUZA 3LGJA 1HNWQ 4RGMA 3S1NH 3F8TA 1Y8OB 4N8FA 2EG5A 2IHEA 4DR3Q 2ROQA 3SHLA 2ZXOA 3CQZB 3B5IA 1ENFA 3A8JE 2RCNA 3NEMA 1X65A 3TZUA 5AJ3L 3I7FA 1YI2A 1TWHH 2BA0A 1I6VC 4L5QA 4NPSA 1HQRD 4A3EH 4QGUA 2R93H 3P1HA 3DS1A 1PRTC 1NR4A 4P75A 1D2BA 5EAYA 4IPGA 4QNBA 2J4XA 3HG9A 1E1OA 1XNQQ 5FOBB 2UXCQ 4XFYA 4LF5Q 1TKWB 3M7GA 1IW7C 1U9RA 5I9OA 4JVZA 3K7AB 1SE4A 3CMAA 1Z9FA 3CCLA 4DR7Q 2I5LX 3KFUA 1SNOA 2BE5C 1HPCA 4FF3A 5AFWA 1Z6HA 2AUJD 3CCLP 3EIVA 4QUFA 4KHVA 1FGUA 4C2MH 3OW2A 1CHPD 2IWHA 1LTGD 4XTCS 1PZJD 3VRLC 1PTOB 4OONA 1BDOA 2WAQE 4KJOA 1GXGA 3M1MA 1U4MA 2KWLA 4C56C 4X64Q 1D1DA 2H4OA 1J5EQ 1VQAA 1SNQA 4CKBA 3GJNA 1PH5A 4JI1L 2Z9HA 2OWOA 4OXPA 2KCMA 1VQPP 3AFQA 3I2ZA 4A3MH 1SJED 4IUNA 4DF7A 1LM0A 4MHEA 1QVGA 1I5FA 3NBHB 4J6HA 4ZKBB 4FF1A 4FYDA 1AE2A 1S5CD 2LXKA 4HIKA 1VQMA 1JWUD 3TREA 1DV5A 2FACA 3KLWA 4JPBW 4IOAA 2LF4A 3I70A 1PTOF 1PXUA 2GZEA 3EN2A 1IL8A 4MTKA 3PF4A 2EIFA
chains in the Genus database with same CATH topology
1HZCA 3E9IA 3ER0A 3JAMi 3GTOH 2OTLA 4WYMA 1JJCB 4TVAB 4DR4L 4Y7NH 3RR5A 5M3FG 1KD1Q 1Q46A 3PIOA 2OTJP 3BJUA 3K7UC 2DGYA 2UUAQ 3GTMH 3I56A 1EIFA 4XROA 4UPAA 3W5OA 3I56P 4NXNL 3G21A 5GAEC 4U0EA 4A3IG 4JI3L 2D62A 2HHHL 1TWCH 4GNXC 1S72A 1GVPA 4XFZA 5C4XG 3G29A 4B3RQ 4X66L 4IFDG 4JI2L 3H15A 3RLOA 4GN5A 4LFCQ 2XTIA 1Q82C 3CCVP 2ES2A 1Q1EA 1RL2A 1D7QA 1PH4A 3DM3A 5AJ3Q 2ZTEA 3T1HQ 1R9TH 2JEBI 1HNZQ 4HIOA 3ULLA 4DAYB 1QRJA 3HOYG 1VQDA 1MJEA 1GM5A 1IBLL 2C35B 1TWGH 2CCZA 2Q2HA 1RNIA 3S17H 4U0CA 4LFAL 3KDFA 1N32L 2A19A 1YJ9A 5FJ8G 5IYDG 2Z6KA 5IYCG 2JA8H 2EQSA 4IPYA 3PV0A 1PH7A 4JI1Q 4QY7A 3F2BA 3CCMA 2Z45A 3GTKH 3HKZE 3PO3H 4AQYQ 4Y52H 4A3DH 3CCMP 1A8VA 1N8RQ 1HJPA 1VQHA 2ZJPA 4IPCA 1KQSA 1NE3A 1S40A 1PH2A 1PH9A 2PMZE 1W2BO 4R4QA 4LF7Q 3TS2A 4A3GH 4A3CH 1K73Q 3JC66 2MO0A 4GOPA 3M3YH 3JAMc 3RN5A 5HGLA 4OO1G 1JJGA 3G6EP 3PGZA 4NXNQ 3HOUH 2F4VQ 4EQ5A 2VQEQ 4U0FA 1XPUA 4APVA 4JI3Q 4A3LH 2UUCQ 2RHSB 4DV3L 3F2CA 1K3RA 3BZKA 4X66Q 4JI2Q 1WCMH 4GN3B 1SN8A 4A3FH 3HOZH 1HNXQ 1NJIC 1I3QH 2EIAA 2NVTH 5F2OA 2QA4P 1XTDA 4PG3A 4BY1H 5IP7G 4KLKA 2JYLA 1K8AQ 3CD6A 5IWAL 2ZJRA 3CD6P 3CPWO 1MIUA 1TXYA 1Q81C 4P71A 4LF8Q 2ZJQA 1OTCA 1N32Q 1EIAA 4LNQA 3G4SP 5JJLA 1Q81Q 1CSPA 2MO1A 1VQOA 1I94Q 3KJPA 1FJGL 4ME3A 5LMNW 4DV6Q 1MJCA 1VQOP 1QZGA 4M0IA 1E7ZA 3HOXG 3PO2H 4JOIA 1W3SA 2Y0SE 3FP9A 4XRQA 1CSQA 2YTXA 5M3MG 4C3HH 1PV4A 4MTNA 4OWWB 4BBSG 2MQHA 1H95A 5C0XI 2GVAA 4DK3C 1BBWA 1EQQA 3OTOQ 3I55A 4B3SL 1YEZA 4JBJA 4PZ8A 4HJ8A 5C4JH 5HGNA 1K9MQ 3U4ZA 2JA7H 4GKKL 3DS4A 2R7ZG 1G6PA 2JQOA 5C44G 1M74A 5M5YH 2VS1A 1IBKQ 3CCQP 4O2DA 4BY7G 2Z6KC 2UXDL 2XV6A 2OQKA 1VQNA 4A3JH 2VUMH 4PMWA 1VQNP 4R4IA 2PQAB 4P74A 2XT1A 2PNHA 1XNRQ 2B29A 4DUYL 3S14H 1B70B 1Q7YC 4KHZA 4DUZQ 4JI8L 4OWXB 4QIWE 4OWTB 3PUVA 4GOPC 2VL6A 4DR2L 5LMNL 2ZM6Q 3CCJP 1Q86Q 4GLXA 1K0RA 1E1TA 5C3EH 5FLMH 1EYGA 1VQKA 2QEXA 1X54A 1I50H 3G48A 1ZMBA 3UE1A 4DAMA 4A3EG 2D0OA 4DV7L 2YYZA 4A3KH 2AKWB 4O0AA 1IZ6A 3FHWA 4LF4L 4JI6Q 1SMXA 2CQOA 2PENA 3CXCO 1CKNB 4DV2Q 4QL5A 1YIJA 2KBNA 1YIJP 1UE5A 3CC4A 1OXXK 3M9BA 3HKSA 4AYBG 2MNAA 2PEOA 1A43A 3HZQA 4DV0Q 3K81C 3M85A 3T1YQ 2CFMA 2IHFA 3PSIA 2UXDQ 3Q20A 2Z46A 4JOIC 1EQRA 5H1SE 2CWOA 1SFOH 3TRZA 1NMGA 4GNXB 2RHQB 4PH0A 4QJFA 4XIGS 2A8VA 1YI2P 1YHQA 3S2HH 1HR0Q 2N8NA 5JPAA 2WFWA 1YITA 2ZTDA 2JYGA 1YVCA 1YITP 1VQJA 1G291 2PEJA 4IO9A 1SLJA 2B3GA 1EOVA 3CMAP 4U0AA 2NVXH 4UP9A 3RZOH 3RG6C 2L15A 3RLFA 1K83H 2JE6I 2JA5G 4OX9L 4DV5L 3A5ZB 3AQQA 2A1AA 2ZTCA 5GAGC 4GR2A 4DK6C 4KHPL 3RN2A 4COCA 4LF4Q 4LF6L 4RMFA 1EWIA 4LF9L 3FKIG 1XPOA 1Y1WG 1VQ6A 4JV5Q 1VQMP 1B8AA 4AH6A 2R92G 1KD1C 3GTQH 4GLVB 5F2KA 2JA8G 4UP7A 2OTLP 4B3TQ 4DR5Q 1L1OA 5LMUL 4PZ7A 3KOJA 4A3DG 1VQIA 1X3FA 4X62L 1VQ5A 3S2DH 4A75A 1VQ5P 1M90Q 2IY5B 2GVBA 4BBRG 3ZJYC 2UXBQ 1S72P 4GR6A 3G0VA 4A3CG 2ONTA 5IP9H 2ATWA 3CF5A 3M7NA 2MFIA 5BS2A 2PEKA 1WI5A 1TWAH 3NENA 2NN6I 1M1KQ 4DV4L 4JI4L 1HZ9A 3PF5A 1IYJB 5ELOA 3K8AA 3J81i 4LFBL 5C0XJ 3S1RH 1S3OA 3J7A5 3OW2O 4X65L 3HOZG 1IBML 1YJWA 1YJ9P 1L1OB 1WJJA 2F52A 4OX9Q 1YJWP 4DV5Q 3I4NG 3M4OH 2OARA 1P8LA 1N8RC 5IYBH 2VY3A 4IJLA 3HOWG 5M5XH 5JEAJ 1VQ7A 3WWVA 1ASYA 5IY0A 4LF9Q 3J80i 2YU9H 1VQ7P 4PH1A 2JA6H 3H0GG 1CKOA 2I5MX 1K73C 4JI5L 5BR8L 2E5LL 1LTLA 2YTYA 1PYSB 3CW2C 4A3BG 4DR4Q 4A3IH 4JI7L 2YV5A 4YCUA 5C4XH 1I6HH 2E2HH 5JJKA 2GN5A 3UE0A 3CCUA 4JC0A 4JYAL 2VQFL 2WB1G 1JB7A 2HHHQ 3KDFB 4R4CA 1Q1BA 4L5TA 1U0LA 4BA1I 1XMQL 1HZAA 1K8AC 1J6QA 3VDYA 4AIMA 1UE6A 2HT1A 3G1IA 4HJ5A 1VQFA 1X9NA 1IBLQ 1Y1VG 2KHIA 1UEBA 2HIXA 1AUMA 2KHJA 1KC8Q 5FJ8H 5IYDH 4LFAQ 1JT8A 3Q8DA 1L1OC 4YWLA 1KL9A 1A63A 2NZOA 1SROA 4GOPB 4J15A 2BUOA 3STBC 1SR3A 3J81c 1JMCA 2PI2A 3GD7A 1E3PA 1FVIA 4DV1L 1M6NA 3S15H 4A93H 3A5UA 2OQ0A 2UUBL 4HJAA 3CCSA 1O7IA 2XGTA 5GAHC 4JI5Q 2XXMA 3J80c 1QVFO 1K9MC 3PIPA 2VNUD 4JBWA 4YY3L 3I55P 1EFWA 1SRUA 1NTGA 3DS2A 3E2DA 4JI7Q 5FLMG 4DR6L 1L2FA 3GDEA 3GTLH 3BZCA 2B63H 4JG2A 1G51A 1OXUA 3CXCA 1IXRA 3H3VH 5FLXc 4DV3Q 1V43A 1NY4A 5IP7H 5IT9c 4IFDI 4IPHA 2K52A 3KF6A 1GKHA 2BA1A 3K0XA 2L6EA 4MZ9A 1CKMA 4HIDA 3HOVG 3UDIA 4LUVA 1C0AA 1N33L 1SE8A 3G1GA 2N3SA 3RLNA 1FL0A 1QVCA 3A0JA 5IWAQ 1XMOL 3KJOA 1Y14B 4YWKA 1N36L 5GADC 1VQCA 1C7YA 2ASBA 3OYYA 1HZBA 2QGQA 3CCRA 1WFQA 1HNWL 3HOXH 1L0WA 1Q86C 5M3MH 1FJGQ 5JJIA 4BBSH 3CP0A 3I4OA 2JO0A 2FXQA 1UE1A 4DV1Q 1XNQL 4LF5L 2PEIA 1VQKP 2QEXP 2E2JH 4IPDA 2R93G 1OXVA 1BAJA 2AWOA 5HGMA 1KRSA 4B3SQ 4LW1A 5E7NA 4TQUS 1IUQA 4WJ3M 3TS0A 4YY3Q 4C3IH 4X64L 2R7ZH 5C44H 1JJ2O 1J5EL 2K4KA 2NVQH 4DR6Q 2K5VA 4BY7H 4GKKQ 1EOQA 4OO1I 1EUJA 3K7AH 3CC4P 2JJQA 3UDGA 1PFSA 4A3MG 3EBEA 1MKHA 3CMEA 1YNXA 1GD7A 2VW9A 4YWMA 1PYBA 3H3VI 1VCIA 3PUYA 2AMCB 2HQLA 2UUAL 2WAQG 1Q8KA 1N33Q 3NELA 1PH6A 2ID0A 4DUYQ 3IRBA 1PH1A 1QUQA 2K14A 1VQ4A 5ELNA 2IX1A 4JI8Q 4NXML 4B3RL 4JI0L 3BU2A 4LFCL 3RNUA 1YHQP 1NMFA 4HJ9A 3MEFA 4DR2Q 4C3JH 5LMNQ 3PUXA 3M4QA 4R1JA 3KYHC 3T1HL 3S1QH 1HNZL 1BVSA 2M8LA 1OXSC 3GO5A 1VQ9A 2NVYH 1RO0A 5DCKA 3H0DA 1VQ9P 5IP9G 3PUZA 4AYBE 1AH9A 3AFPA 1DGSA 2CKZB 3NTEA 3TEHB 4DV7Q 4A4IA 3MXNB 3I4MH 1UWVA 3A74A 4P73A 4DR1L 1V9PA 3KF8B 1WOCA 1GO3E 1ASZA 1VQPA 3S16H 5M5WH 2UU9L 4RG1A 1U5KA 1JE5A 3L2PA 1VQ6P 2R6GA 1QUQB 4DKAC 2IT1A 2KCTA 4AQYL 2EXDA 2PEQA 1Q12A 5C0XG 5IYBG 4U0BA 3PO3G 4BXXH 1W2BA 1M90C 2CWAA 2WP8J 3AYHB 4LF7L 1YHBA 2E2IH 4YHHL 4L5SA 2OTJA 4HIMA 4LUOA 1A8OA 3ICEA 1RIPA 2JA6G 2LSSA 3G28A 5JEAG 1X3GA 1YZ6A 1PHJA 4A3GG 2F4VL 3UDXA 1X56A 3K80C 2VQEL 2AWNA 5F2NA 3HKZG 4DPGA 2UUCL 3J7ZC 4LUZA 1KIXA 4NXMQ 4QQBX 3CCVA 1K8GA 1P16A 3HOUG 1M1KC 4JI0Q 2DUDA 3HFZB 1D8LA 2LXJA 4A3LG 3U50C 1HNXL 1VS0A 4GKJL 1M6EX 1Q82Q 1IL2A 2JA5H 2K5NA 2K50A 2PEMA 3DLLA 1WCMG 3DS0A 1AE3A 2M8PA 1B7YB 4A3FG 3CPWA 5HGQA 4BY1G 1EIYB 3FKIH 4LF8L 1Y1WH 4KHPQ 4GN4B 2KODA 1E24A 1QVGO 2R92H 1N34L 3WBHA 1OXTA 1I94L 4YCWA 4LF6Q 4DR1Q 4DV6L 1X55A 2UU9Q 5M3FH 2IX0A 4BA2I 3S24A 3CCEA 2KENA 4H02A 4JBMA 1VQEA 3CCEP 4JCVE 4IFDJ 2EFJA 4R4OA 3PO2G 3MGEA 1KXLA 5LMUQ 1C9OA 4BBRH 4A93G 1BKBA 4XFXA 3TQYA 3OTOL 1QVFA 5GROA 4X62Q 4YHHQ 3CCUP 3G6EA 3GTGH 1E22A 3HOYH 1VQLA 1NBWA 4YCVA 3E9HA 4P72A 1VQLP 1IBKL 3LRYA 1WYDA 4X6AH 2Y0SG 3E0EA 2PI2E 1T9HA 4R4TA 1CUKA 1PVOA 4L5RC 2JA7G 4GLAC 1A62A 2B63G 2BH2A 1KC8C 2QA4A 4B3ML 4JI4Q 4DV4Q 3SGIA 4GKJQ 2JA9A 2YTVA 2Q2IA 3I4NH 5IYCH 4LFBQ 1NJIQ 1XNRL 4X65Q 1IBMQ 4FDBA 3G26A 1HH2P 4A76A 3F1ZA 3HOWH 3ULJA 4DNIA 4KI0A 2Z44A 2R7DA 4A3JG 2VUMG 3CC7A 1K30A 4DUZL 1VQBA 3CC7P 3G4SA 4UY8C 1QZHA 2K75A 3RZDH 2WB1E 3H0GH 5K36G 1HR0W 4HJ7A 1N34Q 1KRTA 2ZM6L 3CPFA 3ULPA 5DLQE 3H4EA 4A3BH 3STBD 1KQSO 1YJNA 4LWCA 3CC2A 4POGA 2HIVA 3ERSX 3U4VA 3CCSP 1YJNP 2PQAA 3CC2P 5BR8Q 2E5LQ 1TWFH 5GQOA 3L7ZC 5BS1A 3S1MH 3L0OA 2R7FA 1XPRA 3DS3A 5HGOA 5C3EG 1E6JP 2BH8A 2F3IA 2E1MA 4ALPA 4JYAQ 4JI6L 1N9WA 2VQFQ 2VZAA 2P9XA 3M4PA 1JJ2A 4PZ6A 4DV2L 4U0DA 2OCEA 4A3KG 1XMQQ 1LYLA 1Y1VH 3UDFA 3U58A 3CCQA 5IE8A 1X3EA 2N78A 4DV0L 3P05A 2I5HA 3PUWA 3T1YL 4K0KL 3W1GA 2BHVA 3PCOB 3DS5A 2I0QA 4B3MQ 5I4TG 2CWPA 1XJVA 2ALYB 3GTJH 1CKNA 3CCRP 1Z47A 3J81j 4DR3L 3H47A 1PH3A 5J3BA 2NZHA 2N49A 4WJ4A 1YHAA 2M8NA 3D0FA 2Q2TA 1HR0L 1Q7YQ 2K5HA 2Q2UA 3CCJA 2UXCL 2NN6G 2UUBQ 2V1CC 2JEAI 3DPHA 4IOCA 4DR7L 3D31A 1BBUA 3KF6B 2JK8A 3HYBA 3CQZH 3F2DA 1RO2A 4GNXA 2PY8A 2E8GA 2Z0SA 3CAMA 2AHOB 1V1QA 1PH8A 1A0IA 2RF4A 2H5XA 2D0PA 1YBYA 4UP8A 1VQGA 4POFA 4NB3A 4JV5L 3W1BA 1X6OA 3HOVH 1UE7A 3I4MG 3G71A 4GS3A 3CMEP 1PA6A 3AEVA 3DTJA 3G71P 4B3TL 4DR5L 3GTPH 4JBKA 1KHIA 1VQ8A 3B6YA 4K0KQ 1KAWA 1VQ8P 1XMOQ 1N36Q 4EX5A 1VQ4P 4IJHA 4MNOA 5HY6A 4BXXG 4COPA 2UXBL 1HNWQ 1LUZA 3LGJA 3S1NH 3F8TA 2EG5A 2IHEA 4DR3Q 3B5IA 5AJ3L 2RCNA 3NEMA 1X65A 1YI2A 3I7FA 1TWHH 2BA0A 4L5QA 4NPSA 4A3EH 4QGUA 2R93H 3DS1A 4P75A 5EAYA 4IPGA 4QNBA 1E1OA 1XNQQ 2UXCQ 4XFYA 4LF5Q 3CMAA 1Z9FA 3CCLA 4DR7Q 2I5LX 3KFUA 3CCLP 3EIVA 1FGUA 4C2MH 3OW2A 4XTCS 3VRLC 4OONA 2WAQE 3M1MA 4X64Q 1D1DA 1J5EQ 1VQAA 1PH5A 4JI1L 2OWOA 4OXPA 2KCMA 1VQPP 3AFQA 3I2ZA 4A3MH 1LM0A 1QVGA 1I5FA 3NBHB 1AE2A 2LXKA 4HIKA 1VQMA 3TREA 3KLWA 4IOAA 2LF4A 3EN2A 3PF4A 2EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDE A;  1HZC A;  3E9I A;  3ER0 A;  3OTO L;  3JAM i;  3BZC A;  3GTL H;  1QVF A;  5GRO A;  4X62 Q;  2B63 H;  2KBN A;  4JG2 A;  3GTO H;  1G51 A;  1UE5 A;  2OTL A;  3CC4 A;  1JJC B;  4YHH Q;  1OXU A;  4TVA B;  4DR4 L;  3CXC A;  1IXR A;  3H3V H;  5FLX c;  4Y7N H;  3RR5 A;  5M3F G;  1OXX K;  1Q46 A;  3M9B A;  3HKS A;  4AYB G;  2MNA A;  3PIO A;  3BJU A;  4DV3 Q;  3K7U C;  2DGY A;  1V43 A;  2UUA Q;  3GTM H;  3I56 A;  3G6E A;  1NY4 A;  1EIF A;  1E22 A;  3GTG H;  4DV0 Q;  3K81 C;  5IP7 H;  5IT9 c;  3M85 A;  3HOY H;  3T1Y Q;  4UPA A;  2CFM A;  2IHF A;  3PSI A;  1VQL A;  3W5O A;  2UXD Q;  1NBW A;  4IFD I;  4IPH A;  3E9H A;  4YCV A;  4NXN L;  2K52 A;  4JOI C;  1EQR A;  4P72 A;  5H1S E;  5GAE C;  3KF6 A;  1SFO H;  1IBK L;  1WYD A;  1GKH A;  4X6A H;  2BA1 A;  2Y0S G;  3K0X A;  3TRZ A;  4A3I G;  3E0E A;  4JI3 L;  2D62 A;  2HHH L;  1TWC H;  2PI2 E;  4GNX C;  1S72 A;  1GVP A;  1T9H A;  4R4T A;  1CUK A;  4MZ9 A;  1CKM A;  1PVO A;  5C4X G;  4HID A;  3HOV G;  4L5R C;  3UDI A;  2JA7 G;  4B3R Q;  4LUV A;  1NMG A;  4GNX B;  4GLA C;  4X66 L;  1N33 L;  4IFD G;  1C0A A;  1SE8 A;  1A62 A;  3H15 A;  2RHQ B;  3RLO A;  4JI2 L;  4GN5 A;  4LFC Q;  2B63 G;  2N3S A;  2XTI A;  2BH2 A;  3RLN A;  1FL0 A;  1QVC A;  1Q82 C;  3A0J A;  5IWA Q;  1XMO L;  1KC8 C;  2ES2 A;  1Q1E A;  1RL2 A;  4QJF A;  4XIG S;  1D7Q A;  3KJO A;  1PH4 A;  1Y14 B;  4YWK A;  2QA4 A;  1N36 L;  3DM3 A;  5GAD C;  5AJ3 Q;  2ZTE A;  4B3M L;  4JI4 Q;  4DV4 Q;  1VQC A;  3SGI A;  3T1H Q;  1R9T H;  1C7Y A;  4GKJ Q;  2JA9 A;  2JEB I;  2ASB A;  2A8V A;  1HNZ Q;  4HIO A;  3ULL A;  4DAY B;  2YTV A;  3OYY A;  2Q2I A;  3HOY G;  1HZB A;  1YHQ A;  1VQD A;  2QGQ A;  3I4N H;  3CCR A;  1MJE A;  5IYC H;  3S2H H;  1WFQ A;  2N8N A;  1GM5 A;  1HR0 Q;  1IBL L;  4LFB Q;  1HNW L;  3HOX H;  1XNR L;  2WFW A;  1L0W A;  2C35 B;  2ZTD A;  4X65 Q;  1YIT A;  1TWG H;  1Q86 C;  1IBM Q;  4FDB A;  1HH2 P;  4A76 A;  2CCZ A;  1YVC A;  3F1Z A;  3HOW H;  3ULJ A;  5M3M H;  4DNI A;  4KI0 A;  2R7D A;  1VQJ A;  4A3J G;  2VUM G;  1FJG Q;  5JJI A;  2Q2H A;  3CC7 A;  3S17 H;  4DUZ L;  1G29 1;  4IO9 A;  1SLJ A;  2B3G A;  4BBS H;  1VQB A;  3CP0 A;  1EOV A;  3G4S A;  4LFA L;  4UY8 C;  1QZH A;  3KDF A;  3I4O A;  1N32 L;  2NVX H;  4UP9 A;  2K75 A;  2A19 A;  3RZD H;  2WB1 E;  2FXQ A;  3H0G H;  1YJ9 A;  1UE1 A;  4DV1 Q;  3RZO H;  1HR0 W;  5K36 G;  2L15 A;  1XNQ L;  4HJ7 A;  3RLF A;  4LF5 L;  1N34 Q;  1K83 H;  2JE6 I;  1KRT A;  2ZM6 L;  3CPF A;  2JA5 G;  4OX9 L;  3ULP A;  4DV5 L;  5DLQ E;  5FJ8 G;  5IYD G;  2E2J H;  4IPD A;  3A5Z B;  4A3B H;  2Z6K A;  2A1A A;  3AQQ A;  3STB D;  5IYC G;  2ZTC A;  5GAG C;  2JA8 H;  2EQS A;  1OXV A;  2R93 G;  2AWO A;  1YJN A;  4LWC A;  4DK6 C;  3PV0 A;  1PH7 A;  4JI1 Q;  3CC2 A;  4QY7 A;  3RN2 A;  4POG A;  4KHP L;  2HIV A;  3F2B A;  3ERS X;  3CCM A;  3U4V A;  1KRS A;  3GTK H;  2PQA A;  3HKZ E;  4B3S Q;  3PO3 H;  4AQY Q;  4LW1 A;  5E7N A;  5BR8 Q;  4Y52 H;  2E5L Q;  4TQU S;  4A3D H;  1A8V A;  4LF4 Q;  1TWF H;  3TS0 A;  5GQO A;  4WJ3 M;  1HJP A;  3L7Z C;  4YY3 Q;  3S1M H;  3L0O A;  4C3I H;  1VQH A;  4X64 L;  4LF6 L;  4RMF A;  2R7Z H;  1EWI A;  5C44 H;  2ZJP A;  3FKI G;  4LF9 L;  1XPO A;  1Y1W G;  2R7F A;  1XPR A;  4IPC A;  1KQS A;  1VQ6 A;  1NE3 A;  1J5E L;  4JV5 Q;  1S40 A;  2K4K A;  5C3E G;  1B8A A;  2F3I A;  2BH8 A;  2NVQ H;  1PH2 A;  1PH9 A;  4DR6 Q;  2K5V A;  4AH6 A;  2R92 G;  4BY7 H;  2PMZ E;  1KD1 C;  4ALP A;  3GTQ H;  4R4Q A;  4GKK Q;  4LF7 Q;  3TS2 A;  4OO1 I;  4GLV B;  1EUJ A;  4A3G H;  4JYA Q;  3K7A H;  4JI6 L;  4A3C H;  1N9W A;  2VQF Q;  2VZA A;  3M4P A;  4UP7 A;  1JJ2 A;  2JA8 G;  4PZ6 A;  4B3T Q;  3JC6 6;  4DR5 Q;  1L1O A;  2MO0 A;  2JJQ A;  5LMU L;  4GOP A;  1PFS A;  3UDG A;  3M3Y H;  4DV2 L;  3EBE A;  4A3M G;  1MKH A;  3JAM c;  4PZ7 A;  3CME A;  2OCE A;  3KOJ A;  4A3K G;  1XMQ Q;  1LYL A;  1YNX A;  3RN5 A;  4A3D G;  1VQI A;  4OO1 G;  1JJG A;  3PGZ A;  3HOU H;  1X3F A;  4NXN Q;  4X62 L;  2F4V Q;  1Y1V H;  1GD7 A;  2VW9 A;  1VQ5 A;  4YWM A;  3UDF A;  3U58 A;  4EQ5 A;  2VQE Q;  3CCQ A;  1XPU A;  3S2D H;  4A75 A;  1PYB A;  4APV A;  3H3V I;  4JI3 Q;  1VCI A;  4A3L H;  3PUY A;  5IE8 A;  2UUC Q;  1X3E A;  2IY5 B;  2AMC B;  2GVB A;  2RHS B;  4BBR G;  4DV3 L;  2HQL A;  2UUA L;  3F2C A;  2WAQ G;  3ZJY C;  2UXB Q;  2N78 A;  1Q8K A;  1K3R A;  3BZK A;  4DV0 L;  4X66 Q;  2I5H A;  1N33 Q;  4JI2 Q;  3NEL A;  3PUW A;  3T1Y L;  1PH6 A;  4K0K L;  2ID0 A;  3W1G A;  4A3C G;  3PCO B;  1WCM H;  4DUY Q;  3IRB A;  4GN3 B;  1PH1 A;  1QUQ A;  2I0Q A;  1SN8 A;  5IP9 H;  4A3F H;  3HOZ H;  2K14 A;  1HNX Q;  2ATW A;  1VQ4 A;  1NJI C;  5ELN A;  1I3Q H;  4B3M Q;  3CF5 A;  2NVT H;  2IX1 A;  3M7N A;  4JI8 Q;  2MFI A;  1XTD A;  4PG3 A;  4BY1 H;  5IP7 G;  4KLK A;  4NXM L;  4B3R L;  2CWP A;  1XJV A;  2ALY B;  4JI0 L;  3BU2 A;  1WI5 A;  1TWA H;  4LFC L;  3GTJ H;  3RNU A;  1CKN A;  1NMF A;  1Z47 A;  4HJ9 A;  3MEF A;  3CD6 A;  5IWA L;  3J81 j;  2ZJR A;  4DR2 Q;  4C3J H;  4DR3 L;  3NEN A;  5LMN Q;  1PH3 A;  5J3B A;  2NZH A;  3PUX A;  2NN6 I;  3M4Q A;  2N49 A;  4R1J A;  4JI4 L;  3KYH C;  4DV4 L;  3T1H L;  1HZ9 A;  1MIU A;  3PF5 A;  1TXY A;  1YHA A;  4WJ4 A;  3S1Q H;  1HNZ L;  3D0F A;  1Q81 C;  4P71 A;  2Q2T A;  4LF8 Q;  1IYJ B;  5ELO A;  1BVS A;  1OXS C;  3GO5 A;  3K8A A;  3J81 i;  1VQ9 A;  2ZJQ A;  1OTC A;  1N32 Q;  2NVY H;  1HR0 L;  4LFB L;  5C0X J;  4LNQ A;  3S1R H;  1S3O A;  3J7A 5;  4X65 L;  5JJL A;  3HOZ G;  2K5H A;  3PUZ A;  5IP9 G;  1IBM L;  2Q2U A;  4AYB E;  1YJW A;  3CCJ A;  2UXC L;  2NN6 G;  1L1O B;  1CSP A;  2MO1 A;  1VQO A;  1I94 Q;  1WJJ A;  3KJP A;  2F52 A;  1FJG L;  2UUB Q;  2V1C C;  4OX9 Q;  2JEA I;  4ME3 A;  5LMN W;  4DV5 Q;  3I4N G;  4DV6 Q;  1MJC A;  1AH9 A;  4IOC A;  3M4O H;  4DR7 L;  3D31 A;  1QZG A;  1BBU A;  3AFP A;  1P8L A;  1N8R C;  1E7Z A;  1DGS A;  3HOX G;  3PO2 H;  2CKZ B;  4JOI A;  5IYB H;  1W3S A;  2VY3 A;  3TEH B;  2Y0S E;  3KF6 B;  3FP9 A;  4IJL A;  4DV7 Q;  1CSQ A;  2JK8 A;  2YTX A;  3HOW G;  4A4I A;  5M3M G;  3CQZ H;  4C3H H;  5M5X H;  3MXN B;  3F2D A;  4GNX A;  1PV4 A;  5JEA J;  3I4M H;  2Z0S A;  2E8G A;  1VQ7 A;  4MTN A;  3WWV A;  1ASY A;  3CAM A;  1UWV A;  5IY0 A;  3A74 A;  4P73 A;  4LF9 Q;  3J80 i;  2AHO B;  2YU9 H;  4DR1 L;  4OWW B;  1V9P A;  4BBS G;  3KF8 B;  2MQH A;  1V1Q A;  1WOC A;  1GO3 E;  1H95 A;  1ASZ A;  1VQP A;  1PH8 A;  3S16 H;  5C0X I;  5M5W H;  2UU9 L;  1A0I A;  2GVA A;  4RG1 A;  1U5K A;  1BBW A;  1JE5 A;  4DK3 C;  2RF4 A;  3H0G G;  3L2P A;  1EQQ A;  1CKO A;  2I5M X;  1K73 C;  2R6G A;  1QUQ B;  4DKA C;  3OTO Q;  4JI5 L;  2IT1 A;  2H5X A;  3I55 A;  2KCT A;  4B3S L;  4AQY L;  5BR8 L;  2E5L L;  1YEZ A;  1LTL A;  2YTY A;  4JBJ A;  1PYS B;  2EXD A;  3CW2 C;  2D0P A;  4PZ8 A;  4HJ8 A;  4A3B G;  1YBY A;  4UP8 A;  1VQG A;  4DR4 Q;  1Q12 A;  4POF A;  5C0X G;  4NB3 A;  4JV5 L;  4A3I H;  4JI7 L;  2YV5 A;  5C4J H;  5IYB G;  4YCU A;  3W1B A;  1X6O A;  5C4X H;  3HOV H;  3PO3 G;  4BXX H;  1I6H H;  1UE7 A;  3U4Z A;  2JA7 H;  1W2B A;  1M90 C;  3I4M G;  2CWA A;  2WP8 J;  4GS3 A;  3G71 A;  4GKK L;  3AYH B;  2E2H H;  4LF7 L;  5JJK A;  2R7Z G;  1G6P A;  2GN5 A;  1YHB A;  2JQO A;  3UE0 A;  5C44 G;  3CCU A;  1PA6 A;  4JC0 A;  5M5Y H;  2E2I H;  3AEV A;  4JYA L;  2VS1 A;  1IBK Q;  4YHH L;  4L5S A;  2VQF L;  2OTJ A;  4HIM A;  4LUO A;  2WB1 G;  1JB7 A;  3ICE A;  2HHH Q;  1RIP A;  3KDF B;  4B3T L;  2JA6 G;  4O2D A;  4DR5 L;  3GTP H;  4JBK A;  4R4C A;  2LSS A;  1KHI A;  1Q1B A;  4L5T A;  4BY7 G;  1U0L A;  4BA1 I;  5JEA G;  1XMQ L;  1VQ8 A;  1X3G A;  1HZA A;  1YZ6 A;  2Z6K C;  3B6Y A;  2UXD L;  4K0K Q;  1KAW A;  1PHJ A;  4A3G G;  2F4V L;  1XMO Q;  3UDX A;  1X56 A;  3K80 C;  2VQE L;  2OQK A;  1K8A C;  2AWN A;  1J6Q A;  1N36 Q;  3VDY A;  1VQN A;  4AIM A;  3HKZ G;  1UE6 A;  4EX5 A;  4A3J H;  4DPG A;  2UUC L;  3J7Z C;  2VUM H;  4LUZ A;  4PMW A;  2JA6 H;  4IJH A;  4MNO A;  2HT1 A;  5HY6 A;  1KIX A;  4R4I A;  2PQA B;  4BXX G;  2UXB L;  4NXM Q;  4QQB X;  3CCV A;  4P74 A;  4HJ5 A;  1P16 A;  1VQF A;  1K8G A;  3HOU G;  1X9N A;  1M1K C;  1IBL Q;  1LUZ A;  1Y1V G;  3LGJ A;  2KHI A;  4JI0 Q;  1HNW Q;  2PNH A;  2DUD A;  3S1N H;  3F8T A;  1XNR Q;  2B29 A;  3HFZ B;  1UEB A;  1D8L A;  2LXJ A;  2IHE A;  4DUY L;  4DR3 Q;  3S14 H;  2HIX A;  4A3L G;  3U50 C;  1HNX L;  1VS0 A;  1B70 B;  5AJ3 L;  2RCN A;  3NEM A;  1X65 A;  1Q7Y C;  1YI2 A;  3I7F A;  4KHZ A;  1TWH H;  2BA0 A;  4GKJ L;  4L5Q A;  4DUZ Q;  4NPS A;  4JI8 L;  2KHJ A;  1IL2 A;  2JA5 H;  4OWX B;  5FJ8 H;  5IYD H;  4LFA Q;  1JT8 A;  2K5N A;  2K50 A;  4QGU A;  4QIW E;  3Q8D A;  4A3E H;  2R93 H;  4OWT B;  1L1O C;  3PUV A;  1KL9 A;  4P75 A;  4YWL A;  5EAY A;  1WCM G;  3DLL A;  1AE3 A;  4IPG A;  4GOP C;  1A63 A;  1B7Y B;  2NZO A;  4A3F G;  2VL6 A;  4DR2 L;  1SRO A;  1E1O A;  1XNQ Q;  2UXC Q;  5LMN L;  3CPW A;  4LF5 Q;  2ZM6 Q;  4GOP B;  4J15 A;  5HGQ A;  3STB C;  4BY1 G;  1SR3 A;  3J81 c;  1JMC A;  3CMA A;  1Z9F A;  3CCL A;  4DR7 Q;  2PI2 A;  2I5L X;  3KFU A;  1EIY B;  3FKI H;  4LF8 L;  3GD7 A;  1Y1W H;  4GLX A;  1K0R A;  4KHP Q;  3EIV A;  1E3P A;  1E1T A;  1FGU A;  1FVI A;  5C3E H;  4C2M H;  4GN4 B;  5FLM H;  3OW2 A;  1E24 A;  1EYG A;  1VQK A;  2QEX A;  4DV1 L;  4XTC S;  3S15 H;  2R92 H;  4A93 H;  1X54 A;  3A5U A;  4OON A;  1N34 L;  1I50 H;  2WAQ E;  3G48 A;  1OXT A;  1I94 L;  2OQ0 A;  4X64 Q;  4YCW A;  2UUB L;  4LF6 Q;  4DR1 Q;  4DV6 L;  1X55 A;  1J5E Q;  1VQA A;  3UE1 A;  4DAM A;  4A3E G;  4HJA A;  1PH5 A;  2UU9 Q;  3CCS A;  5M3F H;  2IX0 A;  1O7I A;  4JI1 L;  3S24 A;  2D0O A;  4OXP A;  2OWO A;  4BA2 I;  2KCM A;  3CCE A;  4A3M H;  3AFQ A;  3I2Z A;  4DV7 L;  2XGT A;  2YYZ A;  5GAH C;  1LM0 A;  1QVG A;  4JI5 Q;  2KEN A;  4H02 A;  4JBM A;  4A3K H;  2AKW B;  4O0A A;  1IZ6 A;  1I5F A;  1VQE A;  3FHW A;  3NBH B;  4JCV E;  3J80 c;  1K9M C;  3PIP A;  4LF4 L;  1AE2 A;  4IFD J;  2VNU D;  2LXK A;  4JBW A;  4YY3 L;  1EFW A;  4HIK A;  4JI6 Q;  1SMX A;  1VQM A;  2CQO A;  1SRU A;  1NTG A;  4R4O A;  3PO2 G;  3TRE A;  1KXL A;  3KLW A;  4JI7 Q;  5LMU Q;  4IOA A;  1CKN B;  4DV2 Q;  1C9O A;  4QL5 A;  5FLM G;  3EN2 A;  4DR6 L;  4BBR H;  1YIJ A;  1BKB A;  3PF4 A;  2EIF A;  4A93 G;  1L2F A;  3TQY A; 
#chains in the Genus database with same CATH topology
 4XXE A;  2ERH A;  1HZC A;  2CW0 D;  3BVM A;  3E9I A;  3ER0 A;  3JAM i;  3S1N B;  3GTO H;  2OTL A;  4WYM A;  1GPJ A;  3NP8 A;  4C3J B;  1JJC B;  3N6R A;  4FP5 D;  2ENB A;  4TVA B;  4DR4 L;  1EMV A;  1JOR A;  4Y7N H;  1EWC A;  3RR5 A;  3RUZ A;  5M3F G;  1KD1 Q;  1Q46 A;  1K8M A;  3PIO A;  2OTJ P;  1TWH B;  3BJU A;  3K7U C;  2DGY A;  2UUA Q;  3GTM H;  3I56 A;  1QJO A;  3I3C A;  2EYO A;  1EIF A;  1AW7 A;  3MVV A;  4G57 A;  4XRO A;  2L4B A;  5KP7 B;  4KV6 A;  4UPA A;  2OEO A;  3W5O A;  4A3E B;  3I56 P;  2NVY B;  4NXN L;  5EW5 E;  1EY7 A;  1T8K A;  3G21 A;  2Z4I A;  5GAE C;  3U43 A;  3PIP 3;  1GUW A;  4U0E A;  2QDL A;  4A3I G;  3GP7 A;  5CBA E;  4JI3 L;  2D62 A;  2HHH L;  1TWC H;  4GNX C;  1S72 A;  1GVP A;  5KNB A;  4XFZ A;  5C4X G;  3G29 A;  4XT1 B;  4B3R Q;  1B1Z A;  4X66 L;  4IFD G;  4JI2 L;  3H15 A;  3RLO A;  4GN5 A;  4LFC Q;  2XTI A;  1Q82 C;  3CCV P;  2B2T A;  2ES2 A;  4C2M B;  1Q1E A;  1RL2 A;  1D7Q A;  1PH4 A;  3MC0 B;  1CT1 D;  1V1O A;  3DM3 A;  5AJ3 Q;  2ZTE A;  2V4D A;  3T1H Q;  1R9T H;  3DEP A;  2JEB I;  1MGS A;  1HNZ Q;  1L0I A;  3ULL A;  5JOB A;  4DAY B;  5FLX E;  4HIO A;  1QRJ A;  3HOY G;  2WV6 D;  1VQD A;  1MJE A;  2XNA C;  4CJ0 B;  1GM5 A;  4CDD C;  1IBL L;  3ERO A;  4AYB B;  2C35 B;  4A3M B;  1JB3 A;  1TWG H;  3IL8 A;  1YNJ D;  2N6Z A;  2CCZ A;  1RJT A;  3H91 A;  1LV9 A;  1S5E D;  5CZD B;  2Q2H A;  1RNI A;  3S17 H;  3GKL C;  1H9R A;  1I4G A;  2F0V A;  2RDH A;  1NNX A;  4U0C A;  4LFA L;  3MXG A;  3KDF A;  1N32 L;  2RVL A;  2N50 A;  1QOH A;  4X3T A;  2A19 A;  1YJ9 A;  4FXG C;  5IGE A;  2WAQ B;  2F3V A;  2VB2 X;  5D3I B;  2KED A;  2F0U A;  2HQE A;  3HZX A;  3GTO B;  4G7O C;  5FK9 C;  3K5M A;  1JWS D;  5FJ8 G;  5IYD G;  4MRT C;  2Z6K A;  5IYC G;  2JA8 H;  1SYB A;  2EQS A;  1HHV A;  5C0X H;  4BPH A;  4IPY A;  3PV0 A;  1PH7 A;  1X3O A;  4JI1 Q;  4QY7 A;  3F2B A;  3GTM B;  3CCM A;  2Z45 A;  1PTO D;  2K04 A;  3GTK H;  4WRD A;  3FPU B;  3HKZ E;  3PO3 H;  4AQY Q;  2A6H C;  4Y52 H;  4A3D H;  3CCM P;  4PMB A;  1A8V A;  2AVA A;  1KDB A;  1JOO A;  4V19 0;  1N8R Q;  4OIJ A;  1DON A;  1HJP A;  1VQH A;  1W6J A;  4RGN A;  2ZJP A;  4IPC A;  1KQS A;  1NE3 A;  4CKC A;  1M8A A;  1S40 A;  1TWC B;  3R8B A;  1PH2 A;  1PH9 A;  1HTP A;  2RBM A;  3TDQ A;  1WD1 A;  2PMZ E;  5JEA H;  1W2B O;  1SNM A;  4R4Q A;  5HGT A;  4L6T B;  4LF7 Q;  1PMR A;  3TS2 A;  4RHS A;  1SNC A;  4A3G H;  2L1B A;  3G7L A;  4K5W A;  4OGQ C;  3BDO A;  4A3C H;  1K73 Q;  4FVM A;  1M4V A;  3JC6 6;  4PXH B;  2MO0 A;  4GOP A;  2EYL A;  1XXG A;  4XDX A;  3M3Y H;  1EL0 A;  1R9T B;  3JAM c;  4KMU C;  2JA5 B;  5JAV A;  4K8I A;  3RN5 A;  2L0C A;  5HGL A;  2GZG A;  4OO1 G;  1JJG A;  3G6E P;  3PGZ A;  4RCN A;  4NXN Q;  3HOU H;  2F4V Q;  4EQ5 A;  1LO5 D;  1B44 D;  1TWG B;  4U0F A;  1YNN D;  2VQE Q;  1XPU A;  2L9F A;  4APV A;  5E3F A;  4JI3 Q;  3VA5 A;  4CGY B;  3IKJ A;  4A3L H;  2QIL A;  2K2Q A;  2KG9 A;  2UUC Q;  2GZI A;  2RHS B;  4DV3 L;  3S17 B;  3F2C A;  3ERQ A;  1K3R A;  3BZK A;  1SE3 A;  4X66 Q;  4JI2 Q;  2PW7 A;  1WCM H;  2JN4 A;  2FVE A;  4GN3 B;  1SN8 A;  4A3F H;  3HOZ H;  1HNX Q;  2XZ0 D;  2XIW A;  2F0D A;  1NJI C;  1CQF A;  1I3Q H;  1FD7 D;  4NMZ A;  1DOM A;  1VHN A;  2EIA A;  2NVT H;  5HVC A;  5F2O A;  2F0K A;  2QA4 P;  1XTD A;  4PG3 A;  4RCO A;  1ZYR C;  5IP7 G;  4BY1 H;  4KLK A;  2JYL A;  1AEX A;  2JA8 B;  1I4X A;  3SK4 A;  1K8A Q;  4B9W A;  2BOS A;  4C1N I;  1ENC A;  2ZT9 C;  3CD6 A;  5IWA L;  2Q8T A;  2ZJR A;  3GTK B;  1UNS A;  3EJI A;  3PO3 B;  1B53 A;  4A3D B;  2SOB A;  3CD6 P;  1UEA B;  3CPW O;  1B9N A;  1MIU A;  1TXY A;  1SYG A;  2RSN A;  4HR7 B;  5E1F A;  1Q81 C;  4P71 A;  4LF8 Q;  2F0S A;  2F0N A;  2ZJQ A;  1OTC A;  1N32 Q;  1JC7 A;  1EIA A;  3ZYY X;  4LNQ A;  2Z6B A;  3G4S P;  4BBR B;  2DNE A;  5JJL A;  2CQA A;  3DWP A;  1ESF A;  1Q81 Q;  2DNW A;  2A6E C;  3FMC A;  4B9X A;  2B39 A;  5C5M A;  1CSP A;  2MO1 A;  1VQO A;  1I94 Q;  3KJP A;  1FJG L;  2KGC A;  4CDE C;  4A3G B;  3NWT A;  4ME3 A;  5LMN W;  4DV6 Q;  1MJC A;  1J8I A;  1VQO P;  4XYQ A;  1HUN A;  5ELB A;  1QZG A;  4M0I A;  2HD3 A;  1E7Z A;  1OR5 A;  1R4Q B;  3HOX G;  1ZXT A;  3PO2 H;  4JOI A;  4ZYS A;  3M3Y B;  3HKZ B;  2EY2 A;  1W3S A;  2Y0S E;  3FP9 A;  3GTG B;  1JCK B;  4XRQ A;  2KG6 A;  1CSQ A;  3BS1 A;  2YTX A;  4FF2 A;  5M3M G;  1UUP A;  1Y8P B;  4C3H H;  1PV4 A;  3IAY A;  2GDW A;  3W2D A;  3HOU B;  4MTN A;  1ICW A;  1V1P A;  3DXJ C;  4OL7 A;  2B2T C;  4OWW B;  1DM0 B;  4V0B A;  4BBS G;  2MQH A;  2LL8 A;  5NUC A;  1H95 A;  5C0X I;  2GVA A;  4OEL B;  4DK3 C;  1BBW A;  2PMZ B;  1R4P B;  3UI2 A;  5CGK A;  1EQQ A;  1F2Y A;  3LMO A;  3Q6S A;  5J39 A;  3OTO Q;  3OIQ A;  3I55 A;  4B3S L;  1BXI A;  3SK5 A;  1YEZ A;  4JBJ A;  3KUP A;  4IAL A;  3Q23 A;  1TY2 A;  4PZ8 A;  4HJ8 A;  5ELE A;  4KTA A;  3HOZ B;  1HQM C;  4A3F B;  2Z4H A;  4PMC A;  3MXP A;  1I3Q B;  1F9S A;  5C4J H;  5HGN A;  1K9M Q;  2DY8 A;  2KA7 A;  4M1U B;  5CV5 A;  4BY1 B;  3I4N B;  1ICF B;  3U4Z A;  2JA7 H;  1STN A;  2LTE A;  1STE A;  3VR3 A;  4GKK L;  5KNC A;  3DS4 A;  4C3I G;  2R7Z G;  1G6P A;  2JQO A;  5C44 G;  4OIK A;  1MSH A;  1M74 A;  5M5Y H;  4HMJ A;  2VS1 A;  1IBK Q;  1EIH A;  4J1M A;  5TSS A;  2QF7 A;  3CCQ P;  4O2D A;  4CHT B;  3OMG A;  3NK9 A;  2K1B A;  4BY7 G;  4F37 A;  2Z6K C;  2UXD L;  2KUM A;  2E76 C;  2LML A;  3BDL A;  3TP7 A;  4IUV A;  1HTL D;  2XV6 A;  2OQK A;  2MVU A;  5JVH 3;  4DK1 A;  2QEJ C;  1VQN A;  3T51 B;  1KLU D;  1HFG A;  2PYK A;  4A3J H;  2VUM H;  1ET6 A;  1DOK A;  2N5I A;  4PMW A;  5IGC A;  1VQN P;  4R4I A;  2PQA B;  3OWE B;  4A3B B;  4LMQ D;  4P74 A;  5KP8 B;  2XT1 A;  1D1I A;  1Z6M A;  3PO2 B;  5C5L A;  1BCP F;  2PNH A;  2F0I A;  4UAI A;  1WTX A;  1XNR Q;  2B29 A;  4IUT A;  1G8Z D;  4DUY L;  3S14 H;  2N88 A;  4C3H B;  5K36 H;  4L8J A;  1B70 B;  1L0H A;  1ESR A;  2X69 A;  1Q7Y C;  2K33 A;  4KHZ A;  3S1M B;  1F2Z A;  4N9T A;  2RA4 A;  4MN3 A;  4DUZ Q;  4JI8 L;  1ROD A;  4OWX B;  3VYT A;  4R8I A;  3TP8 A;  3PIO 3;  3NBI A;  1S5B D;  1PYW D;  2O4X A;  4QIW E;  3E0J A;  4OWT B;  3K57 A;  3PUV A;  4GOP C;  2VL6 A;  4DR2 L;  1G2T A;  4ZUI A;  2SNM A;  5LMN L;  1PRT B;  2ZM6 Q;  3CCJ P;  4RKB A;  1CA6 A;  4K6L A;  1Q86 Q;  4GLX A;  2Y0S B;  1K0R A;  2KCC A;  4U68 A;  2K5D A;  1E1T A;  2OF1 A;  3T4A C;  2WKC A;  4C3J G;  5FLM H;  5C3E H;  3OOC A;  1EYG A;  1VQK A;  2QEX A;  1DNY A;  2JA7 B;  3VA7 A;  1X54 A;  2IW3 A;  1STH A;  2K5X A;  2A69 C;  4DK0 A;  1I50 H;  3G48 A;  1Y1V B;  3K58 A;  2KOQ A;  3QOL A;  5M5Y B;  3NQI A;  4PQX A;  2SEB D;  3MTS A;  1ZMB A;  2PNG A;  3UE1 A;  4DAM A;  4A3E G;  1GUT A;  3E6Z X;  1K3B C;  5EPJ A;  2D0O A;  5A2Q L;  2F03 A;  4DV7 L;  2YYZ A;  3L9A X;  5E4X A;  4KD4 A;  4A3K H;  2AKW B;  4O0A A;  1IZ6 A;  3R93 A;  3FHW A;  4LF4 L;  4JK1 C;  1CEI A;  2WII B;  4JI6 Q;  1SMX A;  1LT6 D;  1CQV A;  2CQO A;  2PEN A;  3CXC O;  3D6W A;  4QUC A;  2DJF C;  1WTV A;  4KY7 A;  1CKN B;  4DV2 Q;  5EKK A;  4QL5 A;  4A3J B;  2VUM B;  3SXH A;  1EZ6 A;  1I4H A;  2K0D X;  1YIJ A;  3QG1 A;  4BPG A;  1STY A;  4KJN A;  1PFN A;  2KBN A;  1YIJ P;  2K93 A;  1VMP A;  1UE5 A;  3CC4 A;  2JXM B;  3S14 B;  2G9H D;  1OXX K;  3M9B A;  3HKS A;  4AYB G;  2MNA A;  2PEO A;  4K5X A;  1A43 A;  2QDB A;  1MBY A;  3HZQ A;  1B4O A;  3H6M A;  4DV0 Q;  2E2D C;  1ZEQ X;  3K81 C;  3M85 A;  1WTO A;  3T1Y Q;  1PFB A;  1STA A;  2CFM A;  2IHF A;  3PSI A;  2UXD Q;  1TQO A;  3WDN A;  4F87 A;  3Q20 A;  2Z46 A;  3A7A B;  5CV7 A;  2DN8 A;  1EQR A;  4JOI C;  2F0H A;  5H1S E;  2CWO A;  1D5Z C;  1SFO H;  2JGP A;  2F0L A;  3TRZ A;  3T16 A;  3OIP A;  5IOC A;  1D5X C;  2A73 B;  1X3P A;  4YIJ A;  1NMG A;  4GNX B;  3KF8 A;  2NO8 A;  4H2W C;  2RHQ B;  3MHB A;  3EA6 A;  2JP1 A;  5J1Z A;  4PH0 A;  1EY8 A;  3X3N A;  2XRS D;  4H2Y C;  4QJF A;  1GUO A;  4QMG A;  4XIG S;  4BWG B;  1RDP D;  4DNR B;  1I50 B;  2NN6 H;  2A8V A;  4QIW B;  3FRP B;  1YI2 P;  5K5P A;  1LTB D;  1YHQ A;  3S2H H;  1HR0 Q;  2N8N A;  5JPA A;  2GA4 B;  2WFW A;  1YIT A;  2ZTD A;  2WAC A;  2JYG A;  1D5M C;  2KOR A;  1YVC A;  3I8Z A;  1D1K A;  4FXD A;  1YIT P;  1VQJ A;  1E2W A;  2OXP A;  2XVS A;  1G29 1;  2L12 A;  2PEJ A;  2F0T A;  4IO9 A;  1SLJ A;  2KOP A;  2B3G A;  5KP6 B;  3CE7 A;  1EOV A;  2EOT A;  3CMA P;  4U0A A;  2NVX H;  2KW2 A;  4UP9 A;  5LL6 X;  2K92 A;  1NCV A;  2C5C A;  2K28 A;  2PW5 A;  3HOV B;  5CYU A;  2EYH A;  3I72 A;  2SDF A;  3RZO H;  5EGT A;  3RG6 C;  2L15 A;  3RLF A;  5KIX A;  3A8I E;  4H44 C;  1K83 H;  2JE6 I;  4MIU A;  1KAB A;  2K05 A;  2JA5 G;  4OX9 L;  3K6O A;  5COY A;  4DV5 L;  3A5Z B;  3AQQ A;  2A1A A;  2ZTC A;  5GAG C;  4GR2 A;  1SNP A;  5FO7 B;  3GTP B;  4DK6 C;  4KHP L;  3RN2 A;  1UAP A;  2BE5 D;  2LIU A;  4COC A;  2KOO A;  5DAU A;  4LF4 Q;  4LF6 L;  4RMF A;  1EWI A;  4LF9 L;  3FKI G;  5C3X A;  5C6A A;  1SFO B;  1XPO A;  1Y1W G;  2MF4 A;  1VQ6 A;  4JV5 Q;  1VQM P;  4N8X 1;  1GUS A;  3J81 E;  1XYI A;  3CKI B;  1B8A A;  2LY7 A;  4AH6 A;  2R92 G;  1KD1 C;  3GTQ H;  1S4Z A;  2FQ0 A;  3WOF A;  2JU2 A;  3SDZ A;  3TP6 A;  4ID6 A;  4GLV B;  3V05 A;  2CH4 A;  4ODG A;  1NAP A;  3A7L A;  5F2K A;  2JA8 G;  3E5S A;  4UP7 A;  4DAV A;  5HUR A;  2OTL P;  1LTT D;  4B3T Q;  4DR5 Q;  2KGA A;  1L1O A;  5LMU L;  4FNF A;  4FXK C;  4PZ7 A;  3KOJ A;  1DXM A;  3NTK A;  4A3D G;  3S2H B;  1ZKO A;  2R93 B;  1VQI A;  5FO8 B;  1H9M A;  1X3F A;  2LOL A;  4X62 L;  1VQ5 A;  2A68 C;  1VMC A;  3SK8 A;  3J80 E;  3S2D H;  4A75 A;  1MZ8 A;  1WTQ A;  4NP5 A;  4EQO A;  2K01 A;  1VQ5 P;  3F2U A;  1WD0 A;  5CV4 A;  1M90 Q;  1F9P A;  2IY5 B;  2FHT A;  5KRU A;  2GVB A;  4BBR G;  5JJZ A;  3ND8 A;  3ZJY C;  2UXB Q;  4DXG A;  1S72 P;  4GR6 A;  4RHR A;  5EKL A;  2KJX A;  5CBE E;  4I7Z C;  4K2K A;  1LTI D;  3G0V A;  2NVX B;  2QNW A;  1KNE A;  3QIA A;  4CJ2 C;  3PQI A;  4A3C G;  2ONT A;  1Y69 U;  2H1E A;  3RZO B;  3RG2 A;  3TSS A;  5IP9 H;  2ATW A;  4F7X A;  3HEJ A;  1K83 B;  1B9M A;  5T1I A;  3CF5 A;  1QNK A;  1ACP A;  4G4K A;  2NBF A;  3M7N A;  2MFI A;  4CKE A;  2AF8 A;  1G91 A;  5BS2 A;  1F2L A;  2PEK A;  3JAM L;  1WI5 A;  1TWA H;  2I07 B;  5JPM C;  3KLR A;  5IT9 E;  2XZ1 C;  1F9R A;  1D6E C;  3NEN A;  2NN6 I;  1M1K Q;  4DV4 L;  4JI4 L;  1HZ9 A;  2F4I A;  3PF5 A;  5C4H A;  3SR1 A;  3J7A F;  1IYJ B;  5ELO A;  2EYP A;  3K8A A;  3J81 i;  2EVB A;  4LFB L;  5C0X J;  5IGG A;  3S1R H;  1S3O A;  3J7A 5;  3OW2 O;  4X65 L;  3HOZ G;  1IBM L;  3GTQ B;  1YJW A;  3MWY W;  2N98 A;  1YJ9 P;  1L1O B;  1WJJ A;  1JIC A;  2F52 A;  5L37 A;  4OX9 Q;  1YJW P;  5JPN C;  4DV5 Q;  3I4N G;  3M4O H;  4HAE A;  4P2C B;  1CI3 M;  2DY7 A;  2FVA A;  2OAR A;  4Y7N B;  1K28 A;  1P8L A;  1AYI A;  1N8R C;  1DZ1 A;  4HCE A;  3BYY B;  4HSV A;  1RTN A;  5IYB H;  2L4N A;  2VY3 A;  4IJL A;  4WJW A;  1KAA A;  3HOW G;  5M5X H;  1FNV A;  5JEA J;  2FHS C;  1VQ7 A;  3WWV A;  1ASY A;  2JU1 A;  4X3K A;  5IY0 A;  1PDQ A;  4LF9 Q;  2EPB A;  3J80 i;  1LT3 D;  2YU9 H;  1HFN A;  1VQ7 P;  3S2D B;  4PH1 A;  1BUV T;  2JA6 H;  4K8J A;  3H0G G;  1CKO A;  2I5M X;  1K73 C;  4QB4 A;  4JI5 L;  4EGV A;  4CDC C;  4N9P A;  1LT4 D;  5BR8 L;  2E5L L;  5EPL A;  1LTL A;  2YTY A;  4B08 A;  4UHP B;  1PYS B;  2A6H D;  3CW2 C;  4A3B G;  1ENA A;  3CRK C;  2EE1 A;  4DR4 Q;  1ET9 A;  1EZ8 A;  4A3I H;  4JI7 L;  2YV5 A;  2GZJ A;  1LT5 D;  4YCU A;  1ILP A;  2EYF A;  2L9H A;  5KYI A;  2M5R A;  4H2X C;  5C4X H;  4C3H G;  1I6H H;  4LAA A;  4ZAI A;  3MEH A;  4IFD H;  2E2H H;  1TWA B;  5JJK A;  2GN5 A;  3UE0 A;  3CCU A;  3GZL A;  4JC0 A;  4JYA L;  3NTH A;  1GHJ A;  2VQF L;  1G6Z A;  2WB1 G;  1JB7 A;  3TZD A;  2HHH Q;  1WVL A;  3KDF B;  4R4C A;  3J7Y W;  1Q1B A;  4L5T A;  1QIL A;  1U0L A;  4BA1 I;  1XMQ L;  1HZA A;  3OWF A;  1U4L A;  1NR2 A;  4F8M A;  3B4Q A;  2J0T D;  5T1G A;  2L55 A;  1K8A C;  1J6Q A;  4ME5 A;  3VDY A;  4AIM A;  5BN3 A;  1FR2 A;  1JQY D;  4ZRZ A;  1CHQ D;  1UE6 A;  2HT1 A;  3G1I A;  3M4O B;  3FVQ A;  4HJ5 A;  1VQF A;  4DN4 M;  1X9N A;  1LAC A;  5EJD A;  1SMY C;  1IBL Q;  1Y1V G;  2KHI A;  1SDF A;  1SJH D;  2VSQ A;  2O5J C;  1CFM A;  4CA3 A;  1UEB A;  1VF5 C;  1B50 A;  1TR5 A;  1SND A;  1GOZ A;  2HIX A;  5M5X B;  2G9D A;  5DM7 3;  3ITP A;  5KGU A;  1RHP A;  1AUM A;  2KHJ A;  2YU9 B;  1A2T A;  1FNU A;  2PZT A;  5FLX L;  1KC8 Q;  5FJ8 H;  5IYD H;  4LFA Q;  1JT8 A;  4UDU C;  1ZYR D;  3Q8D A;  4IUU A;  2EZV A;  2JA6 B;  3D4W A;  1L1O C;  4YWL A;  1KL9 A;  2K32 A;  3HGB A;  5IGF A;  4EVO A;  1A63 A;  1RD9 D;  4WOR A;  2NZO A;  3R2T A;  1RKN A;  1SRO A;  2AFE A;  3P7J A;  4GOP B;  4J15 A;  3MA2 B;  2BUO A;  3STB C;  1EEI D;  1SR3 A;  3J81 c;  1JMC A;  4OEM B;  4JW0 A;  2PI2 A;  3C46 A;  1LTR D;  3GD7 A;  1K0S A;  4ZUJ A;  4KY6 A;  4A3I B;  1E3P A;  1FVI A;  5C4X B;  4DV1 L;  1M6N A;  1I6H B;  3S15 H;  4A93 H;  1FR3 A;  4DAP A;  3A5U A;  1CA5 A;  4R9W A;  1BQQ T;  1HY8 A;  2E2H B;  4PWV B;  1HCZ A;  2A6E D;  2OQ0 A;  3HRZ C;  2UUB L;  2LKV A;  2MGS A;  4TKO B;  3S9W A;  4HJA A;  3CCS A;  2EHT A;  5ISR A;  1O7I A;  3C3L A;  4RGT A;  2MUY A;  2XGT A;  5GAH C;  4ZLT F;  4HMI A;  2XXM A;  3NQT A;  4JI5 Q;  3J80 c;  1QVF O;  1K9M C;  3P20 A;  3PIP A;  1EFI D;  2VNU D;  4JBW A;  4NKL A;  4YY3 L;  3I55 P;  2J7Z A;  1EFW A;  1WCM B;  1SRU A;  1NTG A;  5BN4 A;  1EWH A;  5I6W A;  3DS2 A;  3E2D A;  3KBX A;  3KBG A;  1ZNV A;  4JI7 Q;  2TMP A;  2F0W A;  2NVT B;  3DHQ A;  1S5D D;  5FLM G;  1EY5 A;  1GUN A;  4DR6 L;  2FMC A;  3KLS A;  4DXF A;  1L2F A;  3QJY A;  3GDE A;  3GTL H;  2B2Y A;  3BZC A;  3EQL C;  3LX0 A;  2B63 H;  4JG2 A;  1F2M A;  1AP0 A;  1G51 A;  4UHV A;  1OXU A;  2L0Q A;  3CXC A;  1IXR A;  4XYO A;  3H3V H;  5FLX c;  1SSO A;  2F3W A;  2F0G A;  2F0E A;  4DV3 Q;  1V43 A;  1NY4 A;  2HCC A;  4DGZ A;  5IP7 H;  5IT9 c;  4IFD I;  4IPH A;  2K52 A;  1LAB A;  4TSS A;  3KF6 A;  3V96 A;  5J22 A;  1B3Q A;  1GKH A;  2BA1 A;  2ZXP A;  2L6E A;  3K0X A;  4RH6 A;  3J7A V;  1T5X D;  1EU4 A;  1VF7 A;  2X6L A;  4E6I A;  1EY6 A;  1BBX C;  2CVR A;  4MZ9 A;  1CKM A;  2F0O A;  1NUC A;  1H9S A;  4HID A;  3HOV G;  3UDI A;  2R61 A;  3QB3 A;  4LUV A;  1C0A A;  1N33 L;  1SE8 A;  3DEO A;  3G1G A;  2N3S A;  1V1P B;  1SYE A;  3RLN A;  1FL0 A;  1QVC A;  1XX8 A;  3A0J A;  1LLR D;  5IWA Q;  1XMO L;  5I4D A;  2GZF A;  3KJO A;  3S15 B;  1Y14 B;  4A93 B;  1VKU A;  4YWK A;  1A6X A;  1N36 L;  5GAD C;  5CC4 A;  1VQC A;  1C7Y A;  1TS3 A;  2ASB A;  1SYD A;  1LTA D;  1H9J A;  3OYY A;  1HZB A;  4RWS C;  2QGQ A;  2IPK D;  3MAQ A;  3CCR A;  2Z1C A;  1WFQ A;  1HNW L;  3HOX H;  1L0W A;  1Q90 A;  2RCF A;  1Q86 C;  4BS9 A;  2PNR C;  2KEC A;  1KLG D;  3AB9 A;  2VLN A;  3BVG A;  4PV1 C;  5M3M H;  2RDG A;  1FJG Q;  5JJI A;  3D6C A;  3ND9 A;  1WTW A;  4BBS H;  3EFX D;  3CP0 A;  1RTO A;  3I4O A;  5EPK A;  5C4J B;  2LPK A;  2AQ2 B;  2JO0 A;  1ILQ A;  5LL6 S;  2FXQ A;  1RCV D;  3H94 A;  1UE1 A;  2VB3 X;  4DV1 Q;  1GHK A;  3GTL B;  1XNQ L;  4RA8 A;  4LF5 L;  2PEI A;  1VQK P;  2B63 B;  2QEX P;  2F0F A;  3RD4 A;  1EEF D;  1BXT A;  2VLP A;  4IPD A;  2E2J H;  2DJG C;  2R93 G;  3DWQ A;  1OXV A;  1BAJ A;  2AWO A;  4G7H C;  1AZQ A;  3EJB A;  4FF4 A;  1LTS D;  3N52 A;  1PRT F;  5HGM A;  3MZ5 A;  1KRS A;  1QE6 A;  5CV8 A;  1U4R A;  2TSS A;  4B3S Q;  2K03 A;  4LW1 A;  5E7N A;  4TQU S;  3NY7 B;  1IUQ A;  4WJ3 M;  3TS0 A;  4YY3 Q;  2A69 D;  4C3I H;  4X64 L;  3D3R A;  2R7Z H;  1W6K A;  1XTC D;  5C44 H;  4R8N A;  2RQX A;  1JJ2 O;  1J5E L;  3I73 A;  2WKD A;  2K4K A;  5I2Y A;  2PZU A;  2NVQ H;  4S3S A;  4DR6 Q;  2K5V A;  4BY7 H;  2RKS A;  3EJE A;  5I6Y A;  4GKK Q;  1EOQ A;  1BOS A;  2EDG A;  5KYL A;  4OO1 I;  2KVM A;  1EUJ A;  3K7A H;  1BO0 A;  3C1F A;  1PZI D;  4WFN 3;  5ELF A;  2PZW A;  3CC4 P;  2JJQ A;  3UDG A;  1PFS A;  4DFA A;  4A3M G;  3EBE A;  1MKH A;  1X32 A;  3CME A;  1YNX A;  4CJ1 B;  1S5F D;  4DG9 A;  1PTO H;  1BCP C;  1EQT A;  3HOX B;  1GD7 A;  2VW9 A;  4YWM A;  1STG A;  3K0Y A;  3TME A;  1PYB A;  4C1N K;  3MXN A;  3H3V I;  1VCI A;  3PUY A;  1E0H A;  2AMC B;  2HQL A;  2UUA L;  2WAQ G;  1EYD A;  4HN7 A;  1Q8K A;  3HP3 A;  1N33 Q;  4KKU A;  1AF8 A;  2KOS A;  3NEL A;  1PH6 A;  2ID0 A;  2X2B A;  5C3E B;  4DUY Q;  3IRB A;  1PH1 A;  4XQJ A;  1QUQ A;  2MY5 A;  2K14 A;  1VQ4 A;  5ELN A;  4IUQ A;  2C9O A;  3NBH A;  2IX1 A;  2JSO A;  2MHV A;  1Z7T A;  4JI8 Q;  5HV8 A;  1MHW C;  3BYT B;  2E2J B;  4NXM L;  4B3R L;  1EIG A;  3JAM E;  4JI0 L;  3BU2 A;  4LFC L;  3RNU A;  2ZXR A;  2PQE A;  1YHQ P;  3QWN A;  1NMF A;  4HJ9 A;  3MEF A;  4DR2 Q;  1FGB D;  1I4R A;  4C3J H;  3AU7 A;  3DWA A;  4A3K B;  2EY6 A;  5LMN Q;  4I65 A;  2B2Y C;  2XRQ D;  3M4Q A;  2JAZ A;  3PUX A;  4R1J A;  4ILW A;  3KYH C;  3T1H L;  1EYA A;  1GXH A;  4C3I B;  2R7Z B;  3S1Q H;  5C44 B;  1HNZ L;  1E0B A;  1BVS A;  2CNR A;  2M8L A;  1OXS C;  3GO5 A;  1VQ9 A;  2NVY H;  5G3L D;  1KNA A;  2NVQ B;  1RO0 A;  1QCB D;  5DCK A;  1RF2 D;  3H0D A;  1VQ9 P;  1PRT D;  3PUZ A;  5IP9 G;  2B8F A;  3GV3 A;  4O42 A;  4BY7 B;  4AYB E;  3CRL C;  3E3X A;  2FAE A;  3H3V C;  2FVF A;  2LFN A;  1AH9 A;  2K6A A;  1IW7 D;  3D4D A;  3OSO A;  3AFP A;  1DGS A;  2NWG A;  1A3V A;  2CKZ B;  1AZP A;  3NTE A;  3TEH B;  4DV7 Q;  4A4I A;  3MXN B;  2EXZ A;  3I4M H;  1CM9 A;  2LIW A;  2CG5 B;  1UWV A;  3A74 A;  2IJ0 A;  4XQQ A;  4P73 A;  2Q8R E;  2IX3 A;  2CH4 W;  1IKM A;  4RFB A;  4DR1 L;  2A5H A;  4X3S A;  1V9P A;  3KF8 B;  2KGD A;  1WOC A;  1GO3 E;  1ASZ A;  1VQP A;  3S16 H;  5M5W H;  2UU9 L;  1TII D;  3SEB A;  4RG1 A;  1U5K A;  1JE5 A;  4CDF C;  3L2P A;  1VQ6 P;  2CW0 C;  4ABN A;  1HA5 A;  2R6G A;  1QUQ B;  2ICI A;  4DAY A;  4DKA C;  4DA2 A;  3VR5 A;  2JQ4 A;  2IT1 A;  2F0J A;  2KCT A;  1IHZ A;  1Q3L A;  4AQY L;  3SE0 A;  1SYC A;  4EQN A;  1DOL A;  1JOK A;  4IUR A;  1VDZ A;  1A3T A;  4L63 B;  2EXD A;  2PEQ A;  5CV9 A;  1Q12 A;  3D8G A;  4O1N A;  5C0X G;  2MR7 A;  3R3O A;  2KEE A;  1O78 A;  1I4P A;  5IYB G;  2NTS A;  5A35 A;  1J9O A;  4U0B A;  3PO3 G;  4BXX H;  1W2B A;  1M90 C;  2CWA A;  2WP8 J;  4ZK9 B;  3VYR A;  3AYH B;  4LF7 L;  2E74 C;  1YHB A;  2E2I H;  1Y8N B;  1EU3 A;  2JB0 A;  2E75 C;  4YHH L;  4L5S A;  2OTJ A;  4HIM A;  4LUO A;  1A8O A;  3ICE A;  1RIP A;  4M8A A;  2JA6 G;  1II3 A;  2LSS A;  3NTI A;  3WOE A;  2JBG A;  3G28 A;  3LWE A;  3S1Q B;  5JEA G;  5IOD A;  3VR4 A;  3W3A A;  1X3G A;  1YZ6 A;  1C4Q A;  1PHJ A;  5KND A;  4A3G G;  2F4V L;  3UDX A;  1X56 A;  3K80 C;  2VQE L;  2L5T A;  2M2L A;  2AWN A;  5F2N A;  2A68 D;  2EJF C;  3HKZ G;  4ULL A;  1FNW A;  4DPG A;  2KHS A;  2B8G A;  2EY5 A;  2X6G A;  4LUZ A;  3J7Z C;  1CZW A;  5D65 A;  2UUC L;  5IGD A;  1KIX A;  1G2S A;  4NXM Q;  4QQB X;  5I2X A;  2B2U A;  2PO4 A;  3CCV A;  1P16 A;  1K8G A;  3HOU G;  2EYJ A;  1HA6 A;  1M1K C;  5CV6 A;  4JI0 Q;  4KKS A;  2DUD A;  1KDC A;  5FKA C;  1YNJ C;  1U4P A;  3HFZ B;  2DNC A;  1D8L A;  2LXJ A;  1PZK D;  2QCP X;  3U9S A;  4A3L G;  2ICE C;  2AUK A;  3U50 C;  1HNX L;  1VS0 A;  3I4M B;  2GDY A;  3NHH A;  4NEO A;  2FFK B;  4GKJ L;  1WTP A;  1M6E X;  1Q82 Q;  1IL2 A;  3I90 A;  4HSP A;  2JA5 H;  1K8O A;  3NPP A;  1F77 A;  2K5N A;  2K50 A;  2PEM A;  3BDC A;  4KD3 A;  5M5W B;  3S16 B;  3M4Y A;  3DLL A;  1WCM G;  3DS0 A;  1AE3 A;  3EJD A;  1I4Q A;  2M8P A;  1B7Y B;  3GZM A;  1EYC A;  5ELD A;  4A3F G;  1EY9 A;  4NW2 A;  2MD9 A;  1BF4 A;  2D5D A;  4IZ6 A;  3CPW A;  4J8Q A;  5HGQ A;  4F88 A;  5C4Z A;  4BY1 G;  3NSW A;  3BVZ A;  1HQB A;  3EVQ A;  3I91 A;  1AN8 A;  1PFM A;  3KLS X;  3FKI H;  4XT3 B;  3TN2 A;  5M9O A;  1EIY B;  1Y1W H;  4LF8 L;  2FQ1 A;  1PTO C;  3OMC A;  4KHP Q;  2BDO A;  3FDT A;  1B3A A;  1ML0 D;  3A55 A;  4GN4 B;  2KOD A;  1E24 A;  1L0Y B;  2WIN B;  5CR3 A;  1HRJ A;  2MJ8 A;  1QVG O;  2R92 H;  3FEW X;  1N34 L;  4I7A A;  3WBH A;  1OXT A;  1I94 L;  5COR A;  2RSO A;  2E2I B;  4YCW A;  4LF6 Q;  3SVM A;  4DR1 Q;  4DV6 L;  2LS0 1;  1X55 A;  2NTT A;  3LWU A;  3CHB D;  2F0M A;  2UU9 Q;  1EY0 A;  1JR0 D;  5M3F H;  2GDX A;  2IX0 A;  4BA2 I;  3S24 A;  3H09 A;  5FO9 B;  1DJR D;  4H7B A;  3CCE A;  1OO9 B;  3DUZ A;  3VYS A;  2AQ3 B;  2KEN A;  4H02 A;  4JBM A;  3BG3 A;  2OT2 A;  1VQE A;  3CCE P;  4JCV E;  3A8K E;  2I46 A;  1A15 A;  2BDN A;  4IFD J;  2EFJ A;  2F0Q A;  2D2C C;  4R4O A;  3PO2 G;  3MGE A;  4U67 3;  1KXL A;  5LMU Q;  4Q0F A;  2JYO A;  1IKL A;  3L3O C;  1C9O A;  5KEE A;  3J81 L;  1B2T A;  4QF4 A;  1SXT A;  4KKT A;  5CMD A;  4BBR H;  4A93 G;  1BKB A;  4XFX A;  2NZ1 D;  3TQY A;  3OTO L;  2EY1 A;  1QVF A;  5GRO A;  4X62 Q;  1YNN C;  4HTH A;  1V8Q A;  4GZY C;  1JWM D;  1TS2 A;  4YHH Q;  3CCU P;  2HUG A;  4KN4 C;  1MI2 A;  2B2V A;  4Z9C B;  1JOQ A;  3NXW A;  3PMF A;  2KR5 A;  3G6E A;  3GTG H;  1E22 A;  5C3W A;  1UJZ A;  1DCZ A;  3TBI B;  3HOY H;  1CZG A;  1VQL A;  3DM1 A;  1NBW A;  1IYU A;  4YCV A;  3E9H A;  4P72 A;  3S1R B;  2LMC B;  1CK1 A;  1DD2 A;  1VQL P;  5EKI A;  4FO2 A;  1IBK L;  3LRY A;  1WYD A;  2IL8 A;  1GJX A;  3IFD A;  1X3Q A;  2Y0S G;  3J80 L;  4X6A H;  1BR9 A;  3GV6 A;  3E0E A;  3MFY A;  1A3U A;  2HDM A;  2PI2 E;  1T9H A;  4R4T A;  1CUK A;  4K2L A;  1PVO A;  1SBB B;  4RKL A;  4L5R C;  1HXY D;  2JA7 G;  1TS4 A;  2CHB D;  3RMH A;  3FKI B;  4GLA C;  3CU7 A;  1Y1W B;  1A62 A;  2B63 G;  4ZCK A;  3Q0A A;  2BH2 A;  1E2Z A;  1KC8 C;  3Q24 A;  1KLP A;  2R92 B;  2QA4 A;  3URY A;  4XQN A;  3OPO A;  4B3M L;  4RAU C;  4DV4 Q;  4JI4 Q;  3SGI A;  4GKJ Q;  2JA9 A;  4H0L C;  1O80 A;  4ZKC B;  3OW7 A;  3K59 A;  2YTV A;  2Q2I A;  3I4N H;  2CGQ A;  5IYC H;  4IZ8 A;  4LFB Q;  2MP1 A;  2B2W A;  3GQB A;  1NJI Q;  5M3F B;  1WTR A;  2QKI C;  1XNR L;  2D9U A;  1PLF A;  1TVX A;  1SMY D;  2MPM A;  5IT9 L;  4X65 Q;  4QKO A;  1IBM Q;  2F0P A;  1EOT A;  4FDB A;  3G26 A;  1HH2 P;  4A76 A;  2HCI A;  3F1Z A;  3HOW H;  3ULJ A;  4DNI A;  4KI0 A;  2Z44 A;  2R7D A;  4A3J G;  2VUM G;  2NB0 A;  3CC7 A;  1K30 A;  4DUZ L;  2FIN B;  3HS0 C;  1VQB A;  3CC7 P;  3G4S A;  4UY8 C;  1QZH A;  2EJM A;  3IFT A;  1SYF A;  2K75 A;  3RZD H;  2WB1 E;  3H0G H;  3AMU A;  5K36 G;  1HR0 W;  4K6D A;  1XWE A;  4HJ7 A;  2K7V A;  5I9P A;  1N34 Q;  4LK1 C;  1KRT A;  1FYC A;  2ZM6 L;  3CPF A;  3D4R A;  3ULP A;  5DLQ E;  3QO2 A;  3H4E A;  4A3B H;  3STB D;  1F9Q A;  5DNF A;  1KQS O;  3T56 B;  1YJN A;  4LWC A;  4QCL A;  2KGE A;  5IIF A;  3CC2 A;  4POG A;  5A2Q E;  2HIV A;  3ERS X;  3C1E A;  2GYK A;  3U4V A;  4NDX A;  3ONA B;  3CCS P;  1YJN P;  2PQA A;  2HDL A;  3CC2 P;  5BR8 Q;  3HOY B;  2B2U C;  2E5L Q;  2EYM A;  2K0X A;  2FMM A;  3A56 A;  1TWF H;  4KY5 A;  1SE2 A;  5GQO A;  4OO1 H;  3L7Z C;  5BS1 A;  1F80 D;  1ONL A;  3S1M H;  3L0O A;  1WTH A;  1O7Y A;  2XN9 C;  4BPF A;  5D14 A;  2R7F A;  3QOJ A;  1XPR A;  3DS3 A;  5HGO A;  4X3U A;  1QNU A;  4K5V A;  5C3E G;  1E6J P;  2BH8 A;  2F3I A;  5D3D A;  2L11 A;  2E1M A;  3R2I A;  4ALP A;  2WPT A;  1EY4 A;  4JYA Q;  4OHJ A;  2AFD A;  4JI6 L;  1N9W A;  2K0Y A;  2VQF Q;  2VZA A;  2PCF B;  2MR8 A;  2EHS A;  2P9X A;  3M4P A;  2XWB B;  1JJ2 A;  3T13 A;  1QB5 D;  4PZ6 A;  2N5H A;  2LKI A;  2P5Z X;  4DV2 L;  3A54 A;  4U0D A;  2OCE A;  5LHY 1;  2XWJ B;  4A3K G;  1XMQ Q;  1LYL A;  1C8C A;  1Y1V H;  3VR2 A;  2KG8 A;  3UDF A;  3U58 A;  5JVG 3;  2SNS A;  3CCQ A;  3FPP A;  1BCP B;  3HOW B;  1BNZ A;  3MFG A;  2K5Q A;  1T5E A;  4TRD A;  5IE8 A;  1X3E A;  2N78 A;  4DV0 L;  4IN3 A;  1TT2 A;  4HED A;  3P05 A;  2I5H A;  3PUW A;  3T1Y L;  2O5I C;  4K0K L;  1IMQ A;  5EQ0 A;  3G6J B;  3W1G A;  2O2L D;  2BHV A;  4IUP A;  5DM6 3;  3RZD B;  3PCO B;  3DS5 A;  3H0G B;  2I0Q A;  3OHX C;  3KK7 A;  2RDF A;  2FQ2 A;  2M9V A;  4LJZ C;  4B3M Q;  4ZQ3 A;  3P75 A;  1GXD C;  2Z8L A;  5I4T G;  5EBD A;  4KN7 C;  2A74 C;  1SAP A;  4CBV A;  2CWP A;  2KOL A;  5IGB A;  1XJV A;  3T53 B;  2ALY B;  1HUM A;  3GTJ H;  1CKN A;  1JE4 A;  2NUC A;  3CCR P;  1Z47 A;  2G5D A;  3J81 j;  4EQP A;  1MSG A;  2K5W A;  1KDA A;  4DR3 L;  3H47 A;  5E4W C;  1PH3 A;  5J3B A;  1UNK A;  2NZH A;  1TWF B;  2N49 A;  1O7Z A;  3SK6 A;  4WJ4 A;  1YHA A;  5EBC A;  2M8N A;  3D0F A;  1KTK A;  2Q2T A;  4PNY A;  1SEB D;  4Q5V A;  2WB1 B;  1MD2 D;  1HR0 L;  5BN5 A;  3V2T A;  2B2V C;  2MVV A;  1Q7Y Q;  4HKG A;  2NYZ D;  3NE5 B;  2K5H A;  4H13 C;  2N55 A;  2Q2U A;  3C2P A;  1AFP A;  3CCJ A;  2UXC L;  2NN6 G;  1QWY A;  4KK7 A;  4G7Z C;  2Q8I B;  1NSN S;  2UUB Q;  2V1C C;  2JEA I;  3DPH A;  4IOC A;  4DR7 L;  2VLQ A;  3D31 A;  1TY0 A;  3I4L A;  1BBU A;  4DU9 A;  5G3L F;  2VXW A;  3KF6 B;  1TU2 B;  3Q22 A;  1DYQ A;  2JK8 A;  3HYB A;  5EJW A;  2VLO A;  3CQZ H;  3F2D A;  1RO2 A;  4GNX A;  1E2V A;  2PY8 A;  2E8G A;  2Z0S A;  3MXU A;  1GUG A;  3QR8 A;  1H9K A;  3CAM A;  1H9S B;  2AHO B;  1STB A;  1V1Q A;  3VR6 A;  1PH8 A;  2AQ1 B;  2BCO A;  1A0I A;  2RF4 A;  2L22 A;  1O7L A;  2KCN A;  3K5N A;  2H5X A;  1A2U A;  3K5O A;  3LNN A;  2FAD A;  4DNT B;  2EJG C;  2B2W C;  1CTM A;  3K5L A;  2D0P A;  1YBY A;  4UP8 A;  1VQG A;  4POF A;  3X3M A;  4NB3 A;  1IMP A;  4JV5 L;  4IQZ A;  1Q8I A;  3W1B A;  1X6O A;  2QW7 A;  2K94 A;  7CEI A;  3HOV H;  1UE7 A;  3VYU A;  3I4M G;  3G71 A;  4GS3 A;  2PPB C;  3CME P;  3GTJ B;  2CQ8 A;  2R3Z A;  1PA6 A;  3AEV A;  3DTJ A;  3G71 P;  4K14 A;  5M3M B;  4HCS A;  4B3T L;  3BZD B;  4DR5 L;  3GTP H;  5ELC A;  3DMU A;  5F2D A;  4JBK A;  1KHI A;  2N6Y A;  3NUC A;  1EQV A;  1NQ4 A;  1VQ8 A;  4R0M A;  4BBS B;  3B6Y A;  2M00 A;  1TS5 A;  4K0K Q;  4RGO S;  1KAW A;  3TP5 A;  1VQ8 P;  1XMO Q;  1BCP D;  1QG7 A;  1C48 A;  1N36 Q;  1L0X B;  2XSC A;  1IYV A;  4EX5 A;  2KQ3 A;  1VQ4 P;  3NWS A;  4IJH A;  4MNO A;  5DEH A;  5HY6 A;  4BXX G;  4COP A;  2UXB L;  2F1M A;  2FJ2 A;  3U9O A;  3O13 A;  1LUZ A;  3LGJ A;  1HNW Q;  4RGM A;  3S1N H;  3F8T A;  1Y8O B;  4N8F A;  2EG5 A;  2IHE A;  4DR3 Q;  2ROQ A;  3SHL A;  2ZXO A;  3CQZ B;  3B5I A;  1ENF A;  3A8J E;  2RCN A;  3NEM A;  1X65 A;  3TZU A;  5AJ3 L;  3I7F A;  1YI2 A;  1TWH H;  2BA0 A;  1I6V C;  4L5Q A;  4NPS A;  1HQR D;  4A3E H;  4QGU A;  2R93 H;  3P1H A;  3DS1 A;  1PRT C;  1NR4 A;  4P75 A;  1D2B A;  5EAY A;  4IPG A;  4QNB A;  2J4X A;  3HG9 A;  1E1O A;  1XNQ Q;  5FOB B;  2UXC Q;  4XFY A;  4LF5 Q;  1TKW B;  3M7G A;  1IW7 C;  1U9R A;  5I9O A;  4JVZ A;  3K7A B;  1SE4 A;  3CMA A;  1Z9F A;  3CCL A;  4DR7 Q;  2I5L X;  3KFU A;  1SNO A;  2BE5 C;  1HPC A;  4FF3 A;  5AFW A;  1Z6H A;  2AUJ D;  3CCL P;  3EIV A;  4QUF A;  4KHV A;  1FGU A;  4C2M H;  3OW2 A;  1CHP D;  2IWH A;  1LTG D;  4XTC S;  1PZJ D;  3VRL C;  1PTO B;  4OON A;  1BDO A;  2WAQ E;  4KJO A;  1GXG A;  3M1M A;  1U4M A;  2KWL A;  4C56 C;  4X64 Q;  1D1D A;  2H4O A;  1J5E Q;  1VQA A;  1SNQ A;  4CKB A;  3GJN A;  1PH5 A;  4JI1 L;  2Z9H A;  2OWO A;  4OXP A;  2KCM A;  1VQP P;  3AFQ A;  3I2Z A;  4A3M H;  1SJE D;  4IUN A;  4DF7 A;  1LM0 A;  4MHE A;  1QVG A;  1I5F A;  3NBH B;  4J6H A;  4ZKB B;  4FF1 A;  4FYD A;  1AE2 A;  1S5C D;  2LXK A;  4HIK A;  1VQM A;  1JWU D;  3TRE A;  1DV5 A;  2FAC A;  3KLW A;  4JPB W;  4IOA A;  2LF4 A;  3I70 A;  1PTO F;  1PXU A;  2GZE A;  3EN2 A;  1IL8 A;  4MTK A;  3PF4 A;  2EIF A; 
#chains in the Genus database with same CATH homology
 1HZC A;  3E9I A;  3ER0 A;  3JAM i;  3GTO H;  2OTL A;  4WYM A;  1JJC B;  4TVA B;  4DR4 L;  4Y7N H;  3RR5 A;  5M3F G;  1KD1 Q;  1Q46 A;  3PIO A;  2OTJ P;  3BJU A;  3K7U C;  2DGY A;  2UUA Q;  3GTM H;  3I56 A;  1EIF A;  4XRO A;  4UPA A;  3W5O A;  3I56 P;  4NXN L;  3G21 A;  5GAE C;  4U0E A;  4A3I G;  4JI3 L;  2D62 A;  2HHH L;  1TWC H;  4GNX C;  1S72 A;  1GVP A;  4XFZ A;  5C4X G;  3G29 A;  4B3R Q;  4X66 L;  4IFD G;  4JI2 L;  3H15 A;  3RLO A;  4GN5 A;  4LFC Q;  2XTI A;  1Q82 C;  3CCV P;  2ES2 A;  1Q1E A;  1RL2 A;  1D7Q A;  1PH4 A;  3DM3 A;  5AJ3 Q;  2ZTE A;  3T1H Q;  1R9T H;  2JEB I;  1HNZ Q;  4HIO A;  3ULL A;  4DAY B;  1QRJ A;  3HOY G;  1VQD A;  1MJE A;  1GM5 A;  1IBL L;  2C35 B;  1TWG H;  2CCZ A;  2Q2H A;  1RNI A;  3S17 H;  4U0C A;  4LFA L;  3KDF A;  1N32 L;  2A19 A;  1YJ9 A;  5FJ8 G;  5IYD G;  2Z6K A;  5IYC G;  2JA8 H;  2EQS A;  4IPY A;  3PV0 A;  1PH7 A;  4JI1 Q;  4QY7 A;  3F2B A;  3CCM A;  2Z45 A;  3GTK H;  3HKZ E;  3PO3 H;  4AQY Q;  4Y52 H;  4A3D H;  3CCM P;  1A8V A;  1N8R Q;  1HJP A;  1VQH A;  2ZJP A;  4IPC A;  1KQS A;  1NE3 A;  1S40 A;  1PH2 A;  1PH9 A;  2PMZ E;  1W2B O;  4R4Q A;  4LF7 Q;  3TS2 A;  4A3G H;  4A3C H;  1K73 Q;  3JC6 6;  2MO0 A;  4GOP A;  3M3Y H;  3JAM c;  3RN5 A;  5HGL A;  4OO1 G;  1JJG A;  3G6E P;  3PGZ A;  4NXN Q;  3HOU H;  2F4V Q;  4EQ5 A;  2VQE Q;  4U0F A;  1XPU A;  4APV A;  4JI3 Q;  4A3L H;  2UUC Q;  2RHS B;  4DV3 L;  3F2C A;  1K3R A;  3BZK A;  4X66 Q;  4JI2 Q;  1WCM H;  4GN3 B;  1SN8 A;  4A3F H;  3HOZ H;  1HNX Q;  1NJI C;  1I3Q H;  2EIA A;  2NVT H;  5F2O A;  2QA4 P;  1XTD A;  4PG3 A;  4BY1 H;  5IP7 G;  4KLK A;  2JYL A;  1K8A Q;  3CD6 A;  5IWA L;  2ZJR A;  3CD6 P;  3CPW O;  1MIU A;  1TXY A;  1Q81 C;  4P71 A;  4LF8 Q;  2ZJQ A;  1OTC A;  1N32 Q;  1EIA A;  4LNQ A;  3G4S P;  5JJL A;  1Q81 Q;  1CSP A;  2MO1 A;  1VQO A;  1I94 Q;  3KJP A;  1FJG L;  4ME3 A;  5LMN W;  4DV6 Q;  1MJC A;  1VQO P;  1QZG A;  4M0I A;  1E7Z A;  3HOX G;  3PO2 H;  4JOI A;  1W3S A;  2Y0S E;  3FP9 A;  4XRQ A;  1CSQ A;  2YTX A;  5M3M G;  4C3H H;  1PV4 A;  4MTN A;  4OWW B;  4BBS G;  2MQH A;  1H95 A;  5C0X I;  2GVA A;  4DK3 C;  1BBW A;  1EQQ A;  3OTO Q;  3I55 A;  4B3S L;  1YEZ A;  4JBJ A;  4PZ8 A;  4HJ8 A;  5C4J H;  5HGN A;  1K9M Q;  3U4Z A;  2JA7 H;  4GKK L;  3DS4 A;  2R7Z G;  1G6P A;  2JQO A;  5C44 G;  1M74 A;  5M5Y H;  2VS1 A;  1IBK Q;  3CCQ P;  4O2D A;  4BY7 G;  2Z6K C;  2UXD L;  2XV6 A;  2OQK A;  1VQN A;  4A3J H;  2VUM H;  4PMW A;  1VQN P;  4R4I A;  2PQA B;  4P74 A;  2XT1 A;  2PNH A;  1XNR Q;  2B29 A;  4DUY L;  3S14 H;  1B70 B;  1Q7Y C;  4KHZ A;  4DUZ Q;  4JI8 L;  4OWX B;  4QIW E;  4OWT B;  3PUV A;  4GOP C;  2VL6 A;  4DR2 L;  5LMN L;  2ZM6 Q;  3CCJ P;  1Q86 Q;  4GLX A;  1K0R A;  1E1T A;  5C3E H;  5FLM H;  1EYG A;  1VQK A;  2QEX A;  1X54 A;  1I50 H;  3G48 A;  1ZMB A;  3UE1 A;  4DAM A;  4A3E G;  2D0O A;  4DV7 L;  2YYZ A;  4A3K H;  2AKW B;  4O0A A;  1IZ6 A;  3FHW A;  4LF4 L;  4JI6 Q;  1SMX A;  2CQO A;  2PEN A;  3CXC O;  1CKN B;  4DV2 Q;  4QL5 A;  1YIJ A;  2KBN A;  1YIJ P;  1UE5 A;  3CC4 A;  1OXX K;  3M9B A;  3HKS A;  4AYB G;  2MNA A;  2PEO A;  1A43 A;  3HZQ A;  4DV0 Q;  3K81 C;  3M85 A;  3T1Y Q;  2CFM A;  2IHF A;  3PSI A;  2UXD Q;  3Q20 A;  2Z46 A;  4JOI C;  1EQR A;  5H1S E;  2CWO A;  1SFO H;  3TRZ A;  1NMG A;  4GNX B;  2RHQ B;  4PH0 A;  4QJF A;  4XIG S;  2A8V A;  1YI2 P;  1YHQ A;  3S2H H;  1HR0 Q;  2N8N A;  5JPA A;  2WFW A;  1YIT A;  2ZTD A;  2JYG A;  1YVC A;  1YIT P;  1VQJ A;  1G29 1;  2PEJ A;  4IO9 A;  1SLJ A;  2B3G A;  1EOV A;  3CMA P;  4U0A A;  2NVX H;  4UP9 A;  3RZO H;  3RG6 C;  2L15 A;  3RLF A;  1K83 H;  2JE6 I;  2JA5 G;  4OX9 L;  4DV5 L;  3A5Z B;  3AQQ A;  2A1A A;  2ZTC A;  5GAG C;  4GR2 A;  4DK6 C;  4KHP L;  3RN2 A;  4COC A;  4LF4 Q;  4LF6 L;  4RMF A;  1EWI A;  4LF9 L;  3FKI G;  1XPO A;  1Y1W G;  1VQ6 A;  4JV5 Q;  1VQM P;  1B8A A;  4AH6 A;  2R92 G;  1KD1 C;  3GTQ H;  4GLV B;  5F2K A;  2JA8 G;  4UP7 A;  2OTL P;  4B3T Q;  4DR5 Q;  1L1O A;  5LMU L;  4PZ7 A;  3KOJ A;  4A3D G;  1VQI A;  1X3F A;  4X62 L;  1VQ5 A;  3S2D H;  4A75 A;  1VQ5 P;  1M90 Q;  2IY5 B;  2GVB A;  4BBR G;  3ZJY C;  2UXB Q;  1S72 P;  4GR6 A;  3G0V A;  4A3C G;  2ONT A;  5IP9 H;  2ATW A;  3CF5 A;  3M7N A;  2MFI A;  5BS2 A;  2PEK A;  1WI5 A;  1TWA H;  3NEN A;  2NN6 I;  1M1K Q;  4DV4 L;  4JI4 L;  1HZ9 A;  3PF5 A;  1IYJ B;  5ELO A;  3K8A A;  3J81 i;  4LFB L;  5C0X J;  3S1R H;  1S3O A;  3J7A 5;  3OW2 O;  4X65 L;  3HOZ G;  1IBM L;  1YJW A;  1YJ9 P;  1L1O B;  1WJJ A;  2F52 A;  4OX9 Q;  1YJW P;  4DV5 Q;  3I4N G;  3M4O H;  2OAR A;  1P8L A;  1N8R C;  5IYB H;  2VY3 A;  4IJL A;  3HOW G;  5M5X H;  5JEA J;  1VQ7 A;  3WWV A;  1ASY A;  5IY0 A;  4LF9 Q;  3J80 i;  2YU9 H;  1VQ7 P;  4PH1 A;  2JA6 H;  3H0G G;  1CKO A;  2I5M X;  1K73 C;  4JI5 L;  5BR8 L;  2E5L L;  1LTL A;  2YTY A;  1PYS B;  3CW2 C;  4A3B G;  4DR4 Q;  4A3I H;  4JI7 L;  2YV5 A;  4YCU A;  5C4X H;  1I6H H;  2E2H H;  5JJK A;  2GN5 A;  3UE0 A;  3CCU A;  4JC0 A;  4JYA L;  2VQF L;  2WB1 G;  1JB7 A;  2HHH Q;  3KDF B;  4R4C A;  1Q1B A;  4L5T A;  1U0L A;  4BA1 I;  1XMQ L;  1HZA A;  1K8A C;  1J6Q A;  3VDY A;  4AIM A;  1UE6 A;  2HT1 A;  3G1I A;  4HJ5 A;  1VQF A;  1X9N A;  1IBL Q;  1Y1V G;  2KHI A;  1UEB A;  2HIX A;  1AUM A;  2KHJ A;  1KC8 Q;  5FJ8 H;  5IYD H;  4LFA Q;  1JT8 A;  3Q8D A;  1L1O C;  4YWL A;  1KL9 A;  1A63 A;  2NZO A;  1SRO A;  4GOP B;  4J15 A;  2BUO A;  3STB C;  1SR3 A;  3J81 c;  1JMC A;  2PI2 A;  3GD7 A;  1E3P A;  1FVI A;  4DV1 L;  1M6N A;  3S15 H;  4A93 H;  3A5U A;  2OQ0 A;  2UUB L;  4HJA A;  3CCS A;  1O7I A;  2XGT A;  5GAH C;  4JI5 Q;  2XXM A;  3J80 c;  1QVF O;  1K9M C;  3PIP A;  2VNU D;  4JBW A;  4YY3 L;  3I55 P;  1EFW A;  1SRU A;  1NTG A;  3DS2 A;  3E2D A;  4JI7 Q;  5FLM G;  4DR6 L;  1L2F A;  3GDE A;  3GTL H;  3BZC A;  2B63 H;  4JG2 A;  1G51 A;  1OXU A;  3CXC A;  1IXR A;  3H3V H;  5FLX c;  4DV3 Q;  1V43 A;  1NY4 A;  5IP7 H;  5IT9 c;  4IFD I;  4IPH A;  2K52 A;  3KF6 A;  1GKH A;  2BA1 A;  3K0X A;  2L6E A;  4MZ9 A;  1CKM A;  4HID A;  3HOV G;  3UDI A;  4LUV A;  1C0A A;  1N33 L;  1SE8 A;  3G1G A;  2N3S A;  3RLN A;  1FL0 A;  1QVC A;  3A0J A;  5IWA Q;  1XMO L;  3KJO A;  1Y14 B;  4YWK A;  1N36 L;  5GAD C;  1VQC A;  1C7Y A;  2ASB A;  3OYY A;  1HZB A;  2QGQ A;  3CCR A;  1WFQ A;  1HNW L;  3HOX H;  1L0W A;  1Q86 C;  5M3M H;  1FJG Q;  5JJI A;  4BBS H;  3CP0 A;  3I4O A;  2JO0 A;  2FXQ A;  1UE1 A;  4DV1 Q;  1XNQ L;  4LF5 L;  2PEI A;  1VQK P;  2QEX P;  2E2J H;  4IPD A;  2R93 G;  1OXV A;  1BAJ A;  2AWO A;  5HGM A;  1KRS A;  4B3S Q;  4LW1 A;  5E7N A;  4TQU S;  1IUQ A;  4WJ3 M;  3TS0 A;  4YY3 Q;  4C3I H;  4X64 L;  2R7Z H;  5C44 H;  1JJ2 O;  1J5E L;  2K4K A;  2NVQ H;  4DR6 Q;  2K5V A;  4BY7 H;  4GKK Q;  1EOQ A;  4OO1 I;  1EUJ A;  3K7A H;  3CC4 P;  2JJQ A;  3UDG A;  1PFS A;  4A3M G;  3EBE A;  1MKH A;  3CME A;  1YNX A;  1GD7 A;  2VW9 A;  4YWM A;  1PYB A;  3H3V I;  1VCI A;  3PUY A;  2AMC B;  2HQL A;  2UUA L;  2WAQ G;  1Q8K A;  1N33 Q;  3NEL A;  1PH6 A;  2ID0 A;  4DUY Q;  3IRB A;  1PH1 A;  1QUQ A;  2K14 A;  1VQ4 A;  5ELN A;  2IX1 A;  4JI8 Q;  4NXM L;  4B3R L;  4JI0 L;  3BU2 A;  4LFC L;  3RNU A;  1YHQ P;  1NMF A;  4HJ9 A;  3MEF A;  4DR2 Q;  4C3J H;  5LMN Q;  3PUX A;  3M4Q A;  4R1J A;  3KYH C;  3T1H L;  3S1Q H;  1HNZ L;  1BVS A;  2M8L A;  1OXS C;  3GO5 A;  1VQ9 A;  2NVY H;  1RO0 A;  5DCK A;  3H0D A;  1VQ9 P;  5IP9 G;  3PUZ A;  4AYB E;  1AH9 A;  3AFP A;  1DGS A;  2CKZ B;  3NTE A;  3TEH B;  4DV7 Q;  4A4I A;  3MXN B;  3I4M H;  1UWV A;  3A74 A;  4P73 A;  4DR1 L;  1V9P A;  3KF8 B;  1WOC A;  1GO3 E;  1ASZ A;  1VQP A;  3S16 H;  5M5W H;  2UU9 L;  4RG1 A;  1U5K A;  1JE5 A;  3L2P A;  1VQ6 P;  2R6G A;  1QUQ B;  4DKA C;  2IT1 A;  2KCT A;  4AQY L;  2EXD A;  2PEQ A;  1Q12 A;  5C0X G;  5IYB G;  4U0B A;  3PO3 G;  4BXX H;  1W2B A;  1M90 C;  2CWA A;  2WP8 J;  3AYH B;  4LF7 L;  1YHB A;  2E2I H;  4YHH L;  4L5S A;  2OTJ A;  4HIM A;  4LUO A;  1A8O A;  3ICE A;  1RIP A;  2JA6 G;  2LSS A;  3G28 A;  5JEA G;  1X3G A;  1YZ6 A;  1PHJ A;  4A3G G;  2F4V L;  3UDX A;  1X56 A;  3K80 C;  2VQE L;  2AWN A;  5F2N A;  3HKZ G;  4DPG A;  2UUC L;  3J7Z C;  4LUZ A;  1KIX A;  4NXM Q;  4QQB X;  3CCV A;  1K8G A;  1P16 A;  3HOU G;  1M1K C;  4JI0 Q;  2DUD A;  3HFZ B;  1D8L A;  2LXJ A;  4A3L G;  3U50 C;  1HNX L;  1VS0 A;  4GKJ L;  1M6E X;  1Q82 Q;  1IL2 A;  2JA5 H;  2K5N A;  2K50 A;  2PEM A;  3DLL A;  1WCM G;  3DS0 A;  1AE3 A;  2M8P A;  1B7Y B;  4A3F G;  3CPW A;  5HGQ A;  4BY1 G;  1EIY B;  3FKI H;  4LF8 L;  1Y1W H;  4KHP Q;  4GN4 B;  2KOD A;  1E24 A;  1QVG O;  2R92 H;  1N34 L;  3WBH A;  1OXT A;  1I94 L;  4YCW A;  4LF6 Q;  4DR1 Q;  4DV6 L;  1X55 A;  2UU9 Q;  5M3F H;  2IX0 A;  4BA2 I;  3S24 A;  3CCE A;  2KEN A;  4H02 A;  4JBM A;  1VQE A;  3CCE P;  4JCV E;  4IFD J;  2EFJ A;  4R4O A;  3PO2 G;  3MGE A;  1KXL A;  5LMU Q;  1C9O A;  4BBR H;  4A93 G;  1BKB A;  4XFX A;  3TQY A;  3OTO L;  1QVF A;  5GRO A;  4X62 Q;  4YHH Q;  3CCU P;  3G6E A;  3GTG H;  1E22 A;  3HOY H;  1VQL A;  1NBW A;  4YCV A;  3E9H A;  4P72 A;  1VQL P;  1IBK L;  3LRY A;  1WYD A;  4X6A H;  2Y0S G;  3E0E A;  2PI2 E;  1T9H A;  4R4T A;  1CUK A;  1PVO A;  4L5R C;  2JA7 G;  4GLA C;  1A62 A;  2B63 G;  2BH2 A;  1KC8 C;  2QA4 A;  4B3M L;  4JI4 Q;  4DV4 Q;  3SGI A;  4GKJ Q;  2JA9 A;  2YTV A;  2Q2I A;  3I4N H;  5IYC H;  4LFB Q;  1NJI Q;  1XNR L;  4X65 Q;  1IBM Q;  4FDB A;  3G26 A;  1HH2 P;  4A76 A;  3F1Z A;  3HOW H;  3ULJ A;  4DNI A;  4KI0 A;  2Z44 A;  2R7D A;  4A3J G;  2VUM G;  3CC7 A;  1K30 A;  4DUZ L;  1VQB A;  3CC7 P;  3G4S A;  4UY8 C;  1QZH A;  2K75 A;  3RZD H;  2WB1 E;  3H0G H;  5K36 G;  1HR0 W;  4HJ7 A;  1N34 Q;  1KRT A;  2ZM6 L;  3CPF A;  3ULP A;  5DLQ E;  3H4E A;  4A3B H;  3STB D;  1KQS O;  1YJN A;  4LWC A;  3CC2 A;  4POG A;  2HIV A;  3ERS X;  3U4V A;  3CCS P;  1YJN P;  2PQA A;  3CC2 P;  5BR8 Q;  2E5L Q;  1TWF H;  5GQO A;  3L7Z C;  5BS1 A;  3S1M H;  3L0O A;  2R7F A;  1XPR A;  3DS3 A;  5HGO A;  5C3E G;  1E6J P;  2BH8 A;  2F3I A;  2E1M A;  4ALP A;  4JYA Q;  4JI6 L;  1N9W A;  2VQF Q;  2VZA A;  2P9X A;  3M4P A;  1JJ2 A;  4PZ6 A;  4DV2 L;  4U0D A;  2OCE A;  4A3K G;  1XMQ Q;  1LYL A;  1Y1V H;  3UDF A;  3U58 A;  3CCQ A;  5IE8 A;  1X3E A;  2N78 A;  4DV0 L;  3P05 A;  2I5H A;  3PUW A;  3T1Y L;  4K0K L;  3W1G A;  2BHV A;  3PCO B;  3DS5 A;  2I0Q A;  4B3M Q;  5I4T G;  2CWP A;  1XJV A;  2ALY B;  3GTJ H;  1CKN A;  3CCR P;  1Z47 A;  3J81 j;  4DR3 L;  3H47 A;  1PH3 A;  5J3B A;  2NZH A;  2N49 A;  4WJ4 A;  1YHA A;  2M8N A;  3D0F A;  2Q2T A;  1HR0 L;  1Q7Y Q;  2K5H A;  2Q2U A;  3CCJ A;  2UXC L;  2NN6 G;  2UUB Q;  2V1C C;  2JEA I;  3DPH A;  4IOC A;  4DR7 L;  3D31 A;  1BBU A;  3KF6 B;  2JK8 A;  3HYB A;  3CQZ H;  3F2D A;  1RO2 A;  4GNX A;  2PY8 A;  2E8G A;  2Z0S A;  3CAM A;  2AHO B;  1V1Q A;  1PH8 A;  1A0I A;  2RF4 A;  2H5X A;  2D0P A;  1YBY A;  4UP8 A;  1VQG A;  4POF A;  4NB3 A;  4JV5 L;  3W1B A;  1X6O A;  3HOV H;  1UE7 A;  3I4M G;  3G71 A;  4GS3 A;  3CME P;  1PA6 A;  3AEV A;  3DTJ A;  3G71 P;  4B3T L;  4DR5 L;  3GTP H;  4JBK A;  1KHI A;  1VQ8 A;  3B6Y A;  4K0K Q;  1KAW A;  1VQ8 P;  1XMO Q;  1N36 Q;  4EX5 A;  1VQ4 P;  4IJH A;  4MNO A;  5HY6 A;  4BXX G;  4COP A;  2UXB L;  1HNW Q;  1LUZ A;  3LGJ A;  3S1N H;  3F8T A;  2EG5 A;  2IHE A;  4DR3 Q;  3B5I A;  5AJ3 L;  2RCN A;  3NEM A;  1X65 A;  1YI2 A;  3I7F A;  1TWH H;  2BA0 A;  4L5Q A;  4NPS A;  4A3E H;  4QGU A;  2R93 H;  3DS1 A;  4P75 A;  5EAY A;  4IPG A;  4QNB A;  1E1O A;  1XNQ Q;  2UXC Q;  4XFY A;  4LF5 Q;  3CMA A;  1Z9F A;  3CCL A;  4DR7 Q;  2I5L X;  3KFU A;  3CCL P;  3EIV A;  1FGU A;  4C2M H;  3OW2 A;  4XTC S;  3VRL C;  4OON A;  2WAQ E;  3M1M A;  4X64 Q;  1D1D A;  1J5E Q;  1VQA A;  1PH5 A;  4JI1 L;  2OWO A;  4OXP A;  2KCM A;  1VQP P;  3AFQ A;  3I2Z A;  4A3M H;  1LM0 A;  1QVG A;  1I5F A;  3NBH B;  1AE2 A;  2LXK A;  4HIK A;  1VQM A;  3TRE A;  3KLW A;  4IOA A;  2LF4 A;  3EN2 A;  3PF4 A;  2EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...