2DGYA

Solution structure of the eukaryotic initiation factor 1a in mgc11102 protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
111
Chain Sequence
GSSGSSGEHIVPSNQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGC11102 protein
publication title Solution structure of the eukaryotic initiation factor 1A in MGC11102 protein
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 10
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.180 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2dgyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2dgyA01
2OQKA 5GAEC 1KIXA 1YHAA 3H0GG 2PI2A 4X65Q 4BBRH 2UXDQ 2N8NA 2UXCQ 1V9PA 2BH2A 2OTJA 1XMOQ 1PH9A 1ASZA 3HOVH 4AH6A 4BA2I 1X54A 4K0KQ 1HNZL 2ZM6Q 3GTPH 4APVA 2Y0SE 4JG2A 4X66Q 4JI8L 2BA0A 3AYHB 1UE1A 5M3MG 4IOAA 2KHJA 3HFZB 5FLMH 2AWOA 1J6QA 4X62L 4DK6C 3K7UC 3RZDH 1OXVA 4JOIC 4NXML 1N33L 1N32L 3PF5A 4DR1L 3T1HL 3S1RH 2WB1E 1BVSA 1K0RA 4LW1A 3CXCA 1WJJA 1I50H 2LSSA 3K0XA 4A3JH 1IBML 4LFAL 5FJ8H 2JA5G 2AWNA 1O7IA 3GO5A 4L5TA 2F4VL 4DNIA 1EFWA 4PZ6A 4KHZA 4DV4Q 2LXJA 1YHBA 2A1AA 4DPGA 3CAMA 4J15A 3CPWA 4HJ5A 2VY3A 4KLKA 1Q1EA 4POGA 2D62A 2WAQG 2WFWA 4LFCL 1KRSA 1BBUA 3RLNA 4NB3A 4X64L 4A3FG 3PUVA 2YV5A 4A3CG 4IPCA 5EAYA 4LF5L 5C0XJ 3S16H 5C3EG 1I94Q 1HR0Q 3GTKH 2JK8A 3CF5A 1WI5A 3HKZG 3HKSA 4JI0L 2JA6G 4A3MH 3OTOL 2K5HA 5M3FH 4LF4L 5LMNQ 3GTJH 4LUVA 3PUWA 2LXKA 4DV0L 4LF9Q 4YY3Q 2KBNA 2KCMA 4DR5Q 2PQAA 4YWLA 4HJ8A 3PIPA 2BH8A 3TS0A 3WWVA 4B3MQ 4JI2L 4LF8L 2HHHQ 2BA1A 1Z47A 4YHHQ 2NN6I 3UDXA 4JBKA 1Y14B 3BU2A 3DLLA 1TXYA 3ZJYC 4DV3Q 2WP8J 4OONA 2VQFQ 1IYJB 1Q1BA 5IYBH 4L5RC 3M7NA 2JEAI 2VQEQ 1XMOL 2R7ZH 2VUMH 1CSPA 4A4IA 3PO3H 1FJGQ 3L0OA 1SLJA 5JJLA 1JMCA 5BR8L 1A8VA 2K5VA 4JI3L 1QZHA 3I4NG 4LF6Q 4OO1G 4Y52H 3CQZH 1I5FA 3U4VA 2ASBA 1I6HH 2PMZE 1PH2A 4B3TQ 3BZKA 1LTLA 4A3DH 4BY1H 2R93G 1Z9FA 5IYDH 4L5SA 2N78A 3RZOH 4DUYQ 1UEBA 3U4ZA 4HIKA 1X3GA 3J81c 1VQ8A 4UP7A 4A3LH 3GTGH 4C3JH 3CCJA 1Y1VG 1S40A 4BBSH 3I55A 4DV7Q 4JI4Q 1CKNB 4A75A 1EWIA 4DV1Q 4DR4L 3J80c 1E1TA 2E8GA 4IJLA 5C4JH 4JV5L 4EX5A 3CC7A 2Q2TA 2UXBL 1TWHH 1V43A 1U0LA 4BXXH 4MTNA 3GTMH 1NTGA 3S1NH 3AFQA 1VQHA 2B63H 1J5EQ 4DV6Q 1N36L 2CFMA 1BBWA 2ZJRA 1TWFH 3MXNB 3KOJA 1GM5A 4PZ7A 1VQNA 4JC0A 2MQHA 1K83H 1X9NA 1HJPA 1X65A 4RG1A 1E24A 3HOXH 2DGYA 4LUOA 1X56A 4JCVE 4GN4B 2ZJPA 4GLXA 2Q2HA 1NMFA 1PH8A 1OXTA 2WAQE 3RLFA 5IYCH 1L0WA 3W5OA 4IFDJ 1A62A 3HOVG 1N9WA 5C0XG 3F1ZA 1SFOH 2K50A 1NE3A 4A93H 3HKZE 4A3EG 3A74A 4A3GH 3I4OA 1XNRQ 3PCOB 4DR2L 3OYYA 2MFIA 2CWAA 1NJIC 3HOYH 3BZCA 3CMAA 4ALPA 3LGJA 4WJ3M 4XTCS 3JAMc 1KQSA 4IJHA 1Q8KA 1VQJA 3M4PA 3S1MH 1XPRA 4DUZQ 4NXNQ 4YCVA 2JEBI 1QUQB 2UU9Q 4HJAA 1YITA 1VQLA 4LFBL 4DUYL 4A3JG 1JB7A 3E9IA 4DR6L 2KENA 1K73C 1VQ4A 1N34L 2PNHA 1G51A 1R9TH 2D0PA 2K4KA 5H1SE 1K8GA 5IWAL 1X3FA 1HH2P 2HQLA 2A8VA 2ZTCA 1E7ZA 4OWTB 5GROA 2R7FA 2VW9A 2UUAQ 1JE5A 2R92H 5M5WH 3PO2G 5GAGC 1XMQQ 5J3BA 1CUKA 4B3RQ 3I2ZA 4OXPA 1HZBA 1HNXL 4A3BH 4L5QA 3H3VI 4GKKL 3PF4A 1PH6A 1AH9A 2NVQH 4KHPL 5IP7H 5M3FG 4DV5Q 1PH1A 3CC4A 3M4OH 1PH3A 4QY7A 1WCMH 1VQMA 5IT9c 2I5MX 2CCZA 3A0JA 5ELNA 4A3IH 3CD6A 1SMXA 4PG3A 2NVYH 1RIPA 4NPSA 1A0IA 1P16A 3W1GA 5GAHC 4B3SQ 4DR7L 3ERSX 1I3QH 1KHIA 3K8AA 3J7ZC 1K8AC 1XNQQ 3AFPA 3Q8DA 3S15H 4JBJA 2E5LQ 1K3RA 4GS3A 3IRBA 4P73A 1KD1C 3U58A 3PIOA 3ULPA 2RHSB 4EQ5A 4QIWE 5IP9H 3S24A 1UWVA 1YVCA 2UUCQ 3I4MH 4IPDA 1LM0A 3GDEA 4PMWA 4GNXB 5HGQA 2ZTEA 1JJ2A 3HOUG 2YYZA 1CKNA 4R4OA 4R4QA 1IBLQ 4JI5Q 1KXLA 1WYDA 2QEXA 1GO3E 3HOWG 1KL9A 4OX9L 1Y1WG 1XTDA 1E22A 1CSQA 3OW2A 3EN2A 4TQUS 1L1OA 4R1JA 4QGUA 1Q7YC 4BY1G 1PH7A 4OO1I 5IYDG 5C44G 4JI1L 2FXQA 2R7DA 1OTCA 3B6YA 4FDBA 5JJIA 4LF7L 1HNWQ 2Z6KA 5AJ3Q 1JJCB 4JI6Q 4H02A 4X65L 1FGUA 1VQEA 1YZ6A 3D31A 4IFDG 4O0AA 2UXDL 3A5UA 2Q2IA 1DGSA 2IX0A 2UXCL 1PVOA 1Q12A 4BBSG 1A63A 4GLAC 3PV0A 4YCUA 1MJCA 3G48A 3KF6B 3UE0A 4OWWB 1PYBA 1PHJA 1PA6A 3ICEA 4K0KL 2ZM6L 4QJFA 4X66L 1YBYA 1LYLA 5JJKA 4DV5L 2H5XA 2D0OA 1D8LA 1XJVA 2B63G 4C3HH 1M1KC 2OQ0A 2ZJQA 1IBKQ 1Q81C 1YEZA 4DAYB 2JA5H 1L1OC 3GTOH 2NVXH 1QUQA 1XNQL 2B29A 4HIDA 4MNOA 3F8TA 2JJQA 3F2BA 1SR3A 1SRUA 1TWAH 2YTXA 3NEMA 3W1BA 2EXDA 4DV4L 3TRZA 2NZHA 4UPAA 1E3PA 2Z6KC 3CMEA 2L15A 2YU9H 3H3VH 2OTLA 4JYAQ 1QVGA 4A3CH 4BA1I 4X6AH 1JJGA 1OXSC 2CWPA 5C3EH 1VQFA 4UP9A 1W3SA 3D0FA 5C0XI 1I94L 4JBWA 1HR0L 3E9HA 1KAWA 3HOYG 2JE6I 3CCMA 4AQYQ 3RNUA 5C4XH 3AQQA 2ALYB 3GD7A 1IL2A 5LMNL 5M5YH 1EIYB 4WJ4A 1HZ9A 1UE7A 2C35B 3J81i 4GOPB 4LF9L 4YY3L 2EIFA 1Q46A 3CCVA 3U50C 1AE3A 4DR5L 2MO0A 2JA8G 4A3KG 2A19A 3FKIG 2RCNA 4IO9A 1B7YB 3PUXA 4B3ML 4DK3C 4P72A 2HHHL 3J80i 3RN5A 4YHHL 1VQGA 3NBHB 2UUBQ 1P8LA 4DKAC 1V1QA 4BBRG 4DV3L 2VQFL 1M90C 3DM3A 5E7NA 2I0QA 2N49A 2VQEL 4A76A 3L7ZC 1VQ6A 4GN5A 1IXRA 4JI8Q 1FJGL 4GNXA 1CKMA 1OXXK 3CP0A 1KC8C 2AKWB 4GKJQ 4X62Q 3KF8B 3KYHC 1WCMG 5FLMG 4NXMQ 1N32Q 1KRTA 4LUZA 4DR1Q 3T1HQ 4LF6L 3HOZH 1L2FA 3STBD 1VQDA 3KJOA 4A3IG 1QZGA 1HR0W 3CCRA 4B3TL 3PUZA 2ZTDA 3FHWA 5LMNW 2JA7H 2YTVA 5FJ8G 2F4VQ 2XGTA 3KFUA 3KJPA 2GVAA 1MIUA 1HZAA 3S14H 3VDYA 2PI2E 3RLOA 3EIVA 3ULLA 3GTQH 4TVAB 4LFCQ 3UDFA 2E2HH 1SE8A 4RMFA 3ER0A 3JAMi 4DV7L 3CCLA 4JI4L 4LF5Q 4QQBX 4DV1L 2I5LX 3L2PA 4POFA 3KF6A 4JI0Q 3OTOQ 4AQYL 4LF4Q 3MEFA 4P71A 3KLWA 4A3MG 3PUYA 4GLVB 1VQIA 3M3YH 3K81C 5GQOA 2R6GA 1J5EL 4DV6L 4C2MH 3TS2A 4BY7H 4JI2Q 4LF8Q 2KHIA 2K5NA 3ULJA 1VQKA 2N3SA 1UE6A 2UUBL 4UY8C 3JC66 2IY5B 3PGZA 2DUDA 1GKHA 1EUJA 1LUZA 1OXUA 1VQBA 4HIOA 1PH4A 4OWXB 1YHQA 4JI7Q 1GD7A 4Y7NH 5IYBG 4DV2Q 1EQRA 2R7ZG 4IFDI 2VUMG 2V1CC 2CQOA 3UE1A 4A3EH 2MNAA 1YNXA 3PO3G 1NMGA 1XNRL 3TEHB 1SROA 5BR8Q 3G71A 4GKJL 1BKBA 4GN3B 1W2BA 4JI3Q 5K36G 3FP9A 3CC2A 2QGQA 5GADC 2AHOB 4O2DA 1VQ7A 4NXNL 4DUZL 1FL0A 4A3DG 1YJWA 2JA9A 2UU9L 1PFSA 3NELA 1X6OA 4GOPA 3T1YQ 2KCTA 1EIFA 2JQOA 1SN8A 3KDFB 3H0GH 1G291 2B3GA 3CCUA 4YWMA 3UDGA 1YIJA 4C3IH 3H15A 4A3LG 1B70B 1G6PA 2IT1A 4DR4Q 2UUAL 1B8AA 3PO2H 4DR3Q 4IPGA 1YJ9A 3S2DH 1XMQL 4B3RL 1MJEA 4JV5Q 3GTLH 1RL2A 2GVBA 4AYBE 2UXBQ 5M3MH 5C4XG 1VQCA 4R4IA 3S2HH 2IHEA 4BXXG 5IY0A 5JEAJ 3J7A5 1N36Q 4ME3A 4XIGS 4YCWA 2QA4A 3CW2C 5LMUQ 2MO1A 1EOVA 4B3SL 1K9MC 3M9BA 1WOCA 4R4TA 3HOWH 1WFQA 1FVIA 1X3EA 3BJUA 3E0EA 4GOPC 2RHQB 3HOXG 1Q86C 4JBMA 2E5LL 4JI7L 1XPUA 2XTIA 4DV2L 3EBEA 1EQQA 5IYCG 3SGIA 5M5XH 2HIVA 4DAMA 3G4SA 2UUCL 3HOUH 4A3FH 4A93G 2OWOA 4A3GG 3K7AH 3M4QA 2VZAA 4JI5L 4DR2Q 1Q82C 2Y0SG 1IBLL 2I5HA 1UE5A 1TWCH 2IHFA 3RR5A 1Y1WH 2JA6H 1H95A 1VS0A 4R4CA 1C7YA 4AIMA 1HZCA 3HOZG 5FLXc 4LNQA 1MKHA 2VNUD 5C44H 2IX1A 2WB1G 4LFBQ 2NN6G 2RF4A 1IZ6A 4UP8A 3T1YL 1YJNA 5DLQE 2JA7G 1XPOA 4DR6Q 2F52A 1N34Q 4KI0A 3CPFA 3RN2A 1VQPA 1X55A 2Q2UA 2YTYA 2ES2A 1HNWL 5AJ3L 1VQ5A 2E2IH 2NVTH 3S17H 4JI6L 1D7QA 2ID0A 2K52A 5IWAQ 4P74A 1NY4A 3TQYA 4HJ7A 1VQ9A 1S72A 1VQAA 1QVFA 3F2DA 2R92G 1NBWA 2NZOA 2VL6A 4DR3L 1PV4A 1PH5A 1AE2A 1CKOA 1HNXQ 1E1OA 1HNZQ 3M85A 4GKKQ 1C9OA 4A3BG 1TWGH 4IPHA 4KHPQ 2ATWA 2AMCB 3G6EA 1L1OB 3K80C 5IP7G 2GN5A 3STBC 4AYBG 3PSIA 3J81j 3F2CA 4HIMA 3I4NH 1N33Q 3CCSA 2PQAB 2HT1A 4DR7Q 1T9HA 2K75A 2HIXA 4HJ9A 5LMUL 3UDIA 4BY7G 2R93H 1GVPA 1IBKL 4PZ8A 1ASYA 1IBMQ 4LFAQ 2EQSA 3CCQA 1PYSB 4YWKA 1VCIA 3KDFA 1Y1VH 2K14A 4LWCA 1C0AA 4JYAL 5IP9G 2VS1A 4QL5A 3TREA 4X64Q 3I4MG 2OCEA 3AEVA 1JT8A 5IE8A 1YI2A 1N8RC 4JOIA 1EYGA 4OX9Q 4IOCA 1S3OA 3A5ZB 5JEAG 2Z0SA 2CKZB 3I7FA 4GNXC 2F3IA 3NENA 4DV0Q 2E2JH 5ELOA 4MZ9A 3CCEA 3S1QH 1U5KA 4JI1Q 1VQOA 2JA8H 3I56A 3FKIH 4P75A 5HY6A 4A3KH 1QVCA 4LF7Q
chains in the Genus database with same CATH superfamily
3I4LA 2HDLA 2ZT9C 2UXDQ 2F0QA 1LT6D 1H9SA 1NUCA 1V9PA 2OTJA 1M74A 3GTPH 3BVMA 4JG2A 4X66Q 3JAME 3AYHB 1EYDA 2KG9A 3HFZB 4KD4A 4CHTB 3VRLC 3H4EA 4DK6C 2PZTA 1AZQA 4DR1L 3S1RH 3CXCA 4A3JH 4LFAL 1GUWA 3NWSA 2Q8IB 2F4VL 2F0JA 2A74C 2JSOA 1YIJP 2LXJA 2B2UC 4CBVA 4J15A 4J6HA 2MHVA 2VY3A 4KLKA 5IGGA 1KRSA 3RLNA 4A3FG 3S16H 1YJ9P 3J7AF 4KV6A 1HR0Q 3CF5A 5EKIA 4A3MH 2K5HA 1KNAA 4HEDA 4G4KA 5LMNQ 4H2XC 3GTJH 2F3VA 2EG5A 3KF8A 2TMPA 4Q5VA 2KCMA 2PQAA 4UAIA 4HJ8A 3VA5A 3TS0A 4LF8L 2K2QA 4C56C 2F0SA 4XRQA 3ZJYC 5CGKA 5DEHA 1A6XA 4KKSA 1FNVA 4L5RC 2A68D 2SNSA 3PO3H 3G4SP 3GTMB 3EROA 2N98A 1JMCA 1TWFB 2K5VA 3I4NG 1BF4A 4LF6Q 4OO1G 3RD4A 3U4VA 2ASBA 1BO0A 3BZKA 3BVZA 4K8IA 4A3DH 1Z9FA 2N78A 4KKTA 1F9RA 1EU4A 1GUTA 4UP7A 4C3JH 2D5DA 3CCJA 1S40A 2Y0SB 3UI2A 1QNUA 4KK7A 3I55A 4DV7Q 1GJXA 1CKNB 2HQEA 1EWIA 4DR4L 3J80c 1T5XD 1V1PB 2FQ0A 5CORA 4MN3A 2FINB 2UXBL 4U0BA 4MTNA 4DU9A 1Q7YQ 1E2VA 2Q8TA 5D3DA 3S14B 1EY6A 2CFMA 1B50A 2KW2A 2MQHA 1K83H 1PFMA 2PYKA 3SDZA 1KQSO 3W2DA 4PWVB 4A3BB 4GN4B 2LKVA 4OIJA 3RLFA 1PH8A 1L0WA 1A62A 3HOVG 2QEJC 1SFOH 4IUQA 2A69D 4A3EG 3PCOB 3CCLP 5C6AA 4DR2L 1IMPA 1NJIC 3HOYH 3BZCA 3LGJA 1UJZA 1EY7A 4RGOS 1KLPA 4DUZQ 2LS01 2DY8A 2JU2A 1CQFA 1M4VA 2F0TA 2NWGA 1FR3A 3J81L 3E9IA 3K57A 3VYSA 1Q86Q 2KENA 4DR6L 2E74C 3I4MB 2F0OA 5H1SE 4C3IG 2FQ1A 3V2TA 2UUAQ 4PH1A 2K1BA 2VW9A 3R2IA 2OTJP 5M5WH 4B3RQ 5J3BA 2E76C 4L5QA 3PF4A 3GZMA 1IW7C 1SNCA 2PMZB 5CZDB 4KHPL 5M3FG 1X3QA 1PH1A 3M4OH 1PH3A 4QY7A 1WCMH 3U43A 3H0GB 2CCZA 1Y8PB 4CDCC 1LV9A 4NPSA 3W1GA 3ERSX 1I3QH 1KHIA 2JO0A 3J7ZC 1K8AC 3S15H 3OOCA 3OW2O 4K6LA 1NQ4A 2XIWA 2Z9HA 1VQLA 4P73A 3IRBA 2KEEA 1KD1C 2IW3A 5IP9H 3S24A 1UWVA 1PTOB 1XYIA 4G7HC 1ESFA 5HGQA 3HOUG 1HFNA 2YYZA 4R4QA 2F0GA 2VB3X 2JBGA 1WYDA 2QEXA 3JAML 4QUFA 5IGFA 2XT1A 4OEMB 1EY5A 2KWLA 1HXYD 3GV3A 3GTOB 1EL0A 3NBIA 2H4OA 3DS3A 4R1JA 4QGUA 3T16A 2FXQA 3B6YA 4FDBA 2BCOA 2WAQB 2K0XA 5I9PA 2Z6KA 5AJ3Q 4H02A 1FGUA 2K32A 1CEIA 2N6YA 2Q2IA 1RHPA 2PO4A 3HKZB 3LWUA 3A5UA 1PVOA 1A63A 2EZVA 1I4GA 1CQVA 3UE0A 1EIGA 2I46A 3ICEA 3KLSX 2ZM6L 5C44B 2MUYA 1LYLA 5JJKA 3GP7A 1Y8NB 2D0OA 1QVGO 5JAVA 1D8LA 1XJVA 1STBA 3MHBA 3OIPA 4C3HH 3S17B 1A2UA 2DNEA 4HSPA 1IBKQ 1L1OC 2NVXH 1EQTA 3BYTB 1EY4A 3HS0C 1SR3A 2FVFA 3MEHA 3OMGA 4K5WA 1B53A 3W1BA 2NZHA 3CCJP 1VQ5P 1E2WA 2YU9H 3H3VH 3I55P 4BA1I 4EGVA 1VQFA 1B4OA 2QW7A 5LL6X 1DONA 3DEPA 4DG9A 3E9HA 2R93B 2JE6I 2K0DX 1S5CD 4AQYQ 2F0NA 1ESRA 2CQ8A 1AP0A 1LT3D 1UE7A 2L4BA 4YY3L 1Q46A 4DK0A 5EBCA 2FQ2A 2JA8G 2A19A 3FKIG 4DK3C 4P72A 2HHHL 3J80i 3RN5A 1V8QA 5M9OA 1V1QA 5D14A 2FAEA 2VQFL 3CCQP 3DM3A 1M90C 3A8IE 1TIID 1KNEA 5ELCA 2AUJD 4GNXA 1CKMA 2Z46A 4GKJQ 5FLXE 4X62Q 3KF8B 3RMHA 4OO1H 1HR0W 2PEJA 1I4XA 3PMFA 4B3TL 2I07B 1TQOA 3PUZA 2B2VA 2JQ4A 3FHWA 5LMNW 4WRDA 5FJ8G 1SYFA 3URYA 3V05A 4DXGA 3KFUA 2XRQD 4H44C 2OF1A 1E0HA 3IAYA 3VDYA 2EIAA 2RBMA 1D5XC 1AFPA 4TVAB 5ELEA 4O1NA 3UDFA 2KOSA 1SE8A 4JI4L 5T1GA 4FVMA 3S1RB 4CKBA 2LIWA 1EYAA 3OTOQ 4AQYL 3DWQA 5KNBA 2KOOA 1PTOC 4P71A 3KLWA 1G2SA 1RO0A 4A3JB 2GDWA 1RTOA 3M3YH 2F4IA 3K81C 3EJIA 2F0HA 1J5EL 1UUPA 3IFDA 1VQKA 3PO2B 3AB9A 3S16B 1HFGA 1PH4A 1OXUA 4RFBA 1EIAA 1X3OA 5C3WA 1GD7A 4Y7NH 3QOLA 1F9PA 4QB4A 2R7ZG 3UE1A 4A3EH 1YNXA 2VLNA 4JW0A 3C46A 1IW7D 3G71A 4GKJL 4GN3B 2QEXP 1T5EA 4JI3Q 5K36G 2ONTA 5JPNC 3CC2A 4O2DA 4NXNL 1FL0A 2JA9A 1PFSA 4GOPA 3NWTA 4X3UA 3QJYA 4BWGB 5M5XB 2JQOA 3GV6A 3KDFB 3I72A 3CCUA 2EE1A 5CYUA 1CFMA 4C3IH 3H15A 4KY6A 1G6PA 1AYIA 1SJED 3R3OA 2IT1A 2SDFA 3BDOA 3T4AC 2HDMA 1ZXTA 4U673 3MGEA 1XMQL 3NTIA 1AZPA 3GTLH 3OPOA 1GOZA 4GR6A 2RSOA 5C4XG 3FPUB 5I6WA 1CHQD 1IHZA 2N88A 4CDFC 4XROA 2NVTB 3CW2C 2MO1A 2F0LA 2R61A 1WOCA 3FVQA 1C48A 4I7AA 3K5LA 1TR5A 2E75C 2EYJA 1Q86C 2KVMA 4XYOA 3O13A 4TRDA 1CA6A 4CA3A 1BOSA 3T51B 1PFNA 3HOUH 1B44D 5CV6A 2VZAA 1UE5A 1DNYA 2JA6H 1H95A 3FRPB 3QOJA 1QVFO 1K83B 3CC7P 3HOZG 4AIMA 3HP3A 5JVG3 4LNQA 3ZYYX 1MKHA 3CRKC 2NN6G 5FKAC 1IZ6A 3EQLC 3R2TA 2NO8A 2JA7G 4G7ZC 1VQPA 1D1KA 1X55A 2EYMA 2YTYA 1D7QA 5HV8A 1JE4A 1SYGA 4R9WA 1S72A 1VQAA 2Z4HA 3HOYB 2VL6A 1M6NA 5F2KA 4LMQD 5ISRA 5JVH3 1AE2A 4HMIA 2VLQA 1HNZQ 1LT5D 4IPHA 2A73B 4X3SA 3CE7A 3J7YW 3G6EA 2F0KA 4A3KB 5IP7G 2GN5A 4AYBG 1F2MA 1D1DA 1X3PA 1SNPA 2EYLA 4IN3A 2EFJA 4DR7Q 1T9HA 2K75A 1HUNA 5E4WC 3UDIA 4IQZA 1SE4A 1IBMQ 3MFYA 1RCVD 3KLSA 2K14A 4XT1B 3LNNA 2CH4A 3M4OB 4JYAL 1WCMB 4QL5A 4X64Q 4XXEA 2AVAA 4QF4A 3AEVA 4EVOA 1R4QB 4RWSC 1EYGA 2N6ZA 2CKZB 3S15B 1F2YA 4JI1Q 1B9MA 2AQ1B 2JA8H 3FKIH 5HY6A 1QVCA 3VR3A 1KAAA 1PRTB 1GUNA 2J4XA 5GAEC 1YHAA 2OXPA 1W6KA 4F88A 2A6ED 1VQKP 1EWCA 3GTKB 4H2YC 1ASZA 1LLRD 4AH6A 1X54A 2EJFC 1RD9D 1HNZL 4APVA 2Y0SE 1EU3A 4IOAA 5M3MG 3CPWO 3RUZA 2FJ2A 2AWOA 3VR4A 1B2TA 1PTOD 3RZDH 1OXVA 1D1IA 4JOIC 4NXML 1JB3A 3T1HL 1G8ZD 5D3IB 1K0RA 2M8PA 1BCPF 3K0XA 5COYA 2MGSA 1IBML 1ZNVA 5FJ8H 2JA5G 2AWNA 3A7AB 1O7IA 2VUMB 4PZ6A 3CCUP 4KHZA 1PXUA 1IKLA 1YHBA 4DPGA 2X6GA 4HJ5A 3EVQA 2WFWA 4X64L 1BBUA 4C3HB 4C1NI 5C3EG 3P20A 1PZID 1I6HB 2JK8A 1G91A 1JWSD 1M8AA 3HKSA 4JI0L 2EHSA 5IT9E 2BE5D 1BQQT 1MBYA 2EDGA 3FMCA 2XNAC 2VLPA 3G1IA 1CTMA 3KBGA 1H9MA 2KBNA 4DR5Q 3ND9A 4YWLA 2MVUA 2E2DC 4B3MQ 3TP7A 4YHHQ 1Z47A 3UDXA 1Y14B 2JGPA 3BU2A 4PXHB 3DLLA 1TXYA 4QUCA 4DV3Q 2WP8J 4OONA 5C4JB 5CR3A 1BCPC 1TWHB 2R7ZH 3G1GA 1K28A 3MZ5A 1SLJA 2KOLA 5K36H 1LTGD 2H1EA 1A8VA 5BN4A 4OHJA 1I5FA 4FF4A 3R93A 1IYUA 1BR9A 2PMZE 3HOXB 4BY1H 5IYDH 4L5SA 4ILWA 2XRSD 4DUYQ 1K8AQ 5AFWA 1LTID 1CK1A 4FXDA 1SNQA 4A93B 1VQPP 1RDPD 3GTGH 1KTKA 1SJHD 1Y1VG 5EQ0A 5JJZA 4FF2A 4A3GB 1Q3LA 4IZ8A 1S72P 5KP8B 4KY5A 4DV1Q 3H6MA 2E8GA 4IJLA 2XWJB 4JV5L 4EX5A 2Q2TA 2WB1B 1B9NA 4KJOA 2PZUA 3G6EP 2EY5A 1JOKA 4O42A 2A5HA 1N36L 1BBWA 2KGDA 2LKIA 4M0IA 1TY2A 4N9TA 1X9NA 1HJPA 1XWEA 4IUNA 4U0CA 4GLXA 2Q2HA 1OXTA 2WAQE 1VKUA 3W5OA 2NVQB 1PRTC 1N9WA 5C0XG 4ZK9B 2K50A 3M3YB 2KCNA 3HKZE 3TDQA 3I4OA 3SHLA 1HQRD 3OYYA 2Z45A 2CWAA 4ALPA 2QKIC 4WJ3M 4IJHA 1JC7A 1Q8KA 3M4PA 5HGTA 3S1MH 1XPRA 4TKOB 1VF7A 1PYWD 1EZ6A 2NN6H 1QUQB 2JEBI 3Q24A 4HJAA 2UU9Q 1K3BC 4Y7NB 1PDQA 4DUYL 2LMCB 3N52A 1G51A 3SK8A 1SYDA 2FHTA 2JP1A 5IWAL 1GPJA 2HQLA 5GROA 3SE0A 4WORA 1ET9A 1JE5A 2N55A 1YHQP 4RCNA 2NZ1D 1HNXL 3H3VI 4J1MA 1PH6A 1HRJA 5IP7H 1PLFA 1F77A 1LABA 4ABNA 5DAUA 3EJBA 1JJ2O 3A0JA 5ELNA 3CD6A 2ENBA 4PG3A 1RIPA 4B3SQ 1P16A 1VQ7P 4DF7A 3T53B 3AFPA 2KOPA 3CRLC 3Q8DA 2E5LQ 5D65A 3GTLB 1M90Q 3ULPA 2RHSB 2R3ZA 2UUCQ 5DM73 4IPDA 1YNJC 2ZTEA 1IBLQ 1KXLA 4QNBA 1O7LA 3SR1A 4L63B 1UNKA 1Y1WG 1FR2A 1XTDA 1E22A 2K5DA 2BOSA 2SOBA 5G3LF 1TWAB 4OO1I 2LFNA 2QNWA 4DAPA 1HNWQ 1BBXC 4JI6Q 4FXGC 1DV5A 2UXDL 4R0MA 4O0AA 4IFDG 4RHRA 1DGSA 3X3MA 2JA6B 4BBSG 4YCUA 3MXPA 4ZCKA 5C3XA 1MJCA 3G48A 3KF6B 4QJFA 4X66L 1YBYA 4BPHA 2X69A 1NNXA 2L1BA 5IOCA 2H5XA 1II3A 2PEOA 2B63G 2OQ0A 1LTSD 4HAEA 5IODA 4N9PA 2K0YA 3I73A 4DAYB 1HQMC 2JA5H 2B8GA 3QWNA 5JPAA 4MNOA 1TS2A 1SRUA 3TRZA 4UPAA 2MF4A 1BCPD 1VQ9P 3PQIA 1OXSC 5F2NA 1L0IA 5C3EH 4IUVA 1KABA 3D0FA 5IGCA 4JBWA 1HR0L 3CCMA 5CV7A 2XZ0D 2ALYB 3ND8A 1IL2A 1EY0A 3P05A 5M5YH 5LMNL 1EIYB 1HZ9A 5EW5E 2O5IC 5A2QL 2MO0A 1YNNC 2RCNA 3NUCA 4IO9A 1B7YB 3H0DA 2GZGA 4DNRB 2Z44A 3Q22A 1G6ZA 3DXJC 2I0QA 2N49A 2JYOA 1VQ6A 4XFZA 4FYDA 2B8FA 2FMMA 4JI8Q 2TSSA 1OXXK 3CP0A 1KC8C 1O80A 3FKIB 1F9SA 2KODA 1YI2P 1UAPA 4OL7A 5FLMG 3E0JA 1N32Q 4LUZA 4LF6L 2HUGA 3TSSA 4A3IG 1QZGA 3VA7A 4IUUA 5HGNA 4B08A 4M8AA 2AFDA 1JICA 2HCIA 2GVAA 1MIUA 3PIP3 4HMJA 2PI2E 3GTQH 3RG6C 2PEIA 4LFCQ 2E2HH 4DV7L 1A3VA 1BAJA 4LF5Q 3L2PA 2QDLA 4K5XA 4LF4Q 2CGQA 4C2MH 3CD6P 4BY7H 4JI2Q 1SMYC 3ULJA 2N3SA 1UE6A 4NW2A 2RDFA 4XQNA 3PGZA 2DUDA 1GKHA 1LUZA 4IURA 4PV1C 4OWXB 4JI7Q 1GUOA 5C0XH 3NPPA 2CQOA 3FPPA 1NMGA 1S4ZA 2NTSA 1SROA 5BR8Q 3TZUA 5HGLA 1BKBA 1W2BA 3SK4A 4DK1A 2A6HC 2J0TD 3NTKA 1EEID 3FDTA 5JEAH 1CM9A 1EFID 3HG9A 2QF7A 4DUZL 3F2UA 1E6JP 4K5VA 2CNRA 2K7VA 1VF5C 1X6OA 3T1YQ 3HZXA 4RKLA 3MXNA 2MJ8A 3UDGA 4HN7A 1CA5A 1B3QA 2F3WA 1L0XB 4A3LG 1B70B 3NBHA 5BS2A 2UUAL 1B8AA 3K6OA 4IPGA 3S2DH 4B3RL 3DWAA 1RL2A 4BY1B 2GVBA 1Z7TA 2F0MA 1VQCA 2P5ZX 3A55A 4R4IA 3S2HH 4CJ1B 2SNMA 4KTAA 5JEAJ 3V96A 1WTPA 1IUQA 2BDNA 3G0VA 1U4RA 3GTGB 4NKLA 2QA4A 3ERQA 1EOVA 1K73Q 2GDXA 4HSVA 1WFQA 2PPBC 1X3EA 1BXTA 2RHQB 1H9SB 2EOTA 4JI7L 1XPUA 1EQQA 1TVXA 5J1ZA 4DAMA 3I90A 4X3KA 1I4PA 2ICIA 2NB0A 5L37A 4A3FH 3DWPA 3K7AH 3SXHA 2Y0SG 2IHFA 1TWCH 3RR5A 1Y1WH 3DEOA 1JWUD 2K03A 4NP5A 3CCMP 4R4CA 1EYCA 2KGAA 3VYRA 3C2PA 1A43A 4Q0FA 4CJ2C 2VNUD 2IX1A 2L5TA 5E4XA 4LFBQ 1H9KA 3NTHA 3T1YL 5DLQE 3D6CA 1XPOA 2F52A 1N34Q 2IY5B 4RGNA 5AJ3L 5E1FA 2K6AA 4IFDH 3KBXA 2EY1A 3TQYA 5G3LD 2LTEA 1PTOF 1FGBD 3SK5A 2R92G 1NBWA 4PH0A 3PIO3 1CKOA 4R8IA 1FNUA 3S1MB 4GKKQ 1VQ6P 4V0BA 4A3BG 3CKIB 2RSNA 1JR0D 1S5DD 4DGZA 2AMCB 3I4NH 3D4DA 3STBC 1GUSA 3J81j 1N33Q 3CCSA 2PQAB 4ZQ3A 2HT1A 2IPKD 1S5BD 4HJ9A 1IBKL 1ASYA 1ZMBA 2L9FA 3K5NA 4ME5A 1EQVA 5CC4A 4YWKA 3GTPB 1VCIA 3U9OA 3J80E 4AYBB 2AF8A 4K14A 3TREA 5CV4A 3I4MG 4OX9Q 1JOOA 1F80D 3NHHA 2B2WC 2DN8A 4U0DA 1M1KQ 3I7FA 4R8NA 2F3IA 1MI2A 2JAZA 3CCEA 2E2JH 1U5KA 1VQOA 2L6EA 1HUMA 3BDLA 3I56A 4KHVA 1CZWA 2ZXRA 4LF7Q 2OQKA 4NEOA 4OGQC 2B2UA 3H0GG 3WOFA 2IL8A 4X65Q 3C1EA 2EY2A 4B9XA 4IZ6A 2N8NA 2UXCQ 2VLOA 1DOKA 3I8ZA 3CXCO 1VQLP 3DS1A 1IL8A 4A3MB 3HOVH 4BA2I 4K0KQ 2CW0C 3GTJB 5FO9B 1DZ1A 2BA0A 1QRJA 5FLMH 2K01A 1J6QA 4X62L 2MR7A 4F37A 2VB2X 3EA6A 1SBBB 4PMCA 1N33L 3TP5A 2WB1E 3TBIB 4LW1A 2FVEA 4OIKA 1WJJA 1I50H 2LSSA 3GO5A 4RHSA 1HTPA 4L5TA 1J8IA 4DNIA 2KJXA 1EFWA 4DV4Q 1ICWA 3PO3B 2F0WA 3KUPA 3S9WA 3CAMA 3M4YA 4B9WA 4POGA 2D62A 2WAQG 2L4NA 5KP7B 4A3CG 4IPCA 7CEIA 1I94Q 1C8CA 1PZKD 2WPTA 3HKZG 5E3FA 4A3DB 3EJDA 3OTOL 5M3FH 1JQYD 1TKWB 2ZXOA 1MGSA 1K8OA 2LXKA 2CQAA 3M7GA 3OWEB 2KUMA 4LF9Q 2SEBD 4C3JB 2QA4P 1Q8IA 3A7LA 1CT1D 2N5IA 3B4QA 1ET6A 2BA1A 2NN6I 4HTHA 5C3EB 4BPFA 2M8NA 2KECA 5KIXA 1NR4A 2PEKA 1QCBD 3M7NA 2JEAI 4ZUIA 2VQEQ 4FXKC 1CSPA 3IKJA 4A4IA 1WTQA 5M5YB 1FJGQ 1GXDC 3L0OA 1JOQA 1MZ8A 3VR5A 1QWYA 5CMDA 3DTJA 4JI3L 2ZXPA 1ZKOA 4Y52H 1SAPA 5TSSA 1PH2A 1LTLA 3RG2A 1K8MA 2R93G 2NTTA 2L9HA 3U4ZA 2QDBA 1O7YA 3J81c 2FHSC 1SFOB 1VQ8A 4A3LH 2RKSA 3CU7A 4A75A 3SVMA 1E1TA 2DJGC 5I2XA 2JXMB 3OHXC 1V43A 4RCOA 3I91A 3TZDA 1NTGA 3GTMH 3AFQA 1VQHA 3BS1A 4DV6Q 1TWFH 3MXNB 3GTQB 1A3TA 4PZ7A 4JC0A 4H2WC 2E2HB 5KNDA 1ZYRC 4RG1A 5M5WB 4LUOA 2ZJPA 5KRUA 1NMFA 3WBHA 1RODA 1ILQA 2F0PA 1D6EC 4ULLA 2NYZD 4KY7A 3TMEA 2EJMA 3A74A 5HURA 1XNRQ 2K94A 2MFIA 4IUTA 2EY6A 4BY7B 3CMAA 1H9JA 2NUCA 5FLXL 3JAMc 1I3QB 1KQSA 3NSWA 1EY8A 2M2LA 4WFN3 5F2OA 4YCVA 1K9MQ 3CCEP 3BZDB 1VQOP 4A3JG 1JB7A 4DNTB 1K73C 1VQ4A 2PNHA 1R9TH 4Z9CB 2K4KA 2VXWA 1HH2P 2ZTCA 1E7ZA 2R92H 1HY8A 2R7FA 5EJDA 3PO2G 1CUKA 2GZJA 4OXPA 4A3BH 1NSNS 1AH9A 5HGOA 1K0SA 2F0UA 4RH6A 4DV5Q 3CC4A 3G71P 1VQMA 2I5MX 3CC2P 1AUMA 1SMXA 4DR7L 1A0IA 5GAHC 2K93A 4JK1C 2O2LD 1LTAD 3K8AA 2F0EA 3DS2A 1XNQQ 3M1MA 4JBJA 4GS3A 3U58A 1F2ZA 2RA4A 1YVCA 3S2HB 3I4MH 4PMWA 5JJIA 4GNXB 4R4OA 1CKNA 1DJRD 4JI5Q 1KC8Q 1V1PA 1GO3E 3HOWG 1KL9A 1HHVA 3OW2A 2NVXB 5C5MA 4F7XA 4TQUS 4CDEC 2XXMA 1L1OA 1PH7A 2PY8A 1FNWA 4JI1L 3ONAB 2R7DA 1OTCA 1WD0A 2YU9B 1TS3A 4A3FB 1ENCA 2LL8A 4WYMA 1VQEA 1LO5D 1TWCB 1Q12A 2M9VA 4GLAC 4J8QA 3PV0A 5CBAE 2J7ZA 4K6DA 2KGCA 1N8RQ 5KEEA 4BS9A 1TT2A 4OWWB 2JYGA 1L0HA 1CHPD 3K5OA 1Z6MA 1PTOH 4DV5L 2EYPA 4LK1C 5A35A 1U9RA 1M1KC 3LRYA 4ZAIA 3VYTA 1VMPA 2ZJQA 2K5WA 1I4HA 2V4DA 5JOBA 1YEZA 1ENFA 3OIQA 3HZQA 1PRTF 3GTOH 3WOEA 1XNQL 1A2TA 2B29A 2JJQA 2YTXA 4XQQA 3DHQA 3GZLA 2EXDA 1VQ8P 1EWHA 2Z6KC 2L15A 1DOLA 1NAPA 3I4NB 1QVGA 4A3CH 4X6AH 1JJGA 1BNZA 5EPKA 4UP9A 3K58A 5C0XI 3MWYW 5J39A 3HOYG 5I9OA 3RNUA 2Z1CA 5C4XH 3AQQA 4NMZA 3WDNA 3GD7A 3QR8A 1A3UA 4H0LC 3D8GA 2C35B 3J81i 2KQ3A 4GOPB 3U50C 1AE3A 3MTSA 4DR5L 1EMVA 3QIAA 4A3KG 4B3ML 4QIWB 4HCEA 4MRTC 4YHHL 2RDGA 4BBRG 4DV3L 1SYCA 5E7NA 3NXWA 4A76A 5CBEE 2IWHA 4GN5A 2PW7A 1IXRA 2E2JB 5C4HA 2RDHA 1AW7A 2XSCA 3DPHA 3KYHC 4PMBA 1WCMG 5J22A 3CMAP 1KRTA 2IX3A 2MY5A 4DR1Q 3HOZH 1L2FA 1GXGA 3KJOA 3CCRA 3NK9A 2PEQA 3GKLC 2ZTDA 4HCSA 2JA7H 3HOVB 2F4VQ 3NQIA 1ZYRD 2K5QA 2DNCA 4A3EB 2MPMA 3LWEA 2M8LA 4RMFA 3JAMi 2C5CA 4QQBX 3CCLA 1EEFD 4DV1L 2I5LX 2EPBA 1MHWC 3CHBD 4TSSA 4HR7B 2BUOA 3MEFA 4I65A 3E5SA 3PUYA 4GLVB 3TN2A 1VQIA 1HA6A 3CC4P 2EYFA 2DJFC 1JORA 5GQOA 2R6GA 1F2LA 4C3IB 2AUKA 4LF8Q 2KGEA 1PZJD 2KHIA 1MD2D 1NR2A 2B2VC 3DM1A 3NTEA 1EUJA 4HIOA 1STEA 3I3CA 4DXFA 1G2TA 5IYBG 4DV2Q 5M3FB 3H3VC 3MA2B 1EQRA 4IFDI 2VUMG 1E2ZA 4N8FA 2WV6D 2ROQA 2MNAA 2X6LA 2PEMA 1I4RA 1XX8A 2JN4A 2K04A 3FP9A 3OSOA 4ZKCB 2QGQA 4RGTA 2AHOB 4FP5D 4C3HG 3MFGA 3OW7A 1YJWA 2UU9L 3QO2A 4UHVA 4HKGA 2KCTA 1EIFA 3B5IA 2EYHA 1SN8A 1G291 2B3GA 3HOUB 4JPBW 2MVVA 1BDOA 1DD2A 1WTRA 2GA4B 2M00A 1JWMD 3H09A 2RCFA 2XWBB 4DR4Q 3PO2H 2XVSA 4CGYB 2GDYA 1MJEA 2LY7A 4AYBE 2UXBQ 2FADA 5M3MH 1IKMA 5BN5A 1SNOA 2F0IA 1TS4A 2KORA 2KOQA 5IT9L 4BXXG 5IY0A 3DS4A 2EVBA 5I6YA 4ME3A 4XIGS 4YCWA 4B3SL 1K9MC 3M9BA 2E1MA 4L6TB 4PQXA 4R4TA 1FVIA 1QJOA 4GOPC 3HOXG 3U9SA 4JBMA 2E5LL 2G9DA 1EOTA 2CG5B 2CWOA 2XTIA 4DV2L 1A15A 3AU7A 1SNMA 3SGIA 2HIVA 5M5XH 3GJNA 3K0YA 5IYCG 2UUCL 2FVAA 2Z8LA 4A93G 2OWOA 4MHEA 4DR2Q 1IBLL 3HOWH 4A3GG 5LL6S 2I5HA 3SEBA 1LTBD 1VS0A 4DAVA 1C7YA 1K30A 5FLXc 3MXGA 2PNGA 2WB1G 2RF4A 4UP8A 5NUCA 1LTRD 1YJNA 1KDBA 4DR6Q 4COPA 3RN2A 1HNWL 2ES2A 3MC0B 1VQ5A 2NVTH 2E2IH 3HEJA 4JI6L 2K52A 4P74A 3BYYB 3K5MA 1QVFA 3F2DA 2NZOA 1PV4A 2XZ1C 1DCZA 1E1OA 1TWGH 5EKLA 4KHPQ 1EIHA 3NE5B 1L1OB 2JA8B 3K80C 3ITPA 2M5RA 3A8JE 3F2CA 1HPCA 3C1FA 3X3NA 1R9TB 2B39A 4ZRZA 3FEWX 3CCRP 1GVPA 4PZ8A 2R92B 3A8KE 1V1OA 2X2BA 5DM63 2Q8RE 3VYUA 2XN9C 2LPKA 5ELBA 3CCQA 1PYSB 3G26A 1QILA 2L12A 3KDFA 1Y1VH 4FF1A 2EHTA 2N5HA 4LWCA 3HRZC 3IL8A 3DS0A 1L0YB 3I70A 3LMOA 3MAQA 1MSGA 1PRTD 3RZDB 4DN4M 3T56B 5IE8A 1N8RC 1EZ8A 4JOIA 4IOCA 4LJZC 3G7LA 3NENA 1ML0D 4DV0Q 2LIUA 1Q81Q 3S1QH 1B1ZA 3E3XA 1O78A 4A3KH 4P75A 5FOBB 5FO8B 1BXIA 1KIXA 4NDXA 2L0QA 2PI2A 4EQOA 1STNA 1OO9B 4BBRH 5K5PA 4MTKA 5T1IA 2WACA 2BH2A 2LF4A 1XMOQ 1PH9A 1F9QA 3LX0A 2ZM6Q 4JI8L 2L22A 4S3SA 5CV8A 1UE1A 5F2DA 1EOQA 1RNIA 2KHJA 5EPLA 1SYBA 2CH4W 3K7UC 3P75A 3GQBA 1Y8OB 1N32L 3PF5A 2WIIB 1BVSA 1FD7D 3C3LA 4RKBA 1YJWP 2L0CA 1ENAA 1SDFA 2G5DA 2R7ZB 5IGDA 1RJTA 1ONLA 5IGBA 3BVGA 1DXMA 2A1AA 3CPWA 1ZEQX 1Q1EA 4BPGA 4V190 4LFCL 4NB3A 3PUVA 2YV5A 5HGMA 5EAYA 5KYIA 5C0XJ 4LF5L 1YNJD 3GTKH 1WI5A 2K92A 2JA6G 4LF4L 1J9OA 3NP8A 4LUVA 3PUWA 4ZLTF 4DV0L 1A8OA 4YY3Q 1D5MC 5C5LA 4QCLA 2CHBD 3G21A 2BH8A 5EJWA 3WWVA 3PIPA 1B3AA 4JI2L 4KD3A 2HHHQ 1Z6HA 4JBKA 1WTOA 4FF3A 1STYA 2VQFQ 1IYJB 1Q1BA 5IYBH 2NBFA 2AQ3B 5C4XB 1XMOL 2B2TC 2VUMH 4ZKBB 3H91A 5JJLA 4C1NK 5BR8L 1QZHA 1AN8A 2KCCA 1VDZA 3CQZH 4GR2A 1I6HH 3G6JB 4B3TQ 2KR5A 2PENA 4E6IA 5ELDA 2F03A 3RZOH 1UEBA 5EGTA 2RVLA 4HIKA 1X3GA 1YJNP 2VSQA 2WINB 3T13A 1RTNA 2MR8A 4F8MA 5KNCA 4BBSH 4JI4Q 2BHVA 4L8JA 1U4LA 3HOZB 4FO2A 5C4JH 2CVRA 4DFAA 3CC7A 1TWHH 2JA7B 1U0LA 4BXXH 4DA2A 3S1NH 2B63H 1J5EQ 3E6ZX 1SXTA 2ZJRA 2IJ0A 3KOJA 1GM5A 1VQNA 3VR6A 1YNND 2KG6A 1X65A 3HOXH 1E24A 3Q20A 5IIFA 2DGYA 1NCVA 1X56A 4JCVE 1OR5A 2AQ2B 5IYCH 4IFDJ 3DMUA 2GZEA 1STHA 3F1ZA 4A93H 1NE3A 4A3GH 4U0EA 4PNYA 2HCCA 1WTWA 2KA7A 4XTCS 3OMCA 1WD1A 1VQJA 4UHPB 1SNDA 4NXNQ 1WTXA 4CKEA 5DCKA 2G9HD 1HTLD 2GYKA 1YITA 4KN4C 4LFBL 2A6EC 4IUPA 1N34L 4XFYA 2D0PA 1K8GA 1X3FA 5DNFA 2A8VA 4U0AA 4OWTB 4I7ZC 4U0FA 3P1HA 1IMQA 5GAGC 1XMQQ 1Q82Q 3I2ZA 2FACA 1M6EX 1HZBA 3EJEA 1SYEA 2Z6BA 5EBDA 4GKKL 3SK6A 4EQNA 4KKUA 2NVQH 3P7JA 4FNFA 2B2YC 4XDXA 1RF2D 5IT9c 1U4PA 2AFEA 3QG1A 1DOMA 4A3IH 3EFXD 1LT4D 2NVYH 1AF8A 1UNSA 3Q23A 1SMYD 5IGEA 3KK7A 1K3RA 3PIOA 4EQ5A 5M3MB 1SEBD 4KN7C 4QIWE 1E0BA 5HVCA 1LM0A 3GDEA 1XXGA 1JJ2A 2MD9A 2OEOA 1QOHA 2BE5C 4F87A 4OX9L 1GHKA 2EJGC 2JA5B 1CSQA 4RAUC 4XT3B 2A6HD 3EN2A 1GXHA 3NQTA 2JB0A 5KP6B 3G29A 5BN3A 4BY1G 1Q7YC 5IYDG 5C44G 2PZWA 1Q90A 4LF7L 1JJCB 4X65L 3D31A 1YZ6A 3HOWB 2L11A 2UXCL 2DNWA 2IX0A 1VMCA 3L9AX 1PYBA 1PHJA 1PA6A 4K0KL 3TP6A 2EYOA 5EPJA 5FK9C 4CJ0B 1FYCA 2E2IB 1QNKA 2WKCA 3DUZA 1VHNA 1HA5A 1Q81C 4YIJA 1CI3M 1PFBA 2PNRC 1QUQA 2P9XA 1U4MA 3D4WA 4HIDA 1C4QA 3F8TA 3F2BA 1EY9A 1TWAH 3NEMA 1TWGB 4DV4L 1E3PA 3CMEA 2OTLA 4JYAQ 3OWFA 2CWPA 3MXUA 1MSHA 1W3SA 1I94L 1KAWA 1SE3A 4RGMA 1CZGA 2DY7A 1LACA 2LOLA 2FMCA 4XFXA 5I2YA 4WJ4A 2KHSA 4LF9L 2EIFA 1Y1VB 3CCVA 3CCSP 1IYVA 4QMGA 1BCPB 2GZFA 3PUXA 1VQNP 1I6VC 1RO2A 1VQGA 3NBHB 2UUBQ 1P8LA 2PCFB 2ERHA 3D4RA 3QB3A 4DKAC 1I4QA 3NY7B 2VQEL 4MIUA 3L7ZC 4COCA 1FJGL 3S1QB 2AKWB 4ZYSA 4C2MB 5JPMC 4NXMQ 1ACPA 3T1HQ 1XTCD 3A54A 3STBD 1VQDA 3L3OC 4BBRB 4GZYC 1AEXA 2N50A 1H9RA 1YITP 1ICFB 2YTVA 3I56P 2XGTA 5EKKA 2GZIA 1WTHA 4G7OC 3KJPA 3G28A 1HZAA 3S14H 2F1MA 1JCKB 4ID6A 3RLOA 3EIVA 3ULLA 2D2CC 5KYLA 3J80L 3J7AV 3ER0A 1HCZA 1R4PB 2RQXA 3TP8A 4LAAA 4POFA 3KF6A 4JI0Q 2LMLA 2JYLA 1BUVT 4H7BA 4A3MG 3MVVA 4K2KA 4UDUC 3H47A 4DV6L 3TS2A 4OELB 3HYBA 1W2BO 2PQEA 3H94A 4ODGA 2K5NA 5BS1A 4DAYA 2UUBL 4UY8C 3S2DB 3JC66 4QKOA 1VQBA 2C9OA 4X3TA 4EQPA 1YHQA 2OARA 1O7ZA 1STGA 2O4XA 1S5FD 2Z4IA 2V1CC 3PO3G 4IPYA 1T8KA 2CW0D 3W3AA 1XNRL 3TEHB 1GHJA 1SE2A 5GADC 1VQ7A 2FFKB 2HD3A 2K5XA 1Y69U 1W6JA 4A3DG 3BDCA 3NELA 2F0VA 2KEDA 2O5JC 3DS5A 2QCPX 3H0GH 1YIJA 4YWMA 2B2TA 1PMRA 3HGBA 4C3JG 3K7AB 2A68C 5FO7B 2EXZA 5CV5A 1Y1WB 1KDAA 4DR3Q 1KLUD 1YJ9A 3CQZB 1GUGA 1QG7A 1D5ZC 4K2LA 1S5ED 1NJIQ 4JV5Q 5C4ZA 3D6WA 3R8BA 1RKNA 4KJNA 3RZOB 2IHEA 4WJWA 2BDOA 1DM0B 3J7A5 1N36Q 5LMUQ 4BBSB 4RA8A 1TS5A 2ICEC 3BJUA 1QE6A 3E0EA 1STAA 2F0DA 4U68A 3EBEA 3Q6SA 3CMEP 3G4SA 2OTLP 3S1NB 1TY0A 2B63B 4M1UB 4CKCA 3M4QA 4JI5L 1Q82C 2K33A 1JT8A 3VR2A 5KGUA 5CV9A 1HZCA 3Q0AA 3D3RA 5A2QE 5C44H 1UEAB 2K28A 5ELFA 3CCVP 2F0FA 1KLGD 1LTTD 4KI0A 3CPFA 4H13C 3A56A 1KD1Q 2Q2UA 2D9UA 3S17H 2ID0A 5IWAQ 1WTVA 2XV6A 1NY4A 4K8JA 4HJ7A 1VQ9A 4DR3L 4G57A 2PW5A 1PH5A 1HQBA 1ILPA 2A69C 1HNXQ 1TU2B 4XQJA 3M85A 1C9OA 2JU1A 2B2WA 3E2DA 3N6RA 2ATWA 2KG8A 5I4DA 2L55A 2WKDA 1DYQA 4HIMA 2MP1A 3PSIA 1WVLA 1SSOA 2HIXA 2K05A 5LMUL 2R93H 4BY7G 5LHY1 3J81E 1X32A 4LFAQ 4XYQA 2QILA 4JVZA 2EQSA 4IALA 1VQ4P 1D2BA 3K59A 1QB5D 1KDCA 4ZUJA 1C0AA 5IP9G 2VS1A 2B2YA 3BG3A 2OCEA 4A3IB 5I4TG 1YI2A 2NVYB 3IFTA 4P2CB 1S3OA 4CDDC 3KLRA 1I50B 3A5ZB 5JEAG 4KMUC 2Z0SA 4GNXC 4N8X1 5ELOA 4MZ9A 1VQMP 2OT2A 3AMUA
chains in the Genus database with same CATH topology
2UXDQ 1V9PA 2OTJA 1M74A 3GTPH 4JG2A 4X66Q 3AYHB 3HFZB 3VRLC 3H4EA 4DK6C 4DR1L 3S1RH 3CXCA 4A3JH 4LFAL 2F4VL 1YIJP 2LXJA 4J15A 2VY3A 4KLKA 1KRSA 3RLNA 4A3FG 3S16H 1YJ9P 1HR0Q 3CF5A 4A3MH 2K5HA 5LMNQ 3GTJH 2EG5A 2KCMA 2PQAA 4HJ8A 3TS0A 4LF8L 4XRQA 3ZJYC 4L5RC 3PO3H 3G4SP 1JMCA 2K5VA 3I4NG 4LF6Q 4OO1G 3U4VA 2ASBA 3BZKA 4A3DH 1Z9FA 2N78A 4UP7A 4C3JH 3CCJA 1S40A 3I55A 4DV7Q 1CKNB 1EWIA 4DR4L 3J80c 2UXBL 4U0BA 4MTNA 1Q7YQ 2CFMA 2MQHA 1K83H 1KQSO 4GN4B 1PH8A 3RLFA 1L0WA 1A62A 3HOVG 1SFOH 4A3EG 3PCOB 3CCLP 4DR2L 1NJIC 3HOYH 3BZCA 3LGJA 4DUZQ 3E9IA 4DR6L 1Q86Q 2KENA 5H1SE 2UUAQ 4PH1A 2VW9A 2OTJP 5M5WH 4B3RQ 5J3BA 4L5QA 3PF4A 4KHPL 5M3FG 1PH1A 3M4OH 1PH3A 4QY7A 1WCMH 2CCZA 4NPSA 3W1GA 3ERSX 1I3QH 1KHIA 2JO0A 3J7ZC 1K8AC 3S15H 3OW2O 1VQLA 4P73A 3IRBA 1KD1C 5IP9H 3S24A 1UWVA 3HOUG 5HGQA 2YYZA 4R4QA 1WYDA 2QEXA 2XT1A 3DS3A 4R1JA 4QGUA 2FXQA 3B6YA 4FDBA 2Z6KA 5AJ3Q 4H02A 1FGUA 3A5UA 2Q2IA 1PVOA 1A63A 3UE0A 3ICEA 2ZM6L 1LYLA 5JJKA 2D0OA 1QVGO 1D8LA 1XJVA 4C3HH 1IBKQ 1L1OC 2NVXH 1SR3A 3W1BA 2NZHA 3CCJP 1VQ5P 2YU9H 3H3VH 3I55P 4BA1I 1VQFA 3E9HA 2JE6I 4AQYQ 1UE7A 4YY3L 1Q46A 2JA8G 2A19A 3FKIG 4DK3C 4P72A 2HHHL 3J80i 3RN5A 1V1QA 2VQFL 3CCQP 3DM3A 1M90C 4GNXA 1CKMA 2Z46A 4GKJQ 4X62Q 3KF8B 1HR0W 2PEJA 4B3TL 3PUZA 3FHWA 5LMNW 5FJ8G 3KFUA 3VDYA 2EIAA 4TVAB 3UDFA 4JI4L 1SE8A 3OTOQ 4AQYL 4P71A 3KLWA 1RO0A 3M3YH 3K81C 1J5EL 1VQKA 1PH4A 1OXUA 1EIAA 1GD7A 4Y7NH 2R7ZG 3UE1A 4A3EH 1YNXA 3G71A 4GKJL 4GN3B 2QEXP 4JI3Q 5K36G 2ONTA 3CC2A 4O2DA 4NXNL 1FL0A 2JA9A 1PFSA 4GOPA 2JQOA 3CCUA 3KDFB 4C3IH 3H15A 1G6PA 2IT1A 3MGEA 1XMQL 3GTLH 4GR6A 5C4XG 4XROA 3CW2C 2MO1A 1WOCA 1Q86C 3HOUH 2VZAA 1UE5A 2JA6H 1H95A 1QVFO 3CC7P 3HOZG 4AIMA 4LNQA 1MKHA 2NN6G 1IZ6A 2JA7G 1VQPA 1X55A 2YTYA 1D7QA 1S72A 1VQAA 2VL6A 1M6NA 5F2KA 1AE2A 1HNZQ 4IPHA 3G6EA 5IP7G 2GN5A 4AYBG 1D1DA 2EFJA 4DR7Q 1T9HA 2K75A 3UDIA 1IBMQ 2K14A 4JYAL 4QL5A 4X64Q 3AEVA 1EYGA 2CKZB 4JI1Q 2JA8H 3FKIH 5HY6A 1QVCA 5GAEC 1YHAA 1VQKP 1ASZA 4AH6A 1X54A 1HNZL 4APVA 2Y0SE 4IOAA 5M3MG 3CPWO 2AWOA 3RZDH 1OXVA 4JOIC 4NXML 3T1HL 1K0RA 2M8PA 3K0XA 1IBML 5FJ8H 2JA5G 2AWNA 1O7IA 4PZ6A 3CCUP 4KHZA 1YHBA 4DPGA 4HJ5A 2WFWA 4X64L 1BBUA 5C3EG 2JK8A 3HKSA 4JI0L 3G1IA 2KBNA 4DR5Q 4YWLA 4B3MQ 4YHHQ 1Z47A 3UDXA 1Y14B 3BU2A 3DLLA 1TXYA 4DV3Q 2WP8J 4OONA 2R7ZH 3G1GA 1SLJA 1A8VA 1I5FA 2PMZE 4BY1H 5IYDH 4L5SA 4DUYQ 1K8AQ 1VQPP 3GTGH 1Y1VG 1S72P 4DV1Q 2E8GA 4IJLA 4JV5L 4EX5A 2Q2TA 3G6EP 1N36L 1BBWA 4M0IA 1X9NA 1HJPA 4U0CA 4GLXA 2Q2HA 1OXTA 2WAQE 3W5OA 1N9WA 5C0XG 2K50A 3HKZE 3I4OA 3OYYA 2Z45A 2CWAA 4ALPA 4WJ3M 4IJHA 1Q8KA 3M4PA 3S1MH 1XPRA 2JEBI 1QUQB 2UU9Q 4HJAA 4DUYL 1G51A 5IWAL 2HQLA 5GROA 1JE5A 1YHQP 1HNXL 3H3VI 1PH6A 5IP7H 1JJ2O 3A0JA 5ELNA 3CD6A 4PG3A 1RIPA 4B3SQ 1P16A 1VQ7P 3AFPA 3Q8DA 2E5LQ 1M90Q 3ULPA 2RHSB 2UUCQ 4IPDA 2ZTEA 1IBLQ 1KXLA 4QNBA 1Y1WG 1XTDA 1E22A 4OO1I 1HNWQ 4JI6Q 2UXDL 4IFDG 4O0AA 1DGSA 4BBSG 4YCUA 1MJCA 3G48A 3KF6B 4QJFA 4X66L 1YBYA 2H5XA 2PEOA 2B63G 2OQ0A 4DAYB 2JA5H 5JPAA 4MNOA 1SRUA 3TRZA 4UPAA 1VQ9P 1OXSC 5F2NA 5C3EH 3D0FA 4JBWA 1HR0L 3CCMA 2ALYB 1IL2A 3P05A 5M5YH 5LMNL 1EIYB 1HZ9A 2MO0A 2RCNA 4IO9A 1B7YB 3H0DA 2Z44A 2I0QA 2N49A 1VQ6A 4XFZA 4JI8Q 1OXXK 3CP0A 1KC8C 2KODA 1YI2P 5FLMG 1N32Q 4LUZA 4LF6L 4A3IG 1QZGA 5HGNA 2GVAA 1MIUA 2PI2E 3GTQH 3RG6C 2PEIA 4LFCQ 2E2HH 4DV7L 1BAJA 4LF5Q 3L2PA 4LF4Q 4C2MH 3CD6P 4BY7H 4JI2Q 3ULJA 2N3SA 1UE6A 3PGZA 1GKHA 1LUZA 2DUDA 4OWXB 4JI7Q 2CQOA 1NMGA 1SROA 5BR8Q 5HGLA 1BKBA 1W2BA 4DUZL 1E6JP 1X6OA 3T1YQ 3UDGA 4A3LG 1B70B 5BS2A 2UUAL 1B8AA 4IPGA 3S2DH 4B3RL 1RL2A 2GVBA 1VQCA 4R4IA 3S2HH 5JEAJ 1IUQA 3G0VA 2QA4A 1EOVA 1K73Q 1WFQA 1X3EA 2RHQB 4JI7L 1XPUA 1EQQA 4DAMA 4A3FH 3K7AH 2Y0SG 2IHFA 1TWCH 3RR5A 1Y1WH 3CCMP 4R4CA 1A43A 2VNUD 2IX1A 4LFBQ 3T1YL 5DLQE 1XPOA 2F52A 1N34Q 2IY5B 5AJ3L 3TQYA 2R92G 1NBWA 4PH0A 1CKOA 4GKKQ 1VQ6P 4A3BG 2AMCB 3I4NH 3STBC 3J81j 1N33Q 3CCSA 2PQAB 2HT1A 4HJ9A 1IBKL 1ASYA 1ZMBA 4YWKA 1VCIA 3TREA 3I4MG 4OX9Q 4U0DA 1M1KQ 3I7FA 2F3IA 2E2JH 3CCEA 1U5KA 1VQOA 2L6EA 3I56A 4LF7Q 2OQKA 3H0GG 4X65Q 2N8NA 2UXCQ 3CXCO 1VQLP 3DS1A 3HOVH 4BA2I 4K0KQ 2BA0A 1QRJA 5FLMH 4X62L 1J6QA 1N33L 2WB1E 4LW1A 1WJJA 1I50H 2LSSA 3GO5A 4L5TA 4DNIA 1EFWA 4DV4Q 3CAMA 4POGA 2D62A 2WAQG 4A3CG 4IPCA 1I94Q 3HKZG 3OTOL 5M3FH 2LXKA 4LF9Q 2QA4P 2BA1A 2NN6I 2M8NA 2PEKA 3M7NA 2JEAI 2VQEQ 1CSPA 4A4IA 1FJGQ 3L0OA 3DTJA 4JI3L 4Y52H 1PH2A 1LTLA 2R93G 3U4ZA 3J81c 1VQ8A 4A3LH 4A75A 1E1TA 1V43A 3GTMH 1NTGA 3AFQA 1VQHA 4DV6Q 1TWFH 3MXNB 4PZ7A 4JC0A 4RG1A 4LUOA 2ZJPA 1NMFA 3WBHA 3A74A 1XNRQ 2MFIA 3CMAA 3JAMc 1KQSA 5F2OA 4YCVA 1K9MQ 3CCEP 1VQOP 4A3JG 1JB7A 1K73C 1VQ4A 2PNHA 1R9TH 2K4KA 1HH2P 2ZTCA 1E7ZA 2R92H 2R7FA 3PO2G 1CUKA 4OXPA 4A3BH 1AH9A 5HGOA 4DV5Q 3CC4A 3G71P 1VQMA 2I5MX 3CC2P 1AUMA 1SMXA 4DR7L 1A0IA 5GAHC 3K8AA 3DS2A 1XNQQ 3M1MA 4JBJA 4GS3A 3U58A 1YVCA 3I4MH 4PMWA 5JJIA 4GNXB 4R4OA 1CKNA 4JI5Q 1KC8Q 1GO3E 3HOWG 1KL9A 3OW2A 4TQUS 2XXMA 1L1OA 1PH7A 2PY8A 4JI1L 2R7DA 1OTCA 4WYMA 1VQEA 1Q12A 4GLAC 3PV0A 1N8RQ 4OWWB 2JYGA 4DV5L 1M1KC 3LRYA 2ZJQA 1YEZA 3HZQA 3GTOH 1XNQL 2B29A 2JJQA 2YTXA 2EXDA 1VQ8P 2Z6KC 2L15A 1QVGA 4A3CH 4X6AH 1JJGA 4UP9A 5C0XI 3HOYG 3RNUA 5C4XH 3AQQA 3GD7A 2C35B 3J81i 4GOPB 3U50C 1AE3A 4DR5L 4A3KG 4B3ML 4YHHL 4BBRG 4DV3L 5E7NA 4A76A 4GN5A 1IXRA 3DPHA 3KYHC 1WCMG 3CMAP 1KRTA 4DR1Q 3HOZH 1L2FA 3KJOA 3CCRA 2PEQA 2ZTDA 2JA7H 2F4VQ 2M8LA 4RMFA 3JAMi 4QQBX 3CCLA 4DV1L 2I5LX 2BUOA 3MEFA 3PUYA 4GLVB 1VQIA 3CC4P 5GQOA 2R6GA 4LF8Q 2KHIA 4HIOA 3NTEA 1EUJA 5IYBG 4DV2Q 1EQRA 4IFDI 2VUMG 2MNAA 2PEMA 3FP9A 2QGQA 2AHOB 1YJWA 2UU9L 2KCTA 1EIFA 3B5IA 1SN8A 1G291 2B3GA 4DR4Q 3PO2H 1MJEA 4AYBE 2UXBQ 5M3MH 4BXXG 5IY0A 3DS4A 4ME3A 4XIGS 4YCWA 4B3SL 1K9MC 3M9BA 2E1MA 4R4TA 1FVIA 4GOPC 3HOXG 4JBMA 2E5LL 2CWOA 2XTIA 4DV2L 5IYCG 3SGIA 5M5XH 2HIVA 2UUCL 4A93G 2OWOA 4A3GG 4DR2Q 1IBLL 3HOWH 2I5HA 1VS0A 1C7YA 1K30A 5FLXc 2WB1G 2RF4A 4UP8A 1YJNA 4DR6Q 4COPA 3RN2A 1HNWL 2ES2A 1VQ5A 2NVTH 2E2IH 4JI6L 2K52A 4P74A 1QVFA 3F2DA 2NZOA 1PV4A 1E1OA 1TWGH 4KHPQ 1L1OB 3K80C 3F2CA 3CCRP 1GVPA 4PZ8A 3CCQA 1PYSB 3G26A 3KDFA 1Y1VH 4LWCA 3DS0A 5IE8A 1N8RC 4JOIA 4IOCA 3NENA 4DV0Q 1Q81Q 3S1QH 4A3KH 4P75A 1KIXA 2PI2A 4BBRH 2BH2A 2LF4A 1XMOQ 1PH9A 2ZM6Q 4JI8L 1UE1A 1EOQA 1RNIA 2KHJA 3K7UC 1N32L 3PF5A 1BVSA 1YJWP 2A1AA 3CPWA 1Q1EA 4LFCL 4NB3A 3PUVA 2YV5A 5HGMA 5EAYA 4LF5L 5C0XJ 3GTKH 1WI5A 2JA6G 4LF4L 4LUVA 3PUWA 4DV0L 1A8OA 4YY3Q 3G21A 2BH8A 3PIPA 3WWVA 4JI2L 2HHHQ 4JBKA 2VQFQ 1IYJB 1Q1BA 5IYBH 1XMOL 2VUMH 5JJLA 5BR8L 1QZHA 3CQZH 4GR2A 1I6HH 4B3TQ 2PENA 3RZOH 1UEBA 4HIKA 1X3GA 1YJNP 4BBSH 4JI4Q 2BHVA 5C4JH 3CC7A 1TWHH 1U0LA 4BXXH 3S1NH 2B63H 1J5EQ 2ZJRA 3KOJA 1GM5A 1VQNA 1X65A 3HOXH 1E24A 3Q20A 2DGYA 1X56A 4JCVE 5IYCH 4IFDJ 3F1ZA 4A93H 1NE3A 4A3GH 4U0EA 4XTCS 1VQJA 4NXNQ 5DCKA 1YITA 4LFBL 1N34L 4XFYA 2D0PA 1K8GA 1X3FA 2A8VA 4U0AA 4OWTB 4U0FA 5GAGC 1XMQQ 1Q82Q 3I2ZA 1HZBA 1M6EX 4GKKL 2NVQH 5IT9c 4A3IH 2NVYH 1K3RA 3PIOA 4EQ5A 4QIWE 1LM0A 3GDEA 1JJ2A 4OX9L 1CSQA 3EN2A 3G29A 1Q7YC 4BY1G 5IYDG 5C44G 4LF7L 1JJCB 4X65L 3D31A 1YZ6A 2UXCL 2IX0A 1PYBA 1PHJA 1PA6A 4K0KL 1Q81C 1QUQA 2P9XA 4HIDA 3F8TA 3F2BA 1TWAH 3NEMA 4DV4L 1E3PA 3CMEA 2OTLA 4JYAQ 2CWPA 1W3SA 1I94L 1KAWA 4XFXA 4WJ4A 4LF9L 2EIFA 3CCVA 3CCSP 3PUXA 1VQNP 1RO2A 1VQGA 3NBHB 2UUBQ 1P8LA 4DKAC 2VQEL 3L7ZC 4COCA 1FJGL 2AKWB 4NXMQ 3T1HQ 3STBD 1VQDA 1YITP 2YTVA 3I56P 2XGTA 3KJPA 3G28A 1HZAA 3S14H 3RLOA 3EIVA 3ULLA 3ER0A 4POFA 3KF6A 4JI0Q 2JYLA 4A3MG 3H47A 4DV6L 3TS2A 3HYBA 1W2BO 2K5NA 5BS1A 2UUBL 4UY8C 3JC66 1VQBA 1YHQA 2OARA 2V1CC 3PO3G 4IPYA 1XNRL 3TEHB 5GADC 1VQ7A 4A3DG 3NELA 3DS5A 3H0GH 1YIJA 4YWMA 4DR3Q 1YJ9A 1NJIQ 4JV5Q 2IHEA 3J7A5 1N36Q 5LMUQ 3BJUA 3E0EA 3EBEA 3CMEP 3G4SA 2OTLP 3M4QA 4JI5L 1Q82C 1JT8A 1HZCA 5C44H 3CCVP 4KI0A 3CPFA 2Q2UA 1KD1Q 3S17H 2ID0A 5IWAQ 2XV6A 1NY4A 4HJ7A 1VQ9A 4DR3L 1PH5A 1HNXQ 3M85A 1C9OA 3E2DA 2ATWA 4HIMA 3PSIA 2HIXA 5LMUL 2R93H 4BY7G 4LFAQ 2EQSA 1VQ4P 1C0AA 5IP9G 2VS1A 2OCEA 5I4TG 1YI2A 1S3OA 3A5ZB 5JEAG 2Z0SA 4GNXC 5ELOA 4MZ9A 1VQMP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQK A;  5GAE C;  1KIX A;  1YHA A;  3H0G G;  2PI2 A;  4X65 Q;  4BBR H;  2UXD Q;  2N8N A;  2UXC Q;  1V9P A;  2BH2 A;  2OTJ A;  1XMO Q;  1PH9 A;  1ASZ A;  3HOV H;  4AH6 A;  4BA2 I;  1X54 A;  4K0K Q;  1HNZ L;  2ZM6 Q;  3GTP H;  4APV A;  2Y0S E;  4JG2 A;  4X66 Q;  4JI8 L;  2BA0 A;  3AYH B;  1UE1 A;  5M3M G;  4IOA A;  2KHJ A;  3HFZ B;  5FLM H;  2AWO A;  1J6Q A;  4X62 L;  4DK6 C;  3K7U C;  3RZD H;  1OXV A;  4JOI C;  4NXM L;  1N33 L;  1N32 L;  3PF5 A;  4DR1 L;  3T1H L;  3S1R H;  2WB1 E;  1BVS A;  1K0R A;  4LW1 A;  3CXC A;  1WJJ A;  1I50 H;  2LSS A;  3K0X A;  4A3J H;  1IBM L;  4LFA L;  5FJ8 H;  2JA5 G;  2AWN A;  1O7I A;  3GO5 A;  4L5T A;  2F4V L;  4DNI A;  1EFW A;  4PZ6 A;  4KHZ A;  4DV4 Q;  2LXJ A;  1YHB A;  2A1A A;  4DPG A;  3CAM A;  4J15 A;  3CPW A;  4HJ5 A;  2VY3 A;  4KLK A;  1Q1E A;  4POG A;  2D62 A;  2WAQ G;  2WFW A;  4LFC L;  1KRS A;  1BBU A;  3RLN A;  4NB3 A;  4X64 L;  4A3F G;  3PUV A;  2YV5 A;  4A3C G;  4IPC A;  5EAY A;  4LF5 L;  5C0X J;  3S16 H;  5C3E G;  1I94 Q;  1HR0 Q;  3GTK H;  2JK8 A;  3CF5 A;  1WI5 A;  3HKZ G;  3HKS A;  4JI0 L;  2JA6 G;  4A3M H;  3OTO L;  2K5H A;  5M3F H;  4LF4 L;  5LMN Q;  3GTJ H;  4LUV A;  3PUW A;  2LXK A;  4DV0 L;  4LF9 Q;  4YY3 Q;  2KBN A;  2KCM A;  4DR5 Q;  2PQA A;  4YWL A;  4HJ8 A;  3PIP A;  2BH8 A;  3TS0 A;  3WWV A;  4B3M Q;  4JI2 L;  4LF8 L;  2HHH Q;  2BA1 A;  1Z47 A;  4YHH Q;  2NN6 I;  3UDX A;  4JBK A;  1Y14 B;  3BU2 A;  3DLL A;  1TXY A;  3ZJY C;  4DV3 Q;  2WP8 J;  4OON A;  2VQF Q;  1IYJ B;  1Q1B A;  5IYB H;  4L5R C;  3M7N A;  2JEA I;  2VQE Q;  1XMO L;  2R7Z H;  2VUM H;  1CSP A;  4A4I A;  3PO3 H;  1FJG Q;  3L0O A;  1SLJ A;  5JJL A;  1JMC A;  5BR8 L;  1A8V A;  2K5V A;  4JI3 L;  1QZH A;  3I4N G;  4LF6 Q;  4OO1 G;  4Y52 H;  3CQZ H;  1I5F A;  3U4V A;  2ASB A;  1I6H H;  2PMZ E;  1PH2 A;  4B3T Q;  3BZK A;  1LTL A;  4A3D H;  4BY1 H;  2R93 G;  1Z9F A;  5IYD H;  4L5S A;  2N78 A;  3RZO H;  4DUY Q;  1UEB A;  3U4Z A;  4HIK A;  1X3G A;  3J81 c;  1VQ8 A;  4UP7 A;  4A3L H;  3GTG H;  4C3J H;  3CCJ A;  1Y1V G;  1S40 A;  4BBS H;  3I55 A;  4DV7 Q;  4JI4 Q;  1CKN B;  4A75 A;  1EWI A;  4DV1 Q;  4DR4 L;  3J80 c;  1E1T A;  2E8G A;  4IJL A;  5C4J H;  4JV5 L;  4EX5 A;  3CC7 A;  2Q2T A;  2UXB L;  1TWH H;  1V43 A;  1U0L A;  4BXX H;  4MTN A;  3GTM H;  1NTG A;  3S1N H;  3AFQ A;  1VQH A;  2B63 H;  1J5E Q;  4DV6 Q;  1N36 L;  2CFM A;  1BBW A;  2ZJR A;  1TWF H;  3MXN B;  3KOJ A;  1GM5 A;  4PZ7 A;  1VQN A;  4JC0 A;  2MQH A;  1K83 H;  1X9N A;  1HJP A;  1X65 A;  4RG1 A;  1E24 A;  3HOX H;  2DGY A;  4LUO A;  1X56 A;  4JCV E;  4GN4 B;  2ZJP A;  4GLX A;  2Q2H A;  1NMF A;  1PH8 A;  1OXT A;  2WAQ E;  3RLF A;  5IYC H;  1L0W A;  3W5O A;  4IFD J;  1A62 A;  3HOV G;  1N9W A;  5C0X G;  3F1Z A;  1SFO H;  2K50 A;  1NE3 A;  4A93 H;  3HKZ E;  4A3E G;  3A74 A;  4A3G H;  3I4O A;  1XNR Q;  3PCO B;  4DR2 L;  3OYY A;  2MFI A;  2CWA A;  1NJI C;  3HOY H;  3BZC A;  3CMA A;  4ALP A;  3LGJ A;  4WJ3 M;  4XTC S;  3JAM c;  1KQS A;  4IJH A;  1Q8K A;  1VQJ A;  3M4P A;  3S1M H;  1XPR A;  4DUZ Q;  4NXN Q;  4YCV A;  2JEB I;  1QUQ B;  2UU9 Q;  4HJA A;  1YIT A;  1VQL A;  4LFB L;  4DUY L;  4A3J G;  1JB7 A;  3E9I A;  4DR6 L;  2KEN A;  1K73 C;  1VQ4 A;  1N34 L;  2PNH A;  1G51 A;  1R9T H;  2D0P A;  2K4K A;  5H1S E;  1K8G A;  5IWA L;  1X3F A;  1HH2 P;  2HQL A;  2A8V A;  2ZTC A;  1E7Z A;  4OWT B;  5GRO A;  2R7F A;  2VW9 A;  2UUA Q;  1JE5 A;  2R92 H;  5M5W H;  3PO2 G;  5GAG C;  1XMQ Q;  5J3B A;  1CUK A;  4B3R Q;  3I2Z A;  4OXP A;  1HZB A;  1HNX L;  4A3B H;  4L5Q A;  3H3V I;  4GKK L;  3PF4 A;  1PH6 A;  1AH9 A;  2NVQ H;  4KHP L;  5IP7 H;  5M3F G;  4DV5 Q;  1PH1 A;  3CC4 A;  3M4O H;  1PH3 A;  4QY7 A;  1WCM H;  1VQM A;  5IT9 c;  2I5M X;  2CCZ A;  3A0J A;  5ELN A;  4A3I H;  3CD6 A;  1SMX A;  4PG3 A;  2NVY H;  1RIP A;  4NPS A;  1A0I A;  1P16 A;  3W1G A;  5GAH C;  4B3S Q;  4DR7 L;  3ERS X;  1I3Q H;  1KHI A;  3K8A A;  3J7Z C;  1K8A C;  1XNQ Q;  3AFP A;  3Q8D A;  3S15 H;  4JBJ A;  2E5L Q;  1K3R A;  4GS3 A;  3IRB A;  4P73 A;  1KD1 C;  3U58 A;  3PIO A;  3ULP A;  2RHS B;  4EQ5 A;  4QIW E;  5IP9 H;  3S24 A;  1UWV A;  1YVC A;  2UUC Q;  3I4M H;  4IPD A;  1LM0 A;  3GDE A;  4PMW A;  4GNX B;  5HGQ A;  2ZTE A;  1JJ2 A;  3HOU G;  2YYZ A;  1CKN A;  4R4O A;  4R4Q A;  1IBL Q;  4JI5 Q;  1KXL A;  1WYD A;  2QEX A;  1GO3 E;  3HOW G;  1KL9 A;  4OX9 L;  1Y1W G;  1XTD A;  1E22 A;  1CSQ A;  3OW2 A;  3EN2 A;  4TQU S;  1L1O A;  4R1J A;  4QGU A;  1Q7Y C;  4BY1 G;  1PH7 A;  4OO1 I;  5IYD G;  5C44 G;  4JI1 L;  2FXQ A;  2R7D A;  1OTC A;  3B6Y A;  4FDB A;  5JJI A;  4LF7 L;  1HNW Q;  2Z6K A;  5AJ3 Q;  1JJC B;  4JI6 Q;  4H02 A;  4X65 L;  1FGU A;  1VQE A;  1YZ6 A;  3D31 A;  4IFD G;  4O0A A;  2UXD L;  3A5U A;  2Q2I A;  1DGS A;  2IX0 A;  2UXC L;  1PVO A;  1Q12 A;  4BBS G;  1A63 A;  4GLA C;  3PV0 A;  4YCU A;  1MJC A;  3G48 A;  3KF6 B;  3UE0 A;  4OWW B;  1PYB A;  1PHJ A;  1PA6 A;  3ICE A;  4K0K L;  2ZM6 L;  4QJF A;  4X66 L;  1YBY A;  1LYL A;  5JJK A;  4DV5 L;  2H5X A;  2D0O A;  1D8L A;  1XJV A;  2B63 G;  4C3H H;  1M1K C;  2OQ0 A;  2ZJQ A;  1IBK Q;  1Q81 C;  1YEZ A;  4DAY B;  2JA5 H;  1L1O C;  3GTO H;  2NVX H;  1QUQ A;  1XNQ L;  2B29 A;  4HID A;  4MNO A;  3F8T A;  2JJQ A;  3F2B A;  1SR3 A;  1SRU A;  1TWA H;  2YTX A;  3NEM A;  3W1B A;  2EXD A;  4DV4 L;  3TRZ A;  2NZH A;  4UPA A;  1E3P A;  2Z6K C;  3CME A;  2L15 A;  2YU9 H;  3H3V H;  2OTL A;  4JYA Q;  1QVG A;  4A3C H;  4BA1 I;  4X6A H;  1JJG A;  1OXS C;  2CWP A;  5C3E H;  1VQF A;  4UP9 A;  1W3S A;  3D0F A;  5C0X I;  1I94 L;  4JBW A;  1HR0 L;  3E9H A;  1KAW A;  3HOY G;  2JE6 I;  3CCM A;  4AQY Q;  3RNU A;  5C4X H;  3AQQ A;  2ALY B;  3GD7 A;  1IL2 A;  5LMN L;  5M5Y H;  1EIY B;  4WJ4 A;  1HZ9 A;  1UE7 A;  2C35 B;  3J81 i;  4GOP B;  4LF9 L;  4YY3 L;  2EIF A;  1Q46 A;  3CCV A;  3U50 C;  1AE3 A;  4DR5 L;  2MO0 A;  2JA8 G;  4A3K G;  2A19 A;  3FKI G;  2RCN A;  4IO9 A;  1B7Y B;  3PUX A;  4B3M L;  4DK3 C;  4P72 A;  2HHH L;  3J80 i;  3RN5 A;  4YHH L;  1VQG A;  3NBH B;  2UUB Q;  1P8L A;  4DKA C;  1V1Q A;  4BBR G;  4DV3 L;  2VQF L;  1M90 C;  3DM3 A;  5E7N A;  2I0Q A;  2N49 A;  2VQE L;  4A76 A;  3L7Z C;  1VQ6 A;  4GN5 A;  1IXR A;  4JI8 Q;  1FJG L;  4GNX A;  1CKM A;  1OXX K;  3CP0 A;  1KC8 C;  2AKW B;  4GKJ Q;  4X62 Q;  3KF8 B;  3KYH C;  1WCM G;  5FLM G;  4NXM Q;  1N32 Q;  1KRT A;  4LUZ A;  4DR1 Q;  3T1H Q;  4LF6 L;  3HOZ H;  1L2F A;  3STB D;  1VQD A;  3KJO A;  4A3I G;  1QZG A;  1HR0 W;  3CCR A;  4B3T L;  3PUZ A;  2ZTD A;  3FHW A;  5LMN W;  2JA7 H;  2YTV A;  5FJ8 G;  2F4V Q;  2XGT A;  3KFU A;  3KJP A;  2GVA A;  1MIU A;  1HZA A;  3S14 H;  3VDY A;  2PI2 E;  3RLO A;  3EIV A;  3ULL A;  3GTQ H;  4TVA B;  4LFC Q;  3UDF A;  2E2H H;  1SE8 A;  4RMF A;  3ER0 A;  3JAM i;  4DV7 L;  3CCL A;  4JI4 L;  4LF5 Q;  4QQB X;  4DV1 L;  2I5L X;  3L2P A;  4POF A;  3KF6 A;  4JI0 Q;  3OTO Q;  4AQY L;  4LF4 Q;  3MEF A;  4P71 A;  3KLW A;  4A3M G;  3PUY A;  4GLV B;  1VQI A;  3M3Y H;  3K81 C;  5GQO A;  2R6G A;  1J5E L;  4DV6 L;  4C2M H;  3TS2 A;  4BY7 H;  4JI2 Q;  4LF8 Q;  2KHI A;  2K5N A;  3ULJ A;  1VQK A;  2N3S A;  1UE6 A;  2UUB L;  4UY8 C;  3JC6 6;  2IY5 B;  3PGZ A;  2DUD A;  1GKH A;  1EUJ A;  1LUZ A;  1OXU A;  1VQB A;  4HIO A;  1PH4 A;  4OWX B;  1YHQ A;  4JI7 Q;  1GD7 A;  4Y7N H;  5IYB G;  4DV2 Q;  1EQR A;  2R7Z G;  4IFD I;  2VUM G;  2V1C C;  2CQO A;  3UE1 A;  4A3E H;  2MNA A;  1YNX A;  3PO3 G;  1NMG A;  1XNR L;  3TEH B;  1SRO A;  5BR8 Q;  3G71 A;  4GKJ L;  1BKB A;  4GN3 B;  1W2B A;  4JI3 Q;  5K36 G;  3FP9 A;  3CC2 A;  2QGQ A;  5GAD C;  2AHO B;  4O2D A;  1VQ7 A;  4NXN L;  4DUZ L;  1FL0 A;  4A3D G;  1YJW A;  2JA9 A;  2UU9 L;  1PFS A;  3NEL A;  1X6O A;  4GOP A;  3T1Y Q;  2KCT A;  1EIF A;  2JQO A;  1SN8 A;  3KDF B;  3H0G H;  1G29 1;  2B3G A;  3CCU A;  4YWM A;  3UDG A;  1YIJ A;  4C3I H;  3H15 A;  4A3L G;  1B70 B;  1G6P A;  2IT1 A;  4DR4 Q;  2UUA L;  1B8A A;  3PO2 H;  4DR3 Q;  4IPG A;  1YJ9 A;  3S2D H;  1XMQ L;  4B3R L;  1MJE A;  4JV5 Q;  3GTL H;  1RL2 A;  2GVB A;  4AYB E;  2UXB Q;  5M3M H;  5C4X G;  1VQC A;  4R4I A;  3S2H H;  2IHE A;  4BXX G;  5IY0 A;  5JEA J;  3J7A 5;  1N36 Q;  4ME3 A;  4XIG S;  4YCW A;  2QA4 A;  3CW2 C;  5LMU Q;  2MO1 A;  1EOV A;  4B3S L;  1K9M C;  3M9B A;  1WOC A;  4R4T A;  3HOW H;  1WFQ A;  1FVI A;  1X3E A;  3BJU A;  3E0E A;  4GOP C;  2RHQ B;  3HOX G;  1Q86 C;  4JBM A;  2E5L L;  4JI7 L;  1XPU A;  2XTI A;  4DV2 L;  3EBE A;  1EQQ A;  5IYC G;  3SGI A;  5M5X H;  2HIV A;  4DAM A;  3G4S A;  2UUC L;  3HOU H;  4A3F H;  4A93 G;  2OWO A;  4A3G G;  3K7A H;  3M4Q A;  2VZA A;  4JI5 L;  4DR2 Q;  1Q82 C;  2Y0S G;  1IBL L;  2I5H A;  1UE5 A;  1TWC H;  2IHF A;  3RR5 A;  1Y1W H;  2JA6 H;  1H95 A;  1VS0 A;  4R4C A;  1C7Y A;  4AIM A;  1HZC A;  3HOZ G;  5FLX c;  4LNQ A;  1MKH A;  2VNU D;  5C44 H;  2IX1 A;  2WB1 G;  4LFB Q;  2NN6 G;  2RF4 A;  1IZ6 A;  4UP8 A;  3T1Y L;  1YJN A;  5DLQ E;  2JA7 G;  1XPO A;  4DR6 Q;  2F52 A;  1N34 Q;  4KI0 A;  3CPF A;  3RN2 A;  1VQP A;  1X55 A;  2Q2U A;  2YTY A;  2ES2 A;  1HNW L;  5AJ3 L;  1VQ5 A;  2E2I H;  2NVT H;  3S17 H;  4JI6 L;  1D7Q A;  2ID0 A;  2K52 A;  5IWA Q;  4P74 A;  1NY4 A;  3TQY A;  4HJ7 A;  1VQ9 A;  1S72 A;  1VQA A;  1QVF A;  3F2D A;  2R92 G;  1NBW A;  2NZO A;  2VL6 A;  4DR3 L;  1PV4 A;  1PH5 A;  1AE2 A;  1CKO A;  1HNX Q;  1E1O A;  1HNZ Q;  3M85 A;  4GKK Q;  1C9O A;  4A3B G;  1TWG H;  4IPH A;  4KHP Q;  2ATW A;  2AMC B;  3G6E A;  1L1O B;  3K80 C;  5IP7 G;  2GN5 A;  3STB C;  4AYB G;  3PSI A;  3J81 j;  3F2C A;  4HIM A;  3I4N H;  1N33 Q;  3CCS A;  2PQA B;  2HT1 A;  4DR7 Q;  1T9H A;  2K75 A;  2HIX A;  4HJ9 A;  5LMU L;  3UDI A;  4BY7 G;  2R93 H;  1GVP A;  1IBK L;  4PZ8 A;  1ASY A;  1IBM Q;  4LFA Q;  2EQS A;  3CCQ A;  1PYS B;  4YWK A;  1VCI A;  3KDF A;  1Y1V H;  2K14 A;  4LWC A;  1C0A A;  4JYA L;  5IP9 G;  2VS1 A;  4QL5 A;  3TRE A;  4X64 Q;  3I4M G;  2OCE A;  3AEV A;  1JT8 A;  5IE8 A;  1YI2 A;  1N8R C;  4JOI A;  1EYG A;  4OX9 Q;  4IOC A;  1S3O A;  3A5Z B;  5JEA G;  2Z0S A;  2CKZ B;  3I7F A;  4GNX C;  2F3I A;  3NEN A;  4DV0 Q;  2E2J H;  5ELO A;  4MZ9 A;  3CCE A;  3S1Q H;  1U5K A;  4JI1 Q;  1VQO A;  2JA8 H;  3I56 A;  3FKI H;  4P75 A;  5HY6 A;  4A3K H;  1QVC A;  4LF7 Q; 
#chains in the Genus database with same CATH topology
 3I4L A;  2HDL A;  2ZT9 C;  2UXD Q;  2F0Q A;  1LT6 D;  1H9S A;  1NUC A;  1V9P A;  2OTJ A;  1M74 A;  3GTP H;  3BVM A;  4JG2 A;  4X66 Q;  3JAM E;  3AYH B;  1EYD A;  2KG9 A;  3HFZ B;  4KD4 A;  4CHT B;  3VRL C;  3H4E A;  4DK6 C;  2PZT A;  1AZQ A;  4DR1 L;  3S1R H;  3CXC A;  4A3J H;  4LFA L;  1GUW A;  3NWS A;  2Q8I B;  2F4V L;  2F0J A;  2A74 C;  2JSO A;  1YIJ P;  2LXJ A;  2B2U C;  4CBV A;  4J15 A;  4J6H A;  2MHV A;  2VY3 A;  4KLK A;  5IGG A;  1KRS A;  3RLN A;  4A3F G;  3S16 H;  1YJ9 P;  3J7A F;  4KV6 A;  1HR0 Q;  3CF5 A;  5EKI A;  4A3M H;  2K5H A;  1KNA A;  4HED A;  4G4K A;  5LMN Q;  4H2X C;  3GTJ H;  2F3V A;  2EG5 A;  3KF8 A;  2TMP A;  4Q5V A;  2KCM A;  2PQA A;  4UAI A;  4HJ8 A;  3VA5 A;  3TS0 A;  4LF8 L;  2K2Q A;  4C56 C;  2F0S A;  4XRQ A;  3ZJY C;  5CGK A;  5DEH A;  1A6X A;  4KKS A;  1FNV A;  4L5R C;  2A68 D;  2SNS A;  3PO3 H;  3G4S P;  3GTM B;  3ERO A;  2N98 A;  1JMC A;  1TWF B;  2K5V A;  3I4N G;  1BF4 A;  4LF6 Q;  4OO1 G;  3RD4 A;  3U4V A;  2ASB A;  1BO0 A;  3BZK A;  3BVZ A;  4K8I A;  4A3D H;  1Z9F A;  2N78 A;  4KKT A;  1F9R A;  1EU4 A;  1GUT A;  4UP7 A;  4C3J H;  2D5D A;  3CCJ A;  1S40 A;  2Y0S B;  3UI2 A;  1QNU A;  4KK7 A;  3I55 A;  4DV7 Q;  1GJX A;  1CKN B;  2HQE A;  1EWI A;  4DR4 L;  3J80 c;  1T5X D;  1V1P B;  2FQ0 A;  5COR A;  4MN3 A;  2FIN B;  2UXB L;  4U0B A;  4MTN A;  4DU9 A;  1Q7Y Q;  1E2V A;  2Q8T A;  5D3D A;  3S14 B;  1EY6 A;  2CFM A;  1B50 A;  2KW2 A;  2MQH A;  1K83 H;  1PFM A;  2PYK A;  3SDZ A;  1KQS O;  3W2D A;  4PWV B;  4A3B B;  4GN4 B;  2LKV A;  4OIJ A;  3RLF A;  1PH8 A;  1L0W A;  1A62 A;  3HOV G;  2QEJ C;  1SFO H;  4IUQ A;  2A69 D;  4A3E G;  3PCO B;  3CCL P;  5C6A A;  4DR2 L;  1IMP A;  1NJI C;  3HOY H;  3BZC A;  3LGJ A;  1UJZ A;  1EY7 A;  4RGO S;  1KLP A;  4DUZ Q;  2LS0 1;  2DY8 A;  2JU2 A;  1CQF A;  1M4V A;  2F0T A;  2NWG A;  1FR3 A;  3J81 L;  3E9I A;  3K57 A;  3VYS A;  1Q86 Q;  2KEN A;  4DR6 L;  2E74 C;  3I4M B;  2F0O A;  5H1S E;  4C3I G;  2FQ1 A;  3V2T A;  2UUA Q;  4PH1 A;  2K1B A;  2VW9 A;  3R2I A;  2OTJ P;  5M5W H;  4B3R Q;  5J3B A;  2E76 C;  4L5Q A;  3PF4 A;  3GZM A;  1IW7 C;  1SNC A;  2PMZ B;  5CZD B;  4KHP L;  5M3F G;  1X3Q A;  1PH1 A;  3M4O H;  1PH3 A;  4QY7 A;  1WCM H;  3U43 A;  3H0G B;  2CCZ A;  1Y8P B;  4CDC C;  1LV9 A;  4NPS A;  3W1G A;  3ERS X;  1I3Q H;  1KHI A;  2JO0 A;  3J7Z C;  1K8A C;  3S15 H;  3OOC A;  3OW2 O;  4K6L A;  1NQ4 A;  2XIW A;  2Z9H A;  1VQL A;  4P73 A;  3IRB A;  2KEE A;  1KD1 C;  2IW3 A;  5IP9 H;  3S24 A;  1UWV A;  1PTO B;  1XYI A;  4G7H C;  1ESF A;  5HGQ A;  3HOU G;  1HFN A;  2YYZ A;  4R4Q A;  2F0G A;  2VB3 X;  2JBG A;  1WYD A;  2QEX A;  3JAM L;  4QUF A;  5IGF A;  2XT1 A;  4OEM B;  1EY5 A;  2KWL A;  1HXY D;  3GV3 A;  3GTO B;  1EL0 A;  3NBI A;  2H4O A;  3DS3 A;  4R1J A;  4QGU A;  3T16 A;  2FXQ A;  3B6Y A;  4FDB A;  2BCO A;  2WAQ B;  2K0X A;  5I9P A;  2Z6K A;  5AJ3 Q;  4H02 A;  1FGU A;  2K32 A;  1CEI A;  2N6Y A;  2Q2I A;  1RHP A;  2PO4 A;  3HKZ B;  3LWU A;  3A5U A;  1PVO A;  1A63 A;  2EZV A;  1I4G A;  1CQV A;  3UE0 A;  1EIG A;  2I46 A;  3ICE A;  3KLS X;  2ZM6 L;  5C44 B;  2MUY A;  1LYL A;  5JJK A;  3GP7 A;  1Y8N B;  2D0O A;  1QVG O;  5JAV A;  1D8L A;  1XJV A;  1STB A;  3MHB A;  3OIP A;  4C3H H;  3S17 B;  1A2U A;  2DNE A;  4HSP A;  1IBK Q;  1L1O C;  2NVX H;  1EQT A;  3BYT B;  1EY4 A;  3HS0 C;  1SR3 A;  2FVF A;  3MEH A;  3OMG A;  4K5W A;  1B53 A;  3W1B A;  2NZH A;  3CCJ P;  1VQ5 P;  1E2W A;  2YU9 H;  3H3V H;  3I55 P;  4BA1 I;  4EGV A;  1VQF A;  1B4O A;  2QW7 A;  5LL6 X;  1DON A;  3DEP A;  4DG9 A;  3E9H A;  2R93 B;  2JE6 I;  2K0D X;  1S5C D;  4AQY Q;  2F0N A;  1ESR A;  2CQ8 A;  1AP0 A;  1LT3 D;  1UE7 A;  2L4B A;  4YY3 L;  1Q46 A;  4DK0 A;  5EBC A;  2FQ2 A;  2JA8 G;  2A19 A;  3FKI G;  4DK3 C;  4P72 A;  2HHH L;  3J80 i;  3RN5 A;  1V8Q A;  5M9O A;  1V1Q A;  5D14 A;  2FAE A;  2VQF L;  3CCQ P;  3DM3 A;  1M90 C;  3A8I E;  1TII D;  1KNE A;  5ELC A;  2AUJ D;  4GNX A;  1CKM A;  2Z46 A;  4GKJ Q;  5FLX E;  4X62 Q;  3KF8 B;  3RMH A;  4OO1 H;  1HR0 W;  2PEJ A;  1I4X A;  3PMF A;  4B3T L;  2I07 B;  1TQO A;  3PUZ A;  2B2V A;  2JQ4 A;  3FHW A;  5LMN W;  4WRD A;  5FJ8 G;  1SYF A;  3URY A;  3V05 A;  4DXG A;  3KFU A;  2XRQ D;  4H44 C;  2OF1 A;  1E0H A;  3IAY A;  3VDY A;  2EIA A;  2RBM A;  1D5X C;  1AFP A;  4TVA B;  5ELE A;  4O1N A;  3UDF A;  2KOS A;  1SE8 A;  4JI4 L;  5T1G A;  4FVM A;  3S1R B;  4CKB A;  2LIW A;  1EYA A;  3OTO Q;  4AQY L;  3DWQ A;  5KNB A;  2KOO A;  1PTO C;  4P71 A;  3KLW A;  1G2S A;  1RO0 A;  4A3J B;  2GDW A;  1RTO A;  3M3Y H;  2F4I A;  3K81 C;  3EJI A;  2F0H A;  1J5E L;  1UUP A;  3IFD A;  1VQK A;  3PO2 B;  3AB9 A;  3S16 B;  1HFG A;  1PH4 A;  1OXU A;  4RFB A;  1EIA A;  1X3O A;  5C3W A;  1GD7 A;  4Y7N H;  3QOL A;  1F9P A;  4QB4 A;  2R7Z G;  3UE1 A;  4A3E H;  1YNX A;  2VLN A;  4JW0 A;  3C46 A;  1IW7 D;  3G71 A;  4GKJ L;  4GN3 B;  2QEX P;  1T5E A;  4JI3 Q;  5K36 G;  2ONT A;  5JPN C;  3CC2 A;  4O2D A;  4NXN L;  1FL0 A;  2JA9 A;  1PFS A;  4GOP A;  3NWT A;  4X3U A;  3QJY A;  4BWG B;  5M5X B;  2JQO A;  3GV6 A;  3KDF B;  3I72 A;  3CCU A;  2EE1 A;  5CYU A;  1CFM A;  4C3I H;  3H15 A;  4KY6 A;  1G6P A;  1AYI A;  1SJE D;  3R3O A;  2IT1 A;  2SDF A;  3BDO A;  3T4A C;  2HDM A;  1ZXT A;  4U67 3;  3MGE A;  1XMQ L;  3NTI A;  1AZP A;  3GTL H;  3OPO A;  1GOZ A;  4GR6 A;  2RSO A;  5C4X G;  3FPU B;  5I6W A;  1CHQ D;  1IHZ A;  2N88 A;  4CDF C;  4XRO A;  2NVT B;  3CW2 C;  2MO1 A;  2F0L A;  2R61 A;  1WOC A;  3FVQ A;  1C48 A;  4I7A A;  3K5L A;  1TR5 A;  2E75 C;  2EYJ A;  1Q86 C;  2KVM A;  4XYO A;  3O13 A;  4TRD A;  1CA6 A;  4CA3 A;  1BOS A;  3T51 B;  1PFN A;  3HOU H;  1B44 D;  5CV6 A;  2VZA A;  1UE5 A;  1DNY A;  2JA6 H;  1H95 A;  3FRP B;  3QOJ A;  1QVF O;  1K83 B;  3CC7 P;  3HOZ G;  4AIM A;  3HP3 A;  5JVG 3;  4LNQ A;  3ZYY X;  1MKH A;  3CRK C;  2NN6 G;  5FKA C;  1IZ6 A;  3EQL C;  3R2T A;  2NO8 A;  2JA7 G;  4G7Z C;  1VQP A;  1D1K A;  1X55 A;  2EYM A;  2YTY A;  1D7Q A;  5HV8 A;  1JE4 A;  1SYG A;  4R9W A;  1S72 A;  1VQA A;  2Z4H A;  3HOY B;  2VL6 A;  1M6N A;  5F2K A;  4LMQ D;  5ISR A;  5JVH 3;  1AE2 A;  4HMI A;  2VLQ A;  1HNZ Q;  1LT5 D;  4IPH A;  2A73 B;  4X3S A;  3CE7 A;  3J7Y W;  3G6E A;  2F0K A;  4A3K B;  5IP7 G;  2GN5 A;  4AYB G;  1F2M A;  1D1D A;  1X3P A;  1SNP A;  2EYL A;  4IN3 A;  2EFJ A;  4DR7 Q;  1T9H A;  2K75 A;  1HUN A;  5E4W C;  3UDI A;  4IQZ A;  1SE4 A;  1IBM Q;  3MFY A;  1RCV D;  3KLS A;  2K14 A;  4XT1 B;  3LNN A;  2CH4 A;  3M4O B;  4JYA L;  1WCM B;  4QL5 A;  4X64 Q;  4XXE A;  2AVA A;  4QF4 A;  3AEV A;  4EVO A;  1R4Q B;  4RWS C;  1EYG A;  2N6Z A;  2CKZ B;  3S15 B;  1F2Y A;  4JI1 Q;  1B9M A;  2AQ1 B;  2JA8 H;  3FKI H;  5HY6 A;  1QVC A;  3VR3 A;  1KAA A;  1PRT B;  1GUN A;  2J4X A;  5GAE C;  1YHA A;  2OXP A;  1W6K A;  4F88 A;  2A6E D;  1VQK P;  1EWC A;  3GTK B;  4H2Y C;  1ASZ A;  1LLR D;  4AH6 A;  1X54 A;  2EJF C;  1RD9 D;  1HNZ L;  4APV A;  2Y0S E;  1EU3 A;  4IOA A;  5M3M G;  3CPW O;  3RUZ A;  2FJ2 A;  2AWO A;  3VR4 A;  1B2T A;  1PTO D;  3RZD H;  1OXV A;  1D1I A;  4JOI C;  4NXM L;  1JB3 A;  3T1H L;  1G8Z D;  5D3I B;  1K0R A;  2M8P A;  1BCP F;  3K0X A;  5COY A;  2MGS A;  1IBM L;  1ZNV A;  5FJ8 H;  2JA5 G;  2AWN A;  3A7A B;  1O7I A;  2VUM B;  4PZ6 A;  3CCU P;  4KHZ A;  1PXU A;  1IKL A;  1YHB A;  4DPG A;  2X6G A;  4HJ5 A;  3EVQ A;  2WFW A;  4X64 L;  1BBU A;  4C3H B;  4C1N I;  5C3E G;  3P20 A;  1PZI D;  1I6H B;  2JK8 A;  1G91 A;  1JWS D;  1M8A A;  3HKS A;  4JI0 L;  2EHS A;  5IT9 E;  2BE5 D;  1BQQ T;  1MBY A;  2EDG A;  3FMC A;  2XNA C;  2VLP A;  3G1I A;  1CTM A;  3KBG A;  1H9M A;  2KBN A;  4DR5 Q;  3ND9 A;  4YWL A;  2MVU A;  2E2D C;  4B3M Q;  3TP7 A;  4YHH Q;  1Z47 A;  3UDX A;  1Y14 B;  2JGP A;  3BU2 A;  4PXH B;  3DLL A;  1TXY A;  4QUC A;  4DV3 Q;  2WP8 J;  4OON A;  5C4J B;  5CR3 A;  1BCP C;  1TWH B;  2R7Z H;  3G1G A;  1K28 A;  3MZ5 A;  1SLJ A;  2KOL A;  5K36 H;  1LTG D;  2H1E A;  1A8V A;  5BN4 A;  4OHJ A;  1I5F A;  4FF4 A;  3R93 A;  1IYU A;  1BR9 A;  2PMZ E;  3HOX B;  4BY1 H;  5IYD H;  4L5S A;  4ILW A;  2XRS D;  4DUY Q;  1K8A Q;  5AFW A;  1LTI D;  1CK1 A;  4FXD A;  1SNQ A;  4A93 B;  1VQP P;  1RDP D;  3GTG H;  1KTK A;  1SJH D;  1Y1V G;  5EQ0 A;  5JJZ A;  4FF2 A;  4A3G B;  1Q3L A;  4IZ8 A;  1S72 P;  5KP8 B;  4KY5 A;  4DV1 Q;  3H6M A;  2E8G A;  4IJL A;  2XWJ B;  4JV5 L;  4EX5 A;  2Q2T A;  2WB1 B;  1B9N A;  4KJO A;  2PZU A;  3G6E P;  2EY5 A;  1JOK A;  4O42 A;  2A5H A;  1N36 L;  1BBW A;  2KGD A;  2LKI A;  4M0I A;  1TY2 A;  4N9T A;  1X9N A;  1HJP A;  1XWE A;  4IUN A;  4U0C A;  4GLX A;  2Q2H A;  1OXT A;  2WAQ E;  1VKU A;  3W5O A;  2NVQ B;  1PRT C;  1N9W A;  5C0X G;  4ZK9 B;  2K50 A;  3M3Y B;  2KCN A;  3HKZ E;  3TDQ A;  3I4O A;  3SHL A;  1HQR D;  3OYY A;  2Z45 A;  2CWA A;  4ALP A;  2QKI C;  4WJ3 M;  4IJH A;  1JC7 A;  1Q8K A;  3M4P A;  5HGT A;  3S1M H;  1XPR A;  4TKO B;  1VF7 A;  1PYW D;  1EZ6 A;  2NN6 H;  1QUQ B;  2JEB I;  3Q24 A;  4HJA A;  2UU9 Q;  1K3B C;  4Y7N B;  1PDQ A;  4DUY L;  2LMC B;  3N52 A;  1G51 A;  3SK8 A;  1SYD A;  2FHT A;  2JP1 A;  5IWA L;  1GPJ A;  2HQL A;  5GRO A;  3SE0 A;  4WOR A;  1ET9 A;  1JE5 A;  2N55 A;  1YHQ P;  4RCN A;  2NZ1 D;  1HNX L;  3H3V I;  4J1M A;  1PH6 A;  1HRJ A;  5IP7 H;  1PLF A;  1F77 A;  1LAB A;  4ABN A;  5DAU A;  3EJB A;  1JJ2 O;  3A0J A;  5ELN A;  3CD6 A;  2ENB A;  4PG3 A;  1RIP A;  4B3S Q;  1P16 A;  1VQ7 P;  4DF7 A;  3T53 B;  3AFP A;  2KOP A;  3CRL C;  3Q8D A;  2E5L Q;  5D65 A;  3GTL B;  1M90 Q;  3ULP A;  2RHS B;  2R3Z A;  2UUC Q;  5DM7 3;  4IPD A;  1YNJ C;  2ZTE A;  1IBL Q;  1KXL A;  4QNB A;  1O7L A;  3SR1 A;  4L63 B;  1UNK A;  1Y1W G;  1FR2 A;  1XTD A;  1E22 A;  2K5D A;  2BOS A;  2SOB A;  5G3L F;  1TWA B;  4OO1 I;  2LFN A;  2QNW A;  4DAP A;  1HNW Q;  1BBX C;  4JI6 Q;  4FXG C;  1DV5 A;  2UXD L;  4R0M A;  4O0A A;  4IFD G;  4RHR A;  1DGS A;  3X3M A;  2JA6 B;  4BBS G;  4YCU A;  3MXP A;  4ZCK A;  5C3X A;  1MJC A;  3G48 A;  3KF6 B;  4QJF A;  4X66 L;  1YBY A;  4BPH A;  2X69 A;  1NNX A;  2L1B A;  5IOC A;  2H5X A;  1II3 A;  2PEO A;  2B63 G;  2OQ0 A;  1LTS D;  4HAE A;  5IOD A;  4N9P A;  2K0Y A;  3I73 A;  4DAY B;  1HQM C;  2JA5 H;  2B8G A;  3QWN A;  5JPA A;  4MNO A;  1TS2 A;  1SRU A;  3TRZ A;  4UPA A;  2MF4 A;  1BCP D;  1VQ9 P;  3PQI A;  1OXS C;  5F2N A;  1L0I A;  5C3E H;  4IUV A;  1KAB A;  3D0F A;  5IGC A;  4JBW A;  1HR0 L;  3CCM A;  5CV7 A;  2XZ0 D;  2ALY B;  3ND8 A;  1IL2 A;  1EY0 A;  3P05 A;  5M5Y H;  5LMN L;  1EIY B;  1HZ9 A;  5EW5 E;  2O5I C;  5A2Q L;  2MO0 A;  1YNN C;  2RCN A;  3NUC A;  4IO9 A;  1B7Y B;  3H0D A;  2GZG A;  4DNR B;  2Z44 A;  3Q22 A;  1G6Z A;  3DXJ C;  2I0Q A;  2N49 A;  2JYO A;  1VQ6 A;  4XFZ A;  4FYD A;  2B8F A;  2FMM A;  4JI8 Q;  2TSS A;  1OXX K;  3CP0 A;  1KC8 C;  1O80 A;  3FKI B;  1F9S A;  2KOD A;  1YI2 P;  1UAP A;  4OL7 A;  5FLM G;  3E0J A;  1N32 Q;  4LUZ A;  4LF6 L;  2HUG A;  3TSS A;  4A3I G;  1QZG A;  3VA7 A;  4IUU A;  5HGN A;  4B08 A;  4M8A A;  2AFD A;  1JIC A;  2HCI A;  2GVA A;  1MIU A;  3PIP 3;  4HMJ A;  2PI2 E;  3GTQ H;  3RG6 C;  2PEI A;  4LFC Q;  2E2H H;  4DV7 L;  1A3V A;  1BAJ A;  4LF5 Q;  3L2P A;  2QDL A;  4K5X A;  4LF4 Q;  2CGQ A;  4C2M H;  3CD6 P;  4BY7 H;  4JI2 Q;  1SMY C;  3ULJ A;  2N3S A;  1UE6 A;  4NW2 A;  2RDF A;  4XQN A;  3PGZ A;  2DUD A;  1GKH A;  1LUZ A;  4IUR A;  4PV1 C;  4OWX B;  4JI7 Q;  1GUO A;  5C0X H;  3NPP A;  2CQO A;  3FPP A;  1NMG A;  1S4Z A;  2NTS A;  1SRO A;  5BR8 Q;  3TZU A;  5HGL A;  1BKB A;  1W2B A;  3SK4 A;  4DK1 A;  2A6H C;  2J0T D;  3NTK A;  1EEI D;  3FDT A;  5JEA H;  1CM9 A;  1EFI D;  3HG9 A;  2QF7 A;  4DUZ L;  3F2U A;  1E6J P;  4K5V A;  2CNR A;  2K7V A;  1VF5 C;  1X6O A;  3T1Y Q;  3HZX A;  4RKL A;  3MXN A;  2MJ8 A;  3UDG A;  4HN7 A;  1CA5 A;  1B3Q A;  2F3W A;  1L0X B;  4A3L G;  1B70 B;  3NBH A;  5BS2 A;  2UUA L;  1B8A A;  3K6O A;  4IPG A;  3S2D H;  4B3R L;  3DWA A;  1RL2 A;  4BY1 B;  2GVB A;  1Z7T A;  2F0M A;  1VQC A;  2P5Z X;  3A55 A;  4R4I A;  3S2H H;  4CJ1 B;  2SNM A;  4KTA A;  5JEA J;  3V96 A;  1WTP A;  1IUQ A;  2BDN A;  3G0V A;  1U4R A;  3GTG B;  4NKL A;  2QA4 A;  3ERQ A;  1EOV A;  1K73 Q;  2GDX A;  4HSV A;  1WFQ A;  2PPB C;  1X3E A;  1BXT A;  2RHQ B;  1H9S B;  2EOT A;  4JI7 L;  1XPU A;  1EQQ A;  1TVX A;  5J1Z A;  4DAM A;  3I90 A;  4X3K A;  1I4P A;  2ICI A;  2NB0 A;  5L37 A;  4A3F H;  3DWP A;  3K7A H;  3SXH A;  2Y0S G;  2IHF A;  1TWC H;  3RR5 A;  1Y1W H;  3DEO A;  1JWU D;  2K03 A;  4NP5 A;  3CCM P;  4R4C A;  1EYC A;  2KGA A;  3VYR A;  3C2P A;  1A43 A;  4Q0F A;  4CJ2 C;  2VNU D;  2IX1 A;  2L5T A;  5E4X A;  4LFB Q;  1H9K A;  3NTH A;  3T1Y L;  5DLQ E;  3D6C A;  1XPO A;  2F52 A;  1N34 Q;  2IY5 B;  4RGN A;  5AJ3 L;  5E1F A;  2K6A A;  4IFD H;  3KBX A;  2EY1 A;  3TQY A;  5G3L D;  2LTE A;  1PTO F;  1FGB D;  3SK5 A;  2R92 G;  1NBW A;  4PH0 A;  3PIO 3;  1CKO A;  4R8I A;  1FNU A;  3S1M B;  4GKK Q;  1VQ6 P;  4V0B A;  4A3B G;  3CKI B;  2RSN A;  1JR0 D;  1S5D D;  4DGZ A;  2AMC B;  3I4N H;  3D4D A;  3STB C;  1GUS A;  3J81 j;  1N33 Q;  3CCS A;  2PQA B;  4ZQ3 A;  2HT1 A;  2IPK D;  1S5B D;  4HJ9 A;  1IBK L;  1ASY A;  1ZMB A;  2L9F A;  3K5N A;  4ME5 A;  1EQV A;  5CC4 A;  4YWK A;  3GTP B;  1VCI A;  3U9O A;  3J80 E;  4AYB B;  2AF8 A;  4K14 A;  3TRE A;  5CV4 A;  3I4M G;  4OX9 Q;  1JOO A;  1F80 D;  3NHH A;  2B2W C;  2DN8 A;  4U0D A;  1M1K Q;  3I7F A;  4R8N A;  2F3I A;  1MI2 A;  2JAZ A;  3CCE A;  2E2J H;  1U5K A;  1VQO A;  2L6E A;  1HUM A;  3BDL A;  3I56 A;  4KHV A;  1CZW A;  2ZXR A;  4LF7 Q;  2OQK A;  4NEO A;  4OGQ C;  2B2U A;  3H0G G;  3WOF A;  2IL8 A;  4X65 Q;  3C1E A;  2EY2 A;  4B9X A;  4IZ6 A;  2N8N A;  2UXC Q;  2VLO A;  1DOK A;  3I8Z A;  3CXC O;  1VQL P;  3DS1 A;  1IL8 A;  4A3M B;  3HOV H;  4BA2 I;  4K0K Q;  2CW0 C;  3GTJ B;  5FO9 B;  1DZ1 A;  2BA0 A;  1QRJ A;  5FLM H;  2K01 A;  1J6Q A;  4X62 L;  2MR7 A;  4F37 A;  2VB2 X;  3EA6 A;  1SBB B;  4PMC A;  1N33 L;  3TP5 A;  2WB1 E;  3TBI B;  4LW1 A;  2FVE A;  4OIK A;  1WJJ A;  1I50 H;  2LSS A;  3GO5 A;  4RHS A;  1HTP A;  4L5T A;  1J8I A;  4DNI A;  2KJX A;  1EFW A;  4DV4 Q;  1ICW A;  3PO3 B;  2F0W A;  3KUP A;  3S9W A;  3CAM A;  3M4Y A;  4B9W A;  4POG A;  2D62 A;  2WAQ G;  2L4N A;  5KP7 B;  4A3C G;  4IPC A;  7CEI A;  1I94 Q;  1C8C A;  1PZK D;  2WPT A;  3HKZ G;  5E3F A;  4A3D B;  3EJD A;  3OTO L;  5M3F H;  1JQY D;  1TKW B;  2ZXO A;  1MGS A;  1K8O A;  2LXK A;  2CQA A;  3M7G A;  3OWE B;  2KUM A;  4LF9 Q;  2SEB D;  4C3J B;  2QA4 P;  1Q8I A;  3A7L A;  1CT1 D;  2N5I A;  3B4Q A;  1ET6 A;  2BA1 A;  2NN6 I;  4HTH A;  5C3E B;  4BPF A;  2M8N A;  2KEC A;  5KIX A;  1NR4 A;  2PEK A;  1QCB D;  3M7N A;  2JEA I;  4ZUI A;  2VQE Q;  4FXK C;  1CSP A;  3IKJ A;  4A4I A;  1WTQ A;  5M5Y B;  1FJG Q;  1GXD C;  3L0O A;  1JOQ A;  1MZ8 A;  3VR5 A;  1QWY A;  5CMD A;  3DTJ A;  4JI3 L;  2ZXP A;  1ZKO A;  4Y52 H;  1SAP A;  5TSS A;  1PH2 A;  1LTL A;  3RG2 A;  1K8M A;  2R93 G;  2NTT A;  2L9H A;  3U4Z A;  2QDB A;  1O7Y A;  3J81 c;  2FHS C;  1SFO B;  1VQ8 A;  4A3L H;  2RKS A;  3CU7 A;  4A75 A;  3SVM A;  1E1T A;  2DJG C;  5I2X A;  2JXM B;  3OHX C;  1V43 A;  4RCO A;  3I91 A;  3TZD A;  1NTG A;  3GTM H;  3AFQ A;  1VQH A;  3BS1 A;  4DV6 Q;  1TWF H;  3MXN B;  3GTQ B;  1A3T A;  4PZ7 A;  4JC0 A;  4H2W C;  2E2H B;  5KND A;  1ZYR C;  4RG1 A;  5M5W B;  4LUO A;  2ZJP A;  5KRU A;  1NMF A;  3WBH A;  1ROD A;  1ILQ A;  2F0P A;  1D6E C;  4ULL A;  2NYZ D;  4KY7 A;  3TME A;  2EJM A;  3A74 A;  5HUR A;  1XNR Q;  2K94 A;  2MFI A;  4IUT A;  2EY6 A;  4BY7 B;  3CMA A;  1H9J A;  2NUC A;  5FLX L;  3JAM c;  1I3Q B;  1KQS A;  3NSW A;  1EY8 A;  2M2L A;  4WFN 3;  5F2O A;  4YCV A;  1K9M Q;  3CCE P;  3BZD B;  1VQO P;  4A3J G;  1JB7 A;  4DNT B;  1K73 C;  1VQ4 A;  2PNH A;  1R9T H;  4Z9C B;  2K4K A;  2VXW A;  1HH2 P;  2ZTC A;  1E7Z A;  2R92 H;  1HY8 A;  2R7F A;  5EJD A;  3PO2 G;  1CUK A;  2GZJ A;  4OXP A;  4A3B H;  1NSN S;  1AH9 A;  5HGO A;  1K0S A;  2F0U A;  4RH6 A;  4DV5 Q;  3CC4 A;  3G71 P;  1VQM A;  2I5M X;  3CC2 P;  1AUM A;  1SMX A;  4DR7 L;  1A0I A;  5GAH C;  2K93 A;  4JK1 C;  2O2L D;  1LTA D;  3K8A A;  2F0E A;  3DS2 A;  1XNQ Q;  3M1M A;  4JBJ A;  4GS3 A;  3U58 A;  1F2Z A;  2RA4 A;  1YVC A;  3S2H B;  3I4M H;  4PMW A;  5JJI A;  4GNX B;  4R4O A;  1CKN A;  1DJR D;  4JI5 Q;  1KC8 Q;  1V1P A;  1GO3 E;  3HOW G;  1KL9 A;  1HHV A;  3OW2 A;  2NVX B;  5C5M A;  4F7X A;  4TQU S;  4CDE C;  2XXM A;  1L1O A;  1PH7 A;  2PY8 A;  1FNW A;  4JI1 L;  3ONA B;  2R7D A;  1OTC A;  1WD0 A;  2YU9 B;  1TS3 A;  4A3F B;  1ENC A;  2LL8 A;  4WYM A;  1VQE A;  1LO5 D;  1TWC B;  1Q12 A;  2M9V A;  4GLA C;  4J8Q A;  3PV0 A;  5CBA E;  2J7Z A;  4K6D A;  2KGC A;  1N8R Q;  5KEE A;  4BS9 A;  1TT2 A;  4OWW B;  2JYG A;  1L0H A;  1CHP D;  3K5O A;  1Z6M A;  1PTO H;  4DV5 L;  2EYP A;  4LK1 C;  5A35 A;  1U9R A;  1M1K C;  3LRY A;  4ZAI A;  3VYT A;  1VMP A;  2ZJQ A;  2K5W A;  1I4H A;  2V4D A;  5JOB A;  1YEZ A;  1ENF A;  3OIQ A;  3HZQ A;  1PRT F;  3GTO H;  3WOE A;  1XNQ L;  1A2T A;  2B29 A;  2JJQ A;  2YTX A;  4XQQ A;  3DHQ A;  3GZL A;  2EXD A;  1VQ8 P;  1EWH A;  2Z6K C;  2L15 A;  1DOL A;  1NAP A;  3I4N B;  1QVG A;  4A3C H;  4X6A H;  1JJG A;  1BNZ A;  5EPK A;  4UP9 A;  3K58 A;  5C0X I;  3MWY W;  5J39 A;  3HOY G;  5I9O A;  3RNU A;  2Z1C A;  5C4X H;  3AQQ A;  4NMZ A;  3WDN A;  3GD7 A;  3QR8 A;  1A3U A;  4H0L C;  3D8G A;  2C35 B;  3J81 i;  2KQ3 A;  4GOP B;  3U50 C;  1AE3 A;  3MTS A;  4DR5 L;  1EMV A;  3QIA A;  4A3K G;  4B3M L;  4QIW B;  4HCE A;  4MRT C;  4YHH L;  2RDG A;  4BBR G;  4DV3 L;  1SYC A;  5E7N A;  3NXW A;  4A76 A;  5CBE E;  2IWH A;  4GN5 A;  2PW7 A;  1IXR A;  2E2J B;  5C4H A;  2RDH A;  1AW7 A;  2XSC A;  3DPH A;  3KYH C;  4PMB A;  1WCM G;  5J22 A;  3CMA P;  1KRT A;  2IX3 A;  2MY5 A;  4DR1 Q;  3HOZ H;  1L2F A;  1GXG A;  3KJO A;  3CCR A;  3NK9 A;  2PEQ A;  3GKL C;  2ZTD A;  4HCS A;  2JA7 H;  3HOV B;  2F4V Q;  3NQI A;  1ZYR D;  2K5Q A;  2DNC A;  4A3E B;  2MPM A;  3LWE A;  2M8L A;  4RMF A;  3JAM i;  2C5C A;  4QQB X;  3CCL A;  1EEF D;  4DV1 L;  2I5L X;  2EPB A;  1MHW C;  3CHB D;  4TSS A;  4HR7 B;  2BUO A;  3MEF A;  4I65 A;  3E5S A;  3PUY A;  4GLV B;  3TN2 A;  1VQI A;  1HA6 A;  3CC4 P;  2EYF A;  2DJF C;  1JOR A;  5GQO A;  2R6G A;  1F2L A;  4C3I B;  2AUK A;  4LF8 Q;  2KGE A;  1PZJ D;  2KHI A;  1MD2 D;  1NR2 A;  2B2V C;  3DM1 A;  3NTE A;  1EUJ A;  4HIO A;  1STE A;  3I3C A;  4DXF A;  1G2T A;  5IYB G;  4DV2 Q;  5M3F B;  3H3V C;  3MA2 B;  1EQR A;  4IFD I;  2VUM G;  1E2Z A;  4N8F A;  2WV6 D;  2ROQ A;  2MNA A;  2X6L A;  2PEM A;  1I4R A;  1XX8 A;  2JN4 A;  2K04 A;  3FP9 A;  3OSO A;  4ZKC B;  2QGQ A;  4RGT A;  2AHO B;  4FP5 D;  4C3H G;  3MFG A;  3OW7 A;  1YJW A;  2UU9 L;  3QO2 A;  4UHV A;  4HKG A;  2KCT A;  1EIF A;  3B5I A;  2EYH A;  1SN8 A;  1G29 1;  2B3G A;  3HOU B;  4JPB W;  2MVV A;  1BDO A;  1DD2 A;  1WTR A;  2GA4 B;  2M00 A;  1JWM D;  3H09 A;  2RCF A;  2XWB B;  4DR4 Q;  3PO2 H;  2XVS A;  4CGY B;  2GDY A;  1MJE A;  2LY7 A;  4AYB E;  2UXB Q;  2FAD A;  5M3M H;  1IKM A;  5BN5 A;  1SNO A;  2F0I A;  1TS4 A;  2KOR A;  2KOQ A;  5IT9 L;  4BXX G;  5IY0 A;  3DS4 A;  2EVB A;  5I6Y A;  4ME3 A;  4XIG S;  4YCW A;  4B3S L;  1K9M C;  3M9B A;  2E1M A;  4L6T B;  4PQX A;  4R4T A;  1FVI A;  1QJO A;  4GOP C;  3HOX G;  3U9S A;  4JBM A;  2E5L L;  2G9D A;  1EOT A;  2CG5 B;  2CWO A;  2XTI A;  4DV2 L;  1A15 A;  3AU7 A;  1SNM A;  3SGI A;  2HIV A;  5M5X H;  3GJN A;  3K0Y A;  5IYC G;  2UUC L;  2FVA A;  2Z8L A;  4A93 G;  2OWO A;  4MHE A;  4DR2 Q;  1IBL L;  3HOW H;  4A3G G;  5LL6 S;  2I5H A;  3SEB A;  1LTB D;  1VS0 A;  4DAV A;  1C7Y A;  1K30 A;  5FLX c;  3MXG A;  2PNG A;  2WB1 G;  2RF4 A;  4UP8 A;  5NUC A;  1LTR D;  1YJN A;  1KDB A;  4DR6 Q;  4COP A;  3RN2 A;  1HNW L;  2ES2 A;  3MC0 B;  1VQ5 A;  2NVT H;  2E2I H;  3HEJ A;  4JI6 L;  2K52 A;  4P74 A;  3BYY B;  3K5M A;  1QVF A;  3F2D A;  2NZO A;  1PV4 A;  2XZ1 C;  1DCZ A;  1E1O A;  1TWG H;  5EKL A;  4KHP Q;  1EIH A;  3NE5 B;  1L1O B;  2JA8 B;  3K80 C;  3ITP A;  2M5R A;  3A8J E;  3F2C A;  1HPC A;  3C1F A;  3X3N A;  1R9T B;  2B39 A;  4ZRZ A;  3FEW X;  3CCR P;  1GVP A;  4PZ8 A;  2R92 B;  3A8K E;  1V1O A;  2X2B A;  5DM6 3;  2Q8R E;  3VYU A;  2XN9 C;  2LPK A;  5ELB A;  3CCQ A;  1PYS B;  3G26 A;  1QIL A;  2L12 A;  3KDF A;  1Y1V H;  4FF1 A;  2EHT A;  2N5H A;  4LWC A;  3HRZ C;  3IL8 A;  3DS0 A;  1L0Y B;  3I70 A;  3LMO A;  3MAQ A;  1MSG A;  1PRT D;  3RZD B;  4DN4 M;  3T56 B;  5IE8 A;  1N8R C;  1EZ8 A;  4JOI A;  4IOC A;  4LJZ C;  3G7L A;  3NEN A;  1ML0 D;  4DV0 Q;  2LIU A;  1Q81 Q;  3S1Q H;  1B1Z A;  3E3X A;  1O78 A;  4A3K H;  4P75 A;  5FOB B;  5FO8 B;  1BXI A;  1KIX A;  4NDX A;  2L0Q A;  2PI2 A;  4EQO A;  1STN A;  1OO9 B;  4BBR H;  5K5P A;  4MTK A;  5T1I A;  2WAC A;  2BH2 A;  2LF4 A;  1XMO Q;  1PH9 A;  1F9Q A;  3LX0 A;  2ZM6 Q;  4JI8 L;  2L22 A;  4S3S A;  5CV8 A;  1UE1 A;  5F2D A;  1EOQ A;  1RNI A;  2KHJ A;  5EPL A;  1SYB A;  2CH4 W;  3K7U C;  3P75 A;  3GQB A;  1Y8O B;  1N32 L;  3PF5 A;  2WII B;  1BVS A;  1FD7 D;  3C3L A;  4RKB A;  1YJW P;  2L0C A;  1ENA A;  1SDF A;  2G5D A;  2R7Z B;  5IGD A;  1RJT A;  1ONL A;  5IGB A;  3BVG A;  1DXM A;  2A1A A;  3CPW A;  1ZEQ X;  1Q1E A;  4BPG A;  4V19 0;  4LFC L;  4NB3 A;  3PUV A;  2YV5 A;  5HGM A;  5EAY A;  5KYI A;  5C0X J;  4LF5 L;  1YNJ D;  3GTK H;  1WI5 A;  2K92 A;  2JA6 G;  4LF4 L;  1J9O A;  3NP8 A;  4LUV A;  3PUW A;  4ZLT F;  4DV0 L;  1A8O A;  4YY3 Q;  1D5M C;  5C5L A;  4QCL A;  2CHB D;  3G21 A;  2BH8 A;  5EJW A;  3WWV A;  3PIP A;  1B3A A;  4JI2 L;  4KD3 A;  2HHH Q;  1Z6H A;  4JBK A;  1WTO A;  4FF3 A;  1STY A;  2VQF Q;  1IYJ B;  1Q1B A;  5IYB H;  2NBF A;  2AQ3 B;  5C4X B;  1XMO L;  2B2T C;  2VUM H;  4ZKB B;  3H91 A;  5JJL A;  4C1N K;  5BR8 L;  1QZH A;  1AN8 A;  2KCC A;  1VDZ A;  3CQZ H;  4GR2 A;  1I6H H;  3G6J B;  4B3T Q;  2KR5 A;  2PEN A;  4E6I A;  5ELD A;  2F03 A;  3RZO H;  1UEB A;  5EGT A;  2RVL A;  4HIK A;  1X3G A;  1YJN P;  2VSQ A;  2WIN B;  3T13 A;  1RTN A;  2MR8 A;  4F8M A;  5KNC A;  4BBS H;  4JI4 Q;  2BHV A;  4L8J A;  1U4L A;  3HOZ B;  4FO2 A;  5C4J H;  2CVR A;  4DFA A;  3CC7 A;  1TWH H;  2JA7 B;  1U0L A;  4BXX H;  4DA2 A;  3S1N H;  2B63 H;  1J5E Q;  3E6Z X;  1SXT A;  2ZJR A;  2IJ0 A;  3KOJ A;  1GM5 A;  1VQN A;  3VR6 A;  1YNN D;  2KG6 A;  1X65 A;  3HOX H;  1E24 A;  3Q20 A;  5IIF A;  2DGY A;  1NCV A;  1X56 A;  4JCV E;  1OR5 A;  2AQ2 B;  5IYC H;  4IFD J;  3DMU A;  2GZE A;  1STH A;  3F1Z A;  4A93 H;  1NE3 A;  4A3G H;  4U0E A;  4PNY A;  2HCC A;  1WTW A;  2KA7 A;  4XTC S;  3OMC A;  1WD1 A;  1VQJ A;  4UHP B;  1SND A;  4NXN Q;  1WTX A;  4CKE A;  5DCK A;  2G9H D;  1HTL D;  2GYK A;  1YIT A;  4KN4 C;  4LFB L;  2A6E C;  4IUP A;  1N34 L;  4XFY A;  2D0P A;  1K8G A;  1X3F A;  5DNF A;  2A8V A;  4U0A A;  4OWT B;  4I7Z C;  4U0F A;  3P1H A;  1IMQ A;  5GAG C;  1XMQ Q;  1Q82 Q;  3I2Z A;  2FAC A;  1M6E X;  1HZB A;  3EJE A;  1SYE A;  2Z6B A;  5EBD A;  4GKK L;  3SK6 A;  4EQN A;  4KKU A;  2NVQ H;  3P7J A;  4FNF A;  2B2Y C;  4XDX A;  1RF2 D;  5IT9 c;  1U4P A;  2AFE A;  3QG1 A;  1DOM A;  4A3I H;  3EFX D;  1LT4 D;  2NVY H;  1AF8 A;  1UNS A;  3Q23 A;  1SMY D;  5IGE A;  3KK7 A;  1K3R A;  3PIO A;  4EQ5 A;  5M3M B;  1SEB D;  4KN7 C;  4QIW E;  1E0B A;  5HVC A;  1LM0 A;  3GDE A;  1XXG A;  1JJ2 A;  2MD9 A;  2OEO A;  1QOH A;  2BE5 C;  4F87 A;  4OX9 L;  1GHK A;  2EJG C;  2JA5 B;  1CSQ A;  4RAU C;  4XT3 B;  2A6H D;  3EN2 A;  1GXH A;  3NQT A;  2JB0 A;  5KP6 B;  3G29 A;  5BN3 A;  4BY1 G;  1Q7Y C;  5IYD G;  5C44 G;  2PZW A;  1Q90 A;  4LF7 L;  1JJC B;  4X65 L;  3D31 A;  1YZ6 A;  3HOW B;  2L11 A;  2UXC L;  2DNW A;  2IX0 A;  1VMC A;  3L9A X;  1PYB A;  1PHJ A;  1PA6 A;  4K0K L;  3TP6 A;  2EYO A;  5EPJ A;  5FK9 C;  4CJ0 B;  1FYC A;  2E2I B;  1QNK A;  2WKC A;  3DUZ A;  1VHN A;  1HA5 A;  1Q81 C;  4YIJ A;  1CI3 M;  1PFB A;  2PNR C;  1QUQ A;  2P9X A;  1U4M A;  3D4W A;  4HID A;  1C4Q A;  3F8T A;  3F2B A;  1EY9 A;  1TWA H;  3NEM A;  1TWG B;  4DV4 L;  1E3P A;  3CME A;  2OTL A;  4JYA Q;  3OWF A;  2CWP A;  3MXU A;  1MSH A;  1W3S A;  1I94 L;  1KAW A;  1SE3 A;  4RGM A;  1CZG A;  2DY7 A;  1LAC A;  2LOL A;  2FMC A;  4XFX A;  5I2Y A;  4WJ4 A;  2KHS A;  4LF9 L;  2EIF A;  1Y1V B;  3CCV A;  3CCS P;  1IYV A;  4QMG A;  1BCP B;  2GZF A;  3PUX A;  1VQN P;  1I6V C;  1RO2 A;  1VQG A;  3NBH B;  2UUB Q;  1P8L A;  2PCF B;  2ERH A;  3D4R A;  3QB3 A;  4DKA C;  1I4Q A;  3NY7 B;  2VQE L;  4MIU A;  3L7Z C;  4COC A;  1FJG L;  3S1Q B;  2AKW B;  4ZYS A;  4C2M B;  5JPM C;  4NXM Q;  1ACP A;  3T1H Q;  1XTC D;  3A54 A;  3STB D;  1VQD A;  3L3O C;  4BBR B;  4GZY C;  1AEX A;  2N50 A;  1H9R A;  1YIT P;  1ICF B;  2YTV A;  3I56 P;  2XGT A;  5EKK A;  2GZI A;  1WTH A;  4G7O C;  3KJP A;  3G28 A;  1HZA A;  3S14 H;  2F1M A;  1JCK B;  4ID6 A;  3RLO A;  3EIV A;  3ULL A;  2D2C C;  5KYL A;  3J80 L;  3J7A V;  3ER0 A;  1HCZ A;  1R4P B;  2RQX A;  3TP8 A;  4LAA A;  4POF A;  3KF6 A;  4JI0 Q;  2LML A;  2JYL A;  1BUV T;  4H7B A;  4A3M G;  3MVV A;  4K2K A;  4UDU C;  3H47 A;  4DV6 L;  3TS2 A;  4OEL B;  3HYB A;  1W2B O;  2PQE A;  3H94 A;  4ODG A;  2K5N A;  5BS1 A;  4DAY A;  2UUB L;  4UY8 C;  3S2D B;  3JC6 6;  4QKO A;  1VQB A;  2C9O A;  4X3T A;  4EQP A;  1YHQ A;  2OAR A;  1O7Z A;  1STG A;  2O4X A;  1S5F D;  2Z4I A;  2V1C C;  3PO3 G;  4IPY A;  1T8K A;  2CW0 D;  3W3A A;  1XNR L;  3TEH B;  1GHJ A;  1SE2 A;  5GAD C;  1VQ7 A;  2FFK B;  2HD3 A;  2K5X A;  1Y69 U;  1W6J A;  4A3D G;  3BDC A;  3NEL A;  2F0V A;  2KED A;  2O5J C;  3DS5 A;  2QCP X;  3H0G H;  1YIJ A;  4YWM A;  2B2T A;  1PMR A;  3HGB A;  4C3J G;  3K7A B;  2A68 C;  5FO7 B;  2EXZ A;  5CV5 A;  1Y1W B;  1KDA A;  4DR3 Q;  1KLU D;  1YJ9 A;  3CQZ B;  1GUG A;  1QG7 A;  1D5Z C;  4K2L A;  1S5E D;  1NJI Q;  4JV5 Q;  5C4Z A;  3D6W A;  3R8B A;  1RKN A;  4KJN A;  3RZO B;  2IHE A;  4WJW A;  2BDO A;  1DM0 B;  3J7A 5;  1N36 Q;  5LMU Q;  4BBS B;  4RA8 A;  1TS5 A;  2ICE C;  3BJU A;  1QE6 A;  3E0E A;  1STA A;  2F0D A;  4U68 A;  3EBE A;  3Q6S A;  3CME P;  3G4S A;  2OTL P;  3S1N B;  1TY0 A;  2B63 B;  4M1U B;  4CKC A;  3M4Q A;  4JI5 L;  1Q82 C;  2K33 A;  1JT8 A;  3VR2 A;  5KGU A;  5CV9 A;  1HZC A;  3Q0A A;  3D3R A;  5A2Q E;  5C44 H;  1UEA B;  2K28 A;  5ELF A;  3CCV P;  2F0F A;  1KLG D;  1LTT D;  4KI0 A;  3CPF A;  4H13 C;  3A56 A;  1KD1 Q;  2Q2U A;  2D9U A;  3S17 H;  2ID0 A;  5IWA Q;  1WTV A;  2XV6 A;  1NY4 A;  4K8J A;  4HJ7 A;  1VQ9 A;  4DR3 L;  4G57 A;  2PW5 A;  1PH5 A;  1HQB A;  1ILP A;  2A69 C;  1HNX Q;  1TU2 B;  4XQJ A;  3M85 A;  1C9O A;  2JU1 A;  2B2W A;  3E2D A;  3N6R A;  2ATW A;  2KG8 A;  5I4D A;  2L55 A;  2WKD A;  1DYQ A;  4HIM A;  2MP1 A;  3PSI A;  1WVL A;  1SSO A;  2HIX A;  2K05 A;  5LMU L;  2R93 H;  4BY7 G;  5LHY 1;  3J81 E;  1X32 A;  4LFA Q;  4XYQ A;  2QIL A;  4JVZ A;  2EQS A;  4IAL A;  1VQ4 P;  1D2B A;  3K59 A;  1QB5 D;  1KDC A;  4ZUJ A;  1C0A A;  5IP9 G;  2VS1 A;  2B2Y A;  3BG3 A;  2OCE A;  4A3I B;  5I4T G;  1YI2 A;  2NVY B;  3IFT A;  4P2C B;  1S3O A;  4CDD C;  3KLR A;  1I50 B;  3A5Z B;  5JEA G;  4KMU C;  2Z0S A;  4GNX C;  4N8X 1;  5ELO A;  4MZ9 A;  1VQM P;  2OT2 A;  3AMU A; 
#chains in the Genus database with same CATH homology
 2UXD Q;  1V9P A;  2OTJ A;  1M74 A;  3GTP H;  4JG2 A;  4X66 Q;  3AYH B;  3HFZ B;  3VRL C;  3H4E A;  4DK6 C;  4DR1 L;  3S1R H;  3CXC A;  4A3J H;  4LFA L;  2F4V L;  1YIJ P;  2LXJ A;  4J15 A;  2VY3 A;  4KLK A;  1KRS A;  3RLN A;  4A3F G;  3S16 H;  1YJ9 P;  1HR0 Q;  3CF5 A;  4A3M H;  2K5H A;  5LMN Q;  3GTJ H;  2EG5 A;  2KCM A;  2PQA A;  4HJ8 A;  3TS0 A;  4LF8 L;  4XRQ A;  3ZJY C;  4L5R C;  3PO3 H;  3G4S P;  1JMC A;  2K5V A;  3I4N G;  4LF6 Q;  4OO1 G;  3U4V A;  2ASB A;  3BZK A;  4A3D H;  1Z9F A;  2N78 A;  4UP7 A;  4C3J H;  3CCJ A;  1S40 A;  3I55 A;  4DV7 Q;  1CKN B;  1EWI A;  4DR4 L;  3J80 c;  2UXB L;  4U0B A;  4MTN A;  1Q7Y Q;  2CFM A;  2MQH A;  1K83 H;  1KQS O;  4GN4 B;  1PH8 A;  3RLF A;  1L0W A;  1A62 A;  3HOV G;  1SFO H;  4A3E G;  3PCO B;  3CCL P;  4DR2 L;  1NJI C;  3HOY H;  3BZC A;  3LGJ A;  4DUZ Q;  3E9I A;  4DR6 L;  1Q86 Q;  2KEN A;  5H1S E;  2UUA Q;  4PH1 A;  2VW9 A;  2OTJ P;  5M5W H;  4B3R Q;  5J3B A;  4L5Q A;  3PF4 A;  4KHP L;  5M3F G;  1PH1 A;  3M4O H;  1PH3 A;  4QY7 A;  1WCM H;  2CCZ A;  4NPS A;  3W1G A;  3ERS X;  1I3Q H;  1KHI A;  2JO0 A;  3J7Z C;  1K8A C;  3S15 H;  3OW2 O;  1VQL A;  4P73 A;  3IRB A;  1KD1 C;  5IP9 H;  3S24 A;  1UWV A;  3HOU G;  5HGQ A;  2YYZ A;  4R4Q A;  1WYD A;  2QEX A;  2XT1 A;  3DS3 A;  4R1J A;  4QGU A;  2FXQ A;  3B6Y A;  4FDB A;  2Z6K A;  5AJ3 Q;  4H02 A;  1FGU A;  3A5U A;  2Q2I A;  1PVO A;  1A63 A;  3UE0 A;  3ICE A;  2ZM6 L;  1LYL A;  5JJK A;  2D0O A;  1QVG O;  1D8L A;  1XJV A;  4C3H H;  1IBK Q;  1L1O C;  2NVX H;  1SR3 A;  3W1B A;  2NZH A;  3CCJ P;  1VQ5 P;  2YU9 H;  3H3V H;  3I55 P;  4BA1 I;  1VQF A;  3E9H A;  2JE6 I;  4AQY Q;  1UE7 A;  4YY3 L;  1Q46 A;  2JA8 G;  2A19 A;  3FKI G;  4DK3 C;  4P72 A;  2HHH L;  3J80 i;  3RN5 A;  1V1Q A;  2VQF L;  3CCQ P;  3DM3 A;  1M90 C;  4GNX A;  1CKM A;  2Z46 A;  4GKJ Q;  4X62 Q;  3KF8 B;  1HR0 W;  2PEJ A;  4B3T L;  3PUZ A;  3FHW A;  5LMN W;  5FJ8 G;  3KFU A;  3VDY A;  2EIA A;  4TVA B;  3UDF A;  4JI4 L;  1SE8 A;  3OTO Q;  4AQY L;  4P71 A;  3KLW A;  1RO0 A;  3M3Y H;  3K81 C;  1J5E L;  1VQK A;  1PH4 A;  1OXU A;  1EIA A;  1GD7 A;  4Y7N H;  2R7Z G;  3UE1 A;  4A3E H;  1YNX A;  3G71 A;  4GKJ L;  4GN3 B;  2QEX P;  4JI3 Q;  5K36 G;  2ONT A;  3CC2 A;  4O2D A;  4NXN L;  1FL0 A;  2JA9 A;  1PFS A;  4GOP A;  2JQO A;  3CCU A;  3KDF B;  4C3I H;  3H15 A;  1G6P A;  2IT1 A;  3MGE A;  1XMQ L;  3GTL H;  4GR6 A;  5C4X G;  4XRO A;  3CW2 C;  2MO1 A;  1WOC A;  1Q86 C;  3HOU H;  2VZA A;  1UE5 A;  2JA6 H;  1H95 A;  1QVF O;  3CC7 P;  3HOZ G;  4AIM A;  4LNQ A;  1MKH A;  2NN6 G;  1IZ6 A;  2JA7 G;  1VQP A;  1X55 A;  2YTY A;  1D7Q A;  1S72 A;  1VQA A;  2VL6 A;  1M6N A;  5F2K A;  1AE2 A;  1HNZ Q;  4IPH A;  3G6E A;  5IP7 G;  2GN5 A;  4AYB G;  1D1D A;  2EFJ A;  4DR7 Q;  1T9H A;  2K75 A;  3UDI A;  1IBM Q;  2K14 A;  4JYA L;  4QL5 A;  4X64 Q;  3AEV A;  1EYG A;  2CKZ B;  4JI1 Q;  2JA8 H;  3FKI H;  5HY6 A;  1QVC A;  5GAE C;  1YHA A;  1VQK P;  1ASZ A;  4AH6 A;  1X54 A;  1HNZ L;  4APV A;  2Y0S E;  4IOA A;  5M3M G;  3CPW O;  2AWO A;  3RZD H;  1OXV A;  4JOI C;  4NXM L;  3T1H L;  1K0R A;  2M8P A;  3K0X A;  1IBM L;  5FJ8 H;  2JA5 G;  2AWN A;  1O7I A;  4PZ6 A;  3CCU P;  4KHZ A;  1YHB A;  4DPG A;  4HJ5 A;  2WFW A;  4X64 L;  1BBU A;  5C3E G;  2JK8 A;  3HKS A;  4JI0 L;  3G1I A;  2KBN A;  4DR5 Q;  4YWL A;  4B3M Q;  4YHH Q;  1Z47 A;  3UDX A;  1Y14 B;  3BU2 A;  3DLL A;  1TXY A;  4DV3 Q;  2WP8 J;  4OON A;  2R7Z H;  3G1G A;  1SLJ A;  1A8V A;  1I5F A;  2PMZ E;  4BY1 H;  5IYD H;  4L5S A;  4DUY Q;  1K8A Q;  1VQP P;  3GTG H;  1Y1V G;  1S72 P;  4DV1 Q;  2E8G A;  4IJL A;  4JV5 L;  4EX5 A;  2Q2T A;  3G6E P;  1N36 L;  1BBW A;  4M0I A;  1X9N A;  1HJP A;  4U0C A;  4GLX A;  2Q2H A;  1OXT A;  2WAQ E;  3W5O A;  1N9W A;  5C0X G;  2K50 A;  3HKZ E;  3I4O A;  3OYY A;  2Z45 A;  2CWA A;  4ALP A;  4WJ3 M;  4IJH A;  1Q8K A;  3M4P A;  3S1M H;  1XPR A;  2JEB I;  1QUQ B;  2UU9 Q;  4HJA A;  4DUY L;  1G51 A;  5IWA L;  2HQL A;  5GRO A;  1JE5 A;  1YHQ P;  1HNX L;  3H3V I;  1PH6 A;  5IP7 H;  1JJ2 O;  3A0J A;  5ELN A;  3CD6 A;  4PG3 A;  1RIP A;  4B3S Q;  1P16 A;  1VQ7 P;  3AFP A;  3Q8D A;  2E5L Q;  1M90 Q;  3ULP A;  2RHS B;  2UUC Q;  4IPD A;  2ZTE A;  1IBL Q;  1KXL A;  4QNB A;  1Y1W G;  1XTD A;  1E22 A;  4OO1 I;  1HNW Q;  4JI6 Q;  2UXD L;  4IFD G;  4O0A A;  1DGS A;  4BBS G;  4YCU A;  1MJC A;  3G48 A;  3KF6 B;  4QJF A;  4X66 L;  1YBY A;  2H5X A;  2PEO A;  2B63 G;  2OQ0 A;  4DAY B;  2JA5 H;  5JPA A;  4MNO A;  1SRU A;  3TRZ A;  4UPA A;  1VQ9 P;  1OXS C;  5F2N A;  5C3E H;  3D0F A;  4JBW A;  1HR0 L;  3CCM A;  2ALY B;  1IL2 A;  3P05 A;  5M5Y H;  5LMN L;  1EIY B;  1HZ9 A;  2MO0 A;  2RCN A;  4IO9 A;  1B7Y B;  3H0D A;  2Z44 A;  2I0Q A;  2N49 A;  1VQ6 A;  4XFZ A;  4JI8 Q;  1OXX K;  3CP0 A;  1KC8 C;  2KOD A;  1YI2 P;  5FLM G;  1N32 Q;  4LUZ A;  4LF6 L;  4A3I G;  1QZG A;  5HGN A;  2GVA A;  1MIU A;  2PI2 E;  3GTQ H;  3RG6 C;  2PEI A;  4LFC Q;  2E2H H;  4DV7 L;  1BAJ A;  4LF5 Q;  3L2P A;  4LF4 Q;  4C2M H;  3CD6 P;  4BY7 H;  4JI2 Q;  3ULJ A;  2N3S A;  1UE6 A;  3PGZ A;  1GKH A;  1LUZ A;  2DUD A;  4OWX B;  4JI7 Q;  2CQO A;  1NMG A;  1SRO A;  5BR8 Q;  5HGL A;  1BKB A;  1W2B A;  4DUZ L;  1E6J P;  1X6O A;  3T1Y Q;  3UDG A;  4A3L G;  1B70 B;  5BS2 A;  2UUA L;  1B8A A;  4IPG A;  3S2D H;  4B3R L;  1RL2 A;  2GVB A;  1VQC A;  4R4I A;  3S2H H;  5JEA J;  1IUQ A;  3G0V A;  2QA4 A;  1EOV A;  1K73 Q;  1WFQ A;  1X3E A;  2RHQ B;  4JI7 L;  1XPU A;  1EQQ A;  4DAM A;  4A3F H;  3K7A H;  2Y0S G;  2IHF A;  1TWC H;  3RR5 A;  1Y1W H;  3CCM P;  4R4C A;  1A43 A;  2VNU D;  2IX1 A;  4LFB Q;  3T1Y L;  5DLQ E;  1XPO A;  2F52 A;  1N34 Q;  2IY5 B;  5AJ3 L;  3TQY A;  2R92 G;  1NBW A;  4PH0 A;  1CKO A;  4GKK Q;  1VQ6 P;  4A3B G;  2AMC B;  3I4N H;  3STB C;  3J81 j;  1N33 Q;  3CCS A;  2PQA B;  2HT1 A;  4HJ9 A;  1IBK L;  1ASY A;  1ZMB A;  4YWK A;  1VCI A;  3TRE A;  3I4M G;  4OX9 Q;  4U0D A;  1M1K Q;  3I7F A;  2F3I A;  2E2J H;  3CCE A;  1U5K A;  1VQO A;  2L6E A;  3I56 A;  4LF7 Q;  2OQK A;  3H0G G;  4X65 Q;  2N8N A;  2UXC Q;  3CXC O;  1VQL P;  3DS1 A;  3HOV H;  4BA2 I;  4K0K Q;  2BA0 A;  1QRJ A;  5FLM H;  4X62 L;  1J6Q A;  1N33 L;  2WB1 E;  4LW1 A;  1WJJ A;  1I50 H;  2LSS A;  3GO5 A;  4L5T A;  4DNI A;  1EFW A;  4DV4 Q;  3CAM A;  4POG A;  2D62 A;  2WAQ G;  4A3C G;  4IPC A;  1I94 Q;  3HKZ G;  3OTO L;  5M3F H;  2LXK A;  4LF9 Q;  2QA4 P;  2BA1 A;  2NN6 I;  2M8N A;  2PEK A;  3M7N A;  2JEA I;  2VQE Q;  1CSP A;  4A4I A;  1FJG Q;  3L0O A;  3DTJ A;  4JI3 L;  4Y52 H;  1PH2 A;  1LTL A;  2R93 G;  3U4Z A;  3J81 c;  1VQ8 A;  4A3L H;  4A75 A;  1E1T A;  1V43 A;  3GTM H;  1NTG A;  3AFQ A;  1VQH A;  4DV6 Q;  1TWF H;  3MXN B;  4PZ7 A;  4JC0 A;  4RG1 A;  4LUO A;  2ZJP A;  1NMF A;  3WBH A;  3A74 A;  1XNR Q;  2MFI A;  3CMA A;  3JAM c;  1KQS A;  5F2O A;  4YCV A;  1K9M Q;  3CCE P;  1VQO P;  4A3J G;  1JB7 A;  1K73 C;  1VQ4 A;  2PNH A;  1R9T H;  2K4K A;  1HH2 P;  2ZTC A;  1E7Z A;  2R92 H;  2R7F A;  3PO2 G;  1CUK A;  4OXP A;  4A3B H;  1AH9 A;  5HGO A;  4DV5 Q;  3CC4 A;  3G71 P;  1VQM A;  2I5M X;  3CC2 P;  1AUM A;  1SMX A;  4DR7 L;  1A0I A;  5GAH C;  3K8A A;  3DS2 A;  1XNQ Q;  3M1M A;  4JBJ A;  4GS3 A;  3U58 A;  1YVC A;  3I4M H;  4PMW A;  5JJI A;  4GNX B;  4R4O A;  1CKN A;  4JI5 Q;  1KC8 Q;  1GO3 E;  3HOW G;  1KL9 A;  3OW2 A;  4TQU S;  2XXM A;  1L1O A;  1PH7 A;  2PY8 A;  4JI1 L;  2R7D A;  1OTC A;  4WYM A;  1VQE A;  1Q12 A;  4GLA C;  3PV0 A;  1N8R Q;  4OWW B;  2JYG A;  4DV5 L;  1M1K C;  3LRY A;  2ZJQ A;  1YEZ A;  3HZQ A;  3GTO H;  1XNQ L;  2B29 A;  2JJQ A;  2YTX A;  2EXD A;  1VQ8 P;  2Z6K C;  2L15 A;  1QVG A;  4A3C H;  4X6A H;  1JJG A;  4UP9 A;  5C0X I;  3HOY G;  3RNU A;  5C4X H;  3AQQ A;  3GD7 A;  2C35 B;  3J81 i;  4GOP B;  3U50 C;  1AE3 A;  4DR5 L;  4A3K G;  4B3M L;  4YHH L;  4BBR G;  4DV3 L;  5E7N A;  4A76 A;  4GN5 A;  1IXR A;  3DPH A;  3KYH C;  1WCM G;  3CMA P;  1KRT A;  4DR1 Q;  3HOZ H;  1L2F A;  3KJO A;  3CCR A;  2PEQ A;  2ZTD A;  2JA7 H;  2F4V Q;  2M8L A;  4RMF A;  3JAM i;  4QQB X;  3CCL A;  4DV1 L;  2I5L X;  2BUO A;  3MEF A;  3PUY A;  4GLV B;  1VQI A;  3CC4 P;  5GQO A;  2R6G A;  4LF8 Q;  2KHI A;  4HIO A;  3NTE A;  1EUJ A;  5IYB G;  4DV2 Q;  1EQR A;  4IFD I;  2VUM G;  2MNA A;  2PEM A;  3FP9 A;  2QGQ A;  2AHO B;  1YJW A;  2UU9 L;  2KCT A;  1EIF A;  3B5I A;  1SN8 A;  1G29 1;  2B3G A;  4DR4 Q;  3PO2 H;  1MJE A;  4AYB E;  2UXB Q;  5M3M H;  4BXX G;  5IY0 A;  3DS4 A;  4ME3 A;  4XIG S;  4YCW A;  4B3S L;  1K9M C;  3M9B A;  2E1M A;  4R4T A;  1FVI A;  4GOP C;  3HOX G;  4JBM A;  2E5L L;  2CWO A;  2XTI A;  4DV2 L;  5IYC G;  3SGI A;  5M5X H;  2HIV A;  2UUC L;  4A93 G;  2OWO A;  4A3G G;  4DR2 Q;  1IBL L;  3HOW H;  2I5H A;  1VS0 A;  1C7Y A;  1K30 A;  5FLX c;  2WB1 G;  2RF4 A;  4UP8 A;  1YJN A;  4DR6 Q;  4COP A;  3RN2 A;  1HNW L;  2ES2 A;  1VQ5 A;  2NVT H;  2E2I H;  4JI6 L;  2K52 A;  4P74 A;  1QVF A;  3F2D A;  2NZO A;  1PV4 A;  1E1O A;  1TWG H;  4KHP Q;  1L1O B;  3K80 C;  3F2C A;  3CCR P;  1GVP A;  4PZ8 A;  3CCQ A;  1PYS B;  3G26 A;  3KDF A;  1Y1V H;  4LWC A;  3DS0 A;  5IE8 A;  1N8R C;  4JOI A;  4IOC A;  3NEN A;  4DV0 Q;  1Q81 Q;  3S1Q H;  4A3K H;  4P75 A;  1KIX A;  2PI2 A;  4BBR H;  2BH2 A;  2LF4 A;  1XMO Q;  1PH9 A;  2ZM6 Q;  4JI8 L;  1UE1 A;  1EOQ A;  1RNI A;  2KHJ A;  3K7U C;  1N32 L;  3PF5 A;  1BVS A;  1YJW P;  2A1A A;  3CPW A;  1Q1E A;  4LFC L;  4NB3 A;  3PUV A;  2YV5 A;  5HGM A;  5EAY A;  4LF5 L;  5C0X J;  3GTK H;  1WI5 A;  2JA6 G;  4LF4 L;  4LUV A;  3PUW A;  4DV0 L;  1A8O A;  4YY3 Q;  3G21 A;  2BH8 A;  3PIP A;  3WWV A;  4JI2 L;  2HHH Q;  4JBK A;  2VQF Q;  1IYJ B;  1Q1B A;  5IYB H;  1XMO L;  2VUM H;  5JJL A;  5BR8 L;  1QZH A;  3CQZ H;  4GR2 A;  1I6H H;  4B3T Q;  2PEN A;  3RZO H;  1UEB A;  4HIK A;  1X3G A;  1YJN P;  4BBS H;  4JI4 Q;  2BHV A;  5C4J H;  3CC7 A;  1TWH H;  1U0L A;  4BXX H;  3S1N H;  2B63 H;  1J5E Q;  2ZJR A;  3KOJ A;  1GM5 A;  1VQN A;  1X65 A;  3HOX H;  1E24 A;  3Q20 A;  2DGY A;  1X56 A;  4JCV E;  5IYC H;  4IFD J;  3F1Z A;  4A93 H;  1NE3 A;  4A3G H;  4U0E A;  4XTC S;  1VQJ A;  4NXN Q;  5DCK A;  1YIT A;  4LFB L;  1N34 L;  4XFY A;  2D0P A;  1K8G A;  1X3F A;  2A8V A;  4U0A A;  4OWT B;  4U0F A;  5GAG C;  1XMQ Q;  1Q82 Q;  3I2Z A;  1HZB A;  1M6E X;  4GKK L;  2NVQ H;  5IT9 c;  4A3I H;  2NVY H;  1K3R A;  3PIO A;  4EQ5 A;  4QIW E;  1LM0 A;  3GDE A;  1JJ2 A;  4OX9 L;  1CSQ A;  3EN2 A;  3G29 A;  1Q7Y C;  4BY1 G;  5IYD G;  5C44 G;  4LF7 L;  1JJC B;  4X65 L;  3D31 A;  1YZ6 A;  2UXC L;  2IX0 A;  1PYB A;  1PHJ A;  1PA6 A;  4K0K L;  1Q81 C;  1QUQ A;  2P9X A;  4HID A;  3F8T A;  3F2B A;  1TWA H;  3NEM A;  4DV4 L;  1E3P A;  3CME A;  2OTL A;  4JYA Q;  2CWP A;  1W3S A;  1I94 L;  1KAW A;  4XFX A;  4WJ4 A;  4LF9 L;  2EIF A;  3CCV A;  3CCS P;  3PUX A;  1VQN P;  1RO2 A;  1VQG A;  3NBH B;  2UUB Q;  1P8L A;  4DKA C;  2VQE L;  3L7Z C;  4COC A;  1FJG L;  2AKW B;  4NXM Q;  3T1H Q;  3STB D;  1VQD A;  1YIT P;  2YTV A;  3I56 P;  2XGT A;  3KJP A;  3G28 A;  1HZA A;  3S14 H;  3RLO A;  3EIV A;  3ULL A;  3ER0 A;  4POF A;  3KF6 A;  4JI0 Q;  2JYL A;  4A3M G;  3H47 A;  4DV6 L;  3TS2 A;  3HYB A;  1W2B O;  2K5N A;  5BS1 A;  2UUB L;  4UY8 C;  3JC6 6;  1VQB A;  1YHQ A;  2OAR A;  2V1C C;  3PO3 G;  4IPY A;  1XNR L;  3TEH B;  5GAD C;  1VQ7 A;  4A3D G;  3NEL A;  3DS5 A;  3H0G H;  1YIJ A;  4YWM A;  4DR3 Q;  1YJ9 A;  1NJI Q;  4JV5 Q;  2IHE A;  3J7A 5;  1N36 Q;  5LMU Q;  3BJU A;  3E0E A;  3EBE A;  3CME P;  3G4S A;  2OTL P;  3M4Q A;  4JI5 L;  1Q82 C;  1JT8 A;  1HZC A;  5C44 H;  3CCV P;  4KI0 A;  3CPF A;  2Q2U A;  1KD1 Q;  3S17 H;  2ID0 A;  5IWA Q;  2XV6 A;  1NY4 A;  4HJ7 A;  1VQ9 A;  4DR3 L;  1PH5 A;  1HNX Q;  3M85 A;  1C9O A;  3E2D A;  2ATW A;  4HIM A;  3PSI A;  2HIX A;  5LMU L;  2R93 H;  4BY7 G;  4LFA Q;  2EQS A;  1VQ4 P;  1C0A A;  5IP9 G;  2VS1 A;  2OCE A;  5I4T G;  1YI2 A;  1S3O A;  3A5Z B;  5JEA G;  2Z0S A;  4GNX C;  5ELO A;  4MZ9 A;  1VQM P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...