2DGYA

Solution structure of the eukaryotic initiation factor 1a in mgc11102 protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
111
Chain Sequence
GSSGSSGEHIVPSNQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the eukaryotic initiation factor 1A in MGC11102 protein
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords MGC11102 protein
total genus 10
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.180 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2dgyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2dgyA01
4B3MQ 4LFBL 1YJWA 2E8GA 1HZBA 2Y0SG 1HJPA 1XMQL 2UUBL 1KRSA 4IPCA 1LUZA 4LWCA 1XMOQ 1IBKQ 1Y1VG 2UXDL 1J5EQ 4MTNA 2QEXA 4LF8Q 2ZTDA 1Q46A 1VQ6A 2RCNA 5LMNL 2A8VA 5C4XH 4BY7G 5IYCG 4WJ3M 4DV1L 4A3KG 5FLMH 3K0XA 1VQKA 2ES2A 2Q2UA 3RZDH 3U58A 1VQMA 1X9NA 1N36Q 2AHOB 1NBWA 1VQPA 3UDFA 3KJPA 4BY1G 2NVTH 1HZCA 3K7UC 2MQHA 1VQ9A 4DR3Q 4DK6C 2OTLA 1EQQA 3CC4A 3CMEA 3CF5A 4DV3Q 3PUVA 1YVCA 2YV5A 5JJKA 4X66L 4A3JH 4A3MH 3WWVA 1N34L 3S1MH 1KXLA 1E7ZA 5M5WH 3KJOA 4A75A 4X65L 1K0RA 2IX0A 1BBWA 2WAQE 1NE3A 3HKZE 1SFOH 4IOAA 2Q2TA 4GKJQ 3CC7A 1M90C 3NBHB 1VQIA 2JEBI 4PG3A 4LUZA 3D0FA 4A4IA 3PUYA 2KBNA 4APVA 1KC8C 4JBJA 1E1TA 4JBKA 2F4VL 1YBYA 1WFQA 1QVFA 4DV5L 4UP7A 4GNXA 4A93G 3GO5A 3EIVA 4DV4Q 1X54A 2IHEA 4YY3L 1PH4A 3HOVH 1IL2A 1CSQA 4JYAQ 1XJVA 3HOZG 4XIGS 4AQYQ 3KLWA 1HNZL 1PFSA 4JI8L 1OXSC 2OWOA 5J3BA 1IBKL 2E5LL 3NENA 4IPDA 3GTGH 3KF6A 2UXDQ 1YHBA 4FDBA 1XMQQ 2UUBQ 3OYYA 2KHJA 2HHHQ 4JI7L 2CFMA 2B63G 2MNAA 1IZ6A 1SROA 1UE7A 1WI5A 3CCSA 1B8AA 4DUZQ 4KLKA 3ULJA 1TXYA 2DGYA 4AIMA 5IP7G 2I5LX 2NVYH 1PH5A 2BA1A 2K50A 2RHSB 3UDIA 2MO0A 3HOYH 1TWCH 4LUVA 1YJ9A 4YWMA 2MFIA 4C2MH 5M3FH 2R92H 1JE5A 2UU9L 4BA1I 4A3BG 5IWAL 1G51A 4AYBE 4JI1L 1N8RC 3VDYA 2JA6H 4BBRH 3HOXH 5M3MG 1YNXA 4DR3L 3L0OA 1VQ4A 4IO9A 2JA7G 1Q1EA 2VQEL 2UUAQ 2VNUD 1N32Q 4HJ9A 3W1BA 4ALPA 1UE1A 1Y1VH 2VZAA 2Z0SA 3I4OA 4DAYB 1VQCA 3OTOQ 1EIYB 4H02A 1PA6A 4IPGA 2JA8G 5LMUQ 5IYCH 1H95A 3TS0A 4A3KH 1XMOL 3PO3H 1IBLL 3T1HQ 4UY8C 1W3SA 2HQLA 4JI0L 3OTOL 3PUZA 4NXNQ 2K5NA 2I5MX 1A62A 5LMUL 4MZ9A 4DR4Q 4QQBX 2LSSA 1SLJA 2UXCQ 5AJ3Q 4TVAB 4JI6Q 4OXPA 1XPUA 1C9OA 4YWLA 4XTCS 3CC2A 1A8VA 4LF9L 1FVIA 4DR4L 3J80c 1Q7YC 4NXML 1NTGA 3H3VH 4BBSG 3S2HH 1K3RA 4HJ7A 2VUMH 3CXCA 4A3MG 1S72A 3CPFA 4R4CA 1QVCA 3FHWA 3IRBA 3G6EA 4A3DG 5GROA 1HZ9A 3AFQA 4C3IH 4IOCA 1BKBA 2N8NA 3CCVA 3CQZH 5H1SE 1GD7A 3HFZB 1A0IA 1RL2A 4DAMA 1VQ7A 4LNQA 2NN6I 4JBWA 3I2ZA 4DUZL 1VS0A 2K52A 2UU9Q 3F2BA 1PH1A 4POFA 1LYLA 1G6PA 3F2DA 2PI2A 3HOWH 4P71A 4TQUS 3HOZH 1LM0A 1W2BA 1V1QA 1CKMA 1V43A 4QY7A 3GDEA 4GN5A 4DV0Q 3CD6A 3HOUH 4DR6Q 2D0PA 1MJEA 4EQ5A 1JJGA 2VY3A 1E22A 5GAHC 2V1CC 4DV0L 2B63H 3MEFA 3UE1A 4JOIA 2RF4A 3TEHB 3K80C 2ZTEA 4NXNL 4A3GH 1EWIA 4GKKQ 1GO3E 2JA9A 3T1HL 4DR7L 5FJ8H 1I3QH 1A63A 2KHIA 4IPHA 1L2FA 4JI2Q 3KOJA 3JAMc 5C3EH 5M3FG 2CCZA 2XTIA 1CKNA 4YWKA 3S1RH 5C44G 2JA5H 5M3MH 3EBEA 2FXQA 2JJQA 4JV5L 4A3IG 1X3FA 3CCRA 3HKSA 3J7A5 1CKOA 2EQSA 3RN2A 1GKHA 1E3PA 3B6YA 1VQJA 2ZJPA 3PF5A 3TREA 2JQOA 5IYBG 4JI4L 1NJIC 3NEMA 2A19A 4PMWA 2R7DA 1AE2A 1SR3A 4A3LG 1E1OA 2HT1A 4DUYL 1TWHH 3H0GH 2WAQG 2B3GA 4DV1Q 4PZ8A 2E2IH 1X6OA 5C0XI 3RN5A 5LMNQ 1XPOA 2NZOA 2KCTA 1L1OC 2PQAB 2VQEQ 2UUAL 2A1AA 3K8AA 2N78A 2VW9A 2R7ZG 3E9HA 1JJCB 4LUOA 2R7FA 3CCUA 4JI7Q 4KHPL 1L1OB 2E2HH 1QZGA 2B29A 3U50C 4QGUA 4LF7Q 2AMCB 3CCLA 2GVAA 1FJGL 1HR0Q 4X6AH 3AQQA 4DNIA 4X66Q 2JK8A 3J80i 4C3JH 3J81c 3I4MH 4LF7L 3G71A 4A3DH 3S17H 2D0OA 5C4JH 5FLXc 4JCVE 4DV7Q 4JI1Q 1FL0A 1KIXA 3L7ZC 3KDFB 4B3ML 2AWOA 4B3RL 4UPAA 4L5SA 5IE8A 1IXRA 3HKZG 2VQFQ 4GLXA 2I0QA 3HOVG 3RZOH 4KI0A 4JI8Q 3A0JA 4DV2Q 2BH8A 4LF6L 1IBMQ 2VS1A 3ULLA 4HIDA 3RNUA 4JYAL 3CMAA 4UP8A 1VQBA 3PV0A 3GTOH 4BXXG 4DR5Q 2ZTCA 1IBML 5BR8L 1YITA 4GN3B 1JMCA 2CQOA 3K81C 3E0EA 3M4QA 2E5LQ 3CCJA 1AH9A 2HIXA 5GQOA 5DLQE 3E9IA 3S1NH 2K5HA 4B3TQ 2OQ0A 2VL6A 1OXUA 3PGZA 1PV4A 1EFWA 4QL5A 4LFAL 4A3BH 2YTVA 2IY5B 4B3SL 3CCQA 2JA6G 4A3EG 1ASZA 3M4PA 3DLLA 1N34Q 3JC66 3W1GA 2OCEA 1HZAA 4A3CH 2H5XA 1XPRA 1SN8A 4KHPQ 2LXJA 2WB1E 2F4VQ 4A3FH 4HJAA 5IT9c 4OONA 3F2CA 2Z6KC 3CCMA 4A3IH 1SMXA 4Y7NH 3J81i 1VQOA 1HNXL 1UE6A 2BA0A 2YYZA 2YTYA 3PCOB 1C0AA 2NVQH 2JA8H 3S16H 1XNRQ 1EIFA 4DR2L 5JJLA 1KL9A 3PO3G 3U4VA 5E7NA 3STBC 4DV2L 4GNXC 3UDXA 4A3LH 2UXCL 1I94L 4JI0Q 4A76A 1KQSA 1VQ8A 4JI4Q 1X56A 2XGTA 1KRTA 1PYSB 4KHZA 4GNXB 4HIMA 2WB1G 1UEBA 4C3HH 4LW1A 3BZKA 3L2PA 4BA2I 1FGUA 1MKHA 3FKIH 2IHFA 4JI3Q 3RLFA 2ZJQA 2ZM6L 3GTLH 1K9MC 4BBSH 3GTQH 1XNRL 1Q86C 2VUMG 2EXDA 4GN4B 5BR8Q 4POGA 1U0LA 5GADC 3KF6B 2ZM6Q 3RR5A 4LFAQ 1P16A 3AYHB 1CUKA 5GAGC 4LF8L 1ASYA 2UUCL 4B3TL 1VQEA 3EN2A 4HIOA 3BJUA 3RLOA 2ASBA 4DR7Q 3CP0A 3S14H 1E24A 1QZHA 1X55A 1EQRA 4MNOA 5C0XJ 4B3SQ 1NY4A 1V9PA 3A5ZB 1Z9FA 4HJ8A 5IP9H 3CAMA 4OWTB 1K8AC 3RLNA 3S2DH 5ELNA 2N49A 2WP8J 3U4ZA 1Q12A 3F8TA 4DR1Q 1N9WA 4GOPC 1K83H 1HR0L 1S40A 1VQAA 4PZ7A 3JAMi 3HOUG 2PNHA 3G4SA 1TWGH 1X65A 1MIUA 1GM5A 2F3IA 4L5QA 2R7ZH 3PO2H 1IBLQ 5GAEC 4DV7L 3GD7A 2K75A 4JG2A 4R4TA 1PH8A 5C0XG 2NN6G 1IYJB 4P74A 1PHJA 4LF9Q 3GTMH 4A3GG 1PVOA 1L0WA 2QGQA 3I4NG 2Q2HA 4NB3A 3H15A 1HNWQ 2CKZB 3J81j 1CKNB 4QIWE 1PH7A 2R6GA 1WCMH 2KENA 4LF5L 5C44H 1B70B 3STBD 3UDGA 2JA5G 1UE5A 1OXTA 1HNWL 5IYDG 1I94Q 1Z47A 4A3CG 1X3GA 1T9HA 2UUCQ 3KYHC 4YCUA 4YY3Q 1LTLA 5IYBH 1NMGA 4DKAC 2NZHA 1PH9A 4YHHL 1Y1WH 4JV5Q 3PSIA 1U5KA 4DUYQ 4LF4L 1QUQB 2HHHL 2ATWA 3H0GG 5C4XG 4B3RQ 4X62Q 5FLMG 1HNZQ 1B7YB 3A5UA 2R93H 2HIVA 1Y14B 1YHAA 1PH3A 2ID0A 4IJHA 4X65Q 2K4KA 5HGQA 3TS2A 1VQNA 1PH2A 4QJFA 5M5YH 1N33L 4R4IA 4OO1I 4DV3L 1JJ2A 1JB7A 2ZJRA 4OO1G 4AYBG 1VCIA 1PYBA 2JA7H 3G48A 4O0AA 4NPSA 4P73A 1OTCA 1R9TH 2Q2IA 1L1OA 3I4MG 1J6QA 1UWVA 4WJ4A 1P8LA 3I55A 4ME3A 4DK3C 1G291 4P75A 3K7AH 3KF8B 1VQHA 5JEAG 4OWWB 4YCVA 4EX5A 4DV6Q 5HY6A 4L5RC 3CCEA 1MJCA 3T1YL 1CSPA 4LF5Q 3H3VI 3W5OA 4BXXH 4LF4Q 2N3SA 4UP9A 4PZ6A 4AH6A 3MXNB 4JI5L 2KCMA 2QA4A 2IT1A 1I6HH 2OTJA 1D7QA 1AE3A 1VQLA 4NXMQ 1SRUA 4GOPA 4GLVB 4DR5L 4Y52H 4JBMA 1C7YA 1RIPA 5AJ3L 3F1ZA 4R4QA 3S24A 4DPGA 5ELOA 3A74A 4X64Q 3PIOA 1PH6A 3PO2G 3PIPA 4GS3A 4DV6L 4LFCL 3S15H 4IFDI 4GLAC 2F52A 4R1JA 5IP7H 5IWAQ 4IFDG 4A3EH 4GKJL 3T1YQ 3AFPA 2NVXH 3NELA 3ER0A 5IY0A 2JE6I 2LXKA 2OQKA 2R92G 2K14A 1WYDA 5M5XH 1Q82C 1QVGA 1YI2A 1WCMG 2ALYB 4DV5Q 4A3FG 3BZCA 4BBRG 4DV4L 1BVSA 1Q1BA 3M7NA 3ERSX 3J7ZC 4JC0A 1HR0W 2BH2A 2GVBA 1YIJA 2YU9H 4OWXB 2VQFL 3DM3A 4BY7H 1OXXK 2MO1A 1DGSA 3KFUA 1SE8A 3TQYA 1Y1WG 1N33Q 2JEAI 2AWNA 4JI6L 1YHQA 3M9BA 4BY1H 4J15A 1XNQQ 5LMNW 4YHHQ 4HIKA 1M1KC 3TRZA 1O7IA 4LF6Q 2R93G 3FKIG 4DR2Q 2UXBL 1XNQL 4X62L 1WOCA 1VQGA 4IJLA 4RMFA 4A3JG 2Y0SE 4LFBQ 1J5EL 1YEZA 1TWFH 1YJNA 2L15A 3GTKH 2UXBQ 4JOIC 4RG1A 4X64L 1OXVA 1KAWA 2D62A 2CWPA 3BU2A 1X3EA 1N32L 2PQAA 1K8GA 1S3OA 1YZ6A 2K5VA 3ICEA 4JI3L 3OW2A 4R4OA 2E2JH 1VQ5A 4O2DA 1NMFA 1EUJA 3UE0A 1Q81C 2Z6KA 2IX1A 1GVPA 1I50H 2YTXA 4A93H 5IP9G 1VQDA 3CW2C 3GTJH 1KHIA 3AEVA 3S1QH 2CWAA 4IFDJ 3M3YH 1EYGA 1N36L 1TWAH 2WFWA 3LGJA 4LFCQ 3FP9A 4DR1L 4K0KL 3CPWA 3ULPA 5EAYA 4DR6L 1WJJA 1I5FA 2RHQB 1JT8A 1HNXQ 3M85A 3HOWG 3KDFA 2PMZE 1D8LA 3I56A 4K0KQ 2AKWB 2PI2E 3PUWA 3SGIA 4OX9Q 5K36G 3PUXA 4P72A 4HJ5A 1FJGQ 2I5HA 1K73C 2DUDA 3HOYG 2EIFA 1HH2P 1KD1C 4GOPB 3I4NH 2C35B 3PF4A 3Q8DA 2GN5A 4OX9L 4YCWA 5JEAJ 5JJIA 1BBUA 4AQYL 3M4OH 3D31A 3GTPH 3HOXG 1QUQA 4JI2L 1EOVA 1Q8KA 3I7FA 4L5TA 1VQFA 5IYDH 5FJ8G 3ZJYC 4JI5Q 4GKKL 1XTDA 5C3EG
chains in the Genus database with same CATH superfamily
3FEWX 1SNDA 4R9WA 1HJPA 1XMQL 2EVBA 2UUBL 2VUMB 1KRSA 1XMOQ 1IW7D 1WTRA 2CWOA 2RCNA 4BY7G 4WJ3M 4DV1L 5FLMH 2Q2UA 3T13A 3U58A 4BY7B 2K0DX 1VQPA 1ZXTA 5DNFA 4DR3Q 2OTLA 4DV3Q 2M8NA 1A2TA 3CKIB 4UHPB 3WWVA 4A3DB 3PIO3 3J7AF 1JB3A 3HGBA 4A75A 1QILA 4X65L 5I6WA 1AFPA 1QCBD 2WAQE 2FVFA 4IOAA 3CC7A 3NBHB 2JEBI 4A4IA 4APVA 3PUYA 2KBNA 1EU3A 4JBJA 2E76C 1B2TA 5CGKA 1WFQA 1L0YB 1PDQA 1ESFA 3H3VC 4GNXA 2MVVA 1V1OA 2OF1A 3KLSA 1MHWC 2VXWA 2NVYB 1M1KQ 5C3XA 4DV4Q 1MD2D 1PH4A 4IURA 2K6AA 1GUSA 4R0MA 4LK1C 2M9VA 1NQ4A 4JI8L 2VLPA 4KY5A 1EYAA 1IBKL 1CFMA 2JSOA 4FF3A 2PW5A 2H4OA 3OYYA 3TZUA 2B63G 2MNAA 1VF7A 2XIWA 2F0QA 3MFYA 4KLKA 3MHBA 3CC4P 2BA1A 2K50A 3UDIA 3HOYH 1YJ9A 4YWMA 5M3FH 1JE5A 4BA1I 1I3QB 1F77A 4AYBE 5IWAL 1EWCA 4I65A 3J7YW 4K2KA 2EY5A 4BBRH 3HOXH 2KODA 5M3MG 2P5ZX 2F0EA 1STNA 3C3LA 1CHQD 2Z0SA 3I4OA 2DN8A 1VQCA 1EIYB 2EY6A 4IPGA 1ET6A 3VYRA 1VQ4P 1XMOL 3PO3H 4JI0L 2HQLA 1AZPA 2CW0C 1TWAB 4MZ9A 1Q82Q 3G26A 5EPKA 2VSQA 2WKDA 1EZ6A 4XTCS 4ZYSA 3CCSP 3QR8A 4BBSG 3S2HH 1NTGA 2F0VA 2L12A 1F2ZA 4HJ7A 4A3MG 3CPFA 4R4CA 4G4KA 5GROA 3FKIB 4O1NA 4IOCA 2BHVA 3CCVA 3CQZH 1A15A 3K7AB 5H1SE 3HFZB 1A0IA 5ELCA 4DAMA 4LNQA 1B9NA 4DGZA 4DUZL 1SSOA 2K32A 4G7ZC 4V0BA 3H09A 1PH1A 5E4XA 4QMGA 4A3FB 2KOQA 2PNGA 1DXMA 1EY9A 5I9OA 3K58A 4GZYC 2M00A 1V43A 3A8JE 3GDEA 4GN5A 4G7OC 2D0PA 1EIGA 4EQ5A 4U673 3TDQA 3DS5A 1E22A 1SYDA 2JYOA 5GAHC 4DV0L 3MEFA 2F0SA 3GQBA 4NP5A 4UDUC 2RF4A 2ZTEA 3NP8A 2JA9A 1LTTD 4DR7L 3G71P 4IPHA 3KOJA 2XTIA 4YWKA 4A3IB 4KD4A 5ISRA 5C44G 5M3MH 2FXQA 4JV5L 4A3IG 1CI3M 3G4SP 2HCCA 1AP0A 3MC0B 1EY4A 1PZKD 3MGEA 4CDFC 1K73Q 3IFDA 2QEXP 2F0KA 1AE2A 1E1OA 1QVFO 4DV1Q 4ZCKA 1PTOH 1JWSD 1X6OA 1IHZA 2RQXA 5LL6S 4C3HG 2WAQB 3RN5A 2VQEQ 2N78A 3E9HA 3E0JA 2J4XA 3CCUA 1U9RA 2I07B 4JI7Q 2A73B 2E2HH 4LF7Q 3RD4A 3S16B 1JR0D 3J80i 3I4MH 4LF7L 3G71A 2LMLA 3S17H 1SNQA 2D0OA 4Q5VA 1ZNVA 4JI1Q 5G3LD 3HKZB 4B3ML 4PH1A 5IT9L 4L5SA 2GDXA 5IE8A 2VQFQ 3HOVG 3RZOH 4FXGC 2E2DC 4DV2Q 3BYTB 2F0OA 3HOVB 4GR6A 4IUVA 4KHVA 4JYAL 5HGTA 5C4ZA 2SNMA 1VQ5P 4K14A 3CMEP 1F2LA 1E6JP 1LTGD 5JPAA 3K81C 1SYBA 4KKTA 5EJDA 3A55A 2OQ0A 4LFAL 3CCMP 2JN4A 4B9WA 3NSWA 2YTVA 1RTNA 2IY5B 4IFDH 1ASZA 2O5JC 3CCLP 1BOSA 2H5XA 2K04A 2WB1E 1EEFD 4G7HC 5IGFA 4HJAA 4OONA 1VQOA 1TU2B 2OXPA 2Z6KC 4RCNA 1EY7A 2E1MA 5CV5A 2YTYA 1FGBD 3I90A 3PCOB 2NVQH 3H6MA 5KP7B 2NB0A 1XNRQ 3GP7A 4DR2L 5JJLA 3STBC 5KGUA 3P7JA 1E2VA 3BVZA 1OR5A 3UDXA 2K2QA 1VQ8A 1X56A 2J7ZA 3BVMA 2KW2A 3IKJA 1LACA 4LAAA 4PNYA 1FGUA 3L2PA 2IHFA 4Y7NB 4JI3Q 3GTQH 1QRJA 2KCNA 2B2UC 4POGA 2QA4P 3TMEA 2KG9A 2Q8TA 1H9SA 4LFAQ 3AYHB 5GAGC 3GTKB 4B3TL 3BJUA 3MVVA 3CPWO 4C3JG 4BPHA 4U0AA 1E24A 1B9MA 1X55A 3W3AA 4MNOA 2GZIA 5C4HA 1A43A 1SNPA 3CAMA 4OWTB 1M8AA 2BCOA 3S2DH 5ELNA 2VLOA 3ITPA 5F2DA 3U4ZA 4GOPC 5IGEA 1K83H 1UUPA 5AFWA 1VQAA 3DM1A 3HOUG 1A2UA 2BDOA 2PNHA 3G4SA 5I2YA 1MIUA 1CQVA 1QWYA 2CHBD 3T51B 1X32A 1GM5A 3TBIB 3PO2H 1WD0A 4DV7L 3GD7A 1T5EA 2XXMA 1PHJA 2RKSA 3HZXA 1STBA 1L0WA 3I4NG 4NEOA 2F0TA 1HNWQ 3EVQA 3K5OA 4MHEA 3OSOA 1HNWL 4DK0A 1I94Q 1Z47A 2N5IA 1X3GA 1KAAA 3HZQA 5I9PA 3RZDB 1H9JA 1NMGA 1UNKA 2NZHA 3PSIA 1PFBA 2KHSA 2EJFC 1TS2A 4CKBA 2IL8A 2A68D 4ZUJA 1LT5D 5BN3A 3CD6P 5F2NA 1SMYD 1ENCA 1IKMA 5D14A 1ENAA 1Q7YQ 4H0LC 4CKCA 4CJ0B 2QKIC 4IJHA 2PW7A 1WD1A 3TS2A 1HXYD 1KDBA 1Z6HA 2TSSA 4OO1G 2EYMA 5M5YB 4AYBG 1PYBA 2WINB 1OTCA 4P73A 1AUMA 2PEQA 4WJ4A 2L5TA 2PEJA 1FR3A 2EE1A 3B5IA 5JEAG 2EDGA 1LABA 1KABA 3NE5B 1BCPD 1RDPD 1VMPA 3CCEA 3T1YL 2EFJA 3H3VI 2A6ED 4LF4Q 2N3SA 1YNNC 1Q81Q 5KRUA 5G3LF 1AE3A 1EMVA 1VQ7P 4NXMQ 1GHKA 1PZJD 1S5ED 4GLVB 1G91A 4JBMA 5C3WA 1C7YA 4DPGA 2E75C 4GS3A 3PIPA 4LFCL 4GLAC 4R1JA 5IP7H 1G8ZD 3AFPA 3ER0A 4HMIA 5IY0A 2JE6I 1UAPA 5FKAC 5C5LA 2CNRA 2K14A 2R92G 4COCA 1YI2A 1WCMG 2KECA 3VR5A 2L6EA 1PRTC 4DV4L 1Q1BA 1WTOA 1WTHA 1HR0W 2N98A 3FMCA 2KGCA 2BH2A 4OWXB 1DGSA 3KFUA 1GHJA 4N8X1 3TQYA 1Y1WG 2GYKA 2EY2A 4DAYA 2JEAI 4JI6L 4DU9A 4DXGA 4J15A 3EA6A 1S5DD 1XNQQ 2R93G 2Q8IB 4U0EA 4KN7C 4X62L 1ZKOA 4IJLA 2B2VA 3QOJA 1RHPA 2Y0SE 3PO3B 2KOOA 3Q6SA 5FLXE 3GTKH 4JOIC 4X64L 5KNCA 2D62A 1K8GA 3OW2A 1NMFA 2JYGA 3BG3A 2Z6KA 2IX1A 3C1FA 3GTJH 1KHIA 4N9TA 2GZGA 2EJMA 4IFDJ 1MGSA 1EYGA 2F0IA 4XT3B 2CW0D 1RCVD 5EJWA 2WFWA 1O7YA 2KG8A 3CPWA 5EAYA 2KOLA 1Y8OB 3SK5A 4KTAA 3M7GA 1JT8A 1HNXQ 1D8LA 2AKWB 2PI2E 4ZKCB 5JJZA 2DUDA 1SJHD 4WRDA 4FF4A 2GN5A 4BPGA 2NVXB 2K5XA 1SNMA 3C46A 1HTPA 3I7FA 2L55A 3J80L 5C0XG 1D1DA 4JI5Q 1XTDA 1Q3LA 4GKKL 5C3EG 4B3MQ 4LFBL 1VQPP 2E8GA 2Y0SG 1TWGB 5CR3A 1X3OA 1IYVA 1LUZA 1IBKQ 2L0CA 2JU2A 1Y1VG 3K0YA 2JA8B 1Q46A 2XWBB 2A8VA 4MTKA 2ZXOA 1BAJA 1TWCB 2ES2A 3G28A 1VQMA 1TWHB 4MRTC 3NWSA 1HZCA 1RO0A 1IKLA 1KTKA 1AZQA 2MPMA 3CMEA 1IUQA 1J9OA 4DNTB 1Y8PB 4HMJA 2D9UA 5JJKA 4X66L 3LMOA 1GXDC 5M5WH 1F9PA 2MR8A 3OWEB 1DD2A 5C6AA 2HQEA 1BBWA 4ZAIA 1SFOH 3G6JB 1M90C 5DM73 1VQIA 2VLNA 4PG3A 3D0FA 1E1TA 2F4VL 1YBYA 4A93B 3VYTA 2M8LA 1F9SA 1QVFA 4DV5L 4A93G 3GO5A 3EIVA 3KUPA 1R4PB 2WB1B 1B3AA 1I4HA 3QIAA 4YY3L 5CV7A 3HOVH 4JYAQ 3URYA 4XIGS 3KLWA 4G57A 1PFSA 1OXSC 3D6WA 4A3EB 1DV5A 2RA4A 3LX0A 1SROA 2OARA 1FR2A 5IP7G 1PH5A 5C4XB 2RHSB 2JB0A 4A3BB 2XWJB 1GPJA 4A3BG 1G51A 5EGTA 1N8RC 3VDYA 2JA6H 1YNXA 5JVH3 4ME5A 1STEA 2JA7G 2F0PA 1U4PA 5LHY1 4FXDA 4KY6A 2F0JA 4HJ9A 1B4OA 1H9KA 2HD3A 3DMUA 4Q0FA 4ALPA 3S1MB 3Q20A 2KJXA 3OTOQ 3N6RA 2NO8A 1PA6A 1H95A 3TS0A 4A3KH 1IBLL 1HA5A 3T1HQ 3BZDB 1EY6A 4KJNA 3OTOL 4NXNQ 2DNCA 1A62A 3VYSA 5LMUL 4FYDA 4QQBX 4DR4Q 2SNSA 2LSSA 1SLJA 2UXCQ 1FD7D 2DJFC 1XPUA 2FVEA 3CC2A 1TY0A 4DR4L 3NTIA 1Q7YC 1EL0A 4RFBA 4V190 1K3RA 3FPPA 3CXCA 3K6OA 1S72A 3U43A 1GUNA 1XYIA 3IRBA 3G6EA 4A3DG 1T5XD 4C3IH 1BKBA 1VQNP 5FK9C 4IUTA 2E2JB 4XYOA 1GD7A 1RL2A 3NBIA 4XT1B 1KQSO 3I2ZA 3IFTA 3H4EA 3F2BA 5IGGA 1LYLA 2ENBA 1Z6MA 2EYOA 3F2DA 4P71A 3HOZH 1LM0A 4DV0Q 1CKMA 1IMPA 4QY7A 3CD6A 1K0SA 5FO9B 5DEHA 1YJ9P 2V1CC 3DPHA 4JOIA 3K80C 1EWIA 1S4ZA 1GO3E 5FJ8H 1I3QH 1H9RA 1D1IA 1LTBD 3VR6A 1IMQA 1HFGA 4JI2Q 4NDXA 4TKOB 4XYQA 5M3FG 3R8BA 3S1RH 1B3QA 2ZT9C 3LWEA 2JA5H 3EBEA 3MEHA 2JJQA 3KBGA 3E5SA 1QOHA 4XDXA 2FHSC 5CC4A 2JQOA 2JYLA 5D3IB 1GUTA 2AUKA 1RTOA 2R7DA 1RKNA 4F87A 4DUYL 3H0GH 3TP5A 4K6DA 2L11A 4WFN3 5C0XI 5LMNQ 2KCTA 1L1OC 1RO2A 3BVGA 2VW9A 1BQQT 1Q90A 3EFXD 5NUCA 1N8RQ 5BS2A 2KGDA 2D2CC 5KP8B 1YNJD 1CM9A 2B29A 2A5HA 1FJGL 2F3WA 4FXKC 4ABNA 4JPBW 3AQQA 4X6AH 4DNIA 4X66Q 3L3OC 3J81c 1AF8A 1ICFB 4A3DH 2BUOA 2A68C 5FLXc 4JCVE 2XVSA 3S14B 3CC7P 1FL0A 1KIXA 2N55A 3L7ZC 3LNNA 1CHPD 2AWOA 3HKZG 4I7AA 5CBAE 3P05A 2DJGC 4KI0A 4JI8Q 1HA6A 4HIDA 3CMAA 3GTOH 5JOBA 5J39A 3DEPA 4JVZA 3T4AC 1YITA 2NBFA 3EJDA 2QILA 3CCJA 2HIXA 3DUZA 5GQOA 3S1NH 2K5HA 1OXUA 3PGZA 5I6YA 4FF1A 1QE6A 1EQVA 2CVRA 4B3SL 2JA6G 4A3EG 1Y1WB 3M4PA 5F2OA 2XZ1C 1EYDA 1N34Q 2OCEA 3CCRP 1O7ZA 2BE5C 3IAYA 4K8JA 1XPRA 1SN8A 4KHPQ 2LXJA 1ZYRD 3R2TA 3MXNA 4L63B 3F2CA 3CCMA 3S1RB 1HNXL 4CDCC 2YYZA 5D65A 5CZDB 3ERQA 4J6HA 3PO3G 5DCKA 5E7NA 1B50A 4DV2L 2XGTA 1SYFA 1M6NA 1JOQA 4GNXB 2K5WA 3V05A 4LW1A 3FKIH 2B2WA 2PY8A 3GTLH 2ZJQA 3HOZB 4PQXA 3T16A 4RGNA 1EFID 2Z45A 1U0LA 4M0IA 4TRDA 3KF6B 2LMCB 3RR5A 3MFGA 3CHBD 1G2TA 1CUKA 4XQQA 1VQEA 4KKUA 3M4YA 3RLOA 5EQ0A 4K6LA 4BY1B 2KOSA 1HFNA 5C0XJ 3HG9A 3NPPA 1Z9FA 5ELDA 3D8GA 1CTMA 1SXTA 2R61A 1Q12A 2PZUA 1PZID 3D6CA 4PZ7A 3JAMi 2WV6D 2R7ZH 3H94A 1I4RA 2RCFA 2EYPA 2K75A 2VLQA 3Q23A 2PENA 2XV6A 1PTOD 1IYJB 4P74A 1BXTA 3CCQP 4XRQA 2FQ0A 4HKGA 2K93A 4ODGA 1TVXA 2FQ1A 2CKZB 1CKNB 4QIWE 1PH7A 2KENA 2JA5G 3SDZA 2N5HA 2F3VA 2O4XA 2PCFB 5KYIA 1OXTA 3RMHA 4N8FA 5BN4A 1QNUA 1MSGA 1YI2P 1T9HA 4YCUA 5IYBH 5C5MA 1Y1WH 1KLUD 2EG5A 1QUQB 3DS3A 4PMBA 3D3RA 2ATWA 2XRSD 3H0GG 4B3RQ 4X62Q 5J22A 3TN2A 3DS4A 5FLMG 1HNZQ 1B7YB 3GTJB 3A5UA 2F0WA 2A6HC 2NZ1D 4CJ1B 3GTQB 1Y14B 2C5CA 2KVMA 3U9SA 4X65Q 1PH3A 1V1PB 1XXGA 5CMDA 2LIUA 1K8OA 3F2UA 5TSSA 2AQ2B 1VQNA 1HUNA 3GTOB 2YU9B 2QDLA 4DV3L 1VCIA 4F7XA 3G48A 2DNEA 3RZOB 3Q24A 4NPSA 1R9TH 2FMMA 4DAPA 3OIQA 2K5QA 2F0GA 3DXJC 2TMPA 3RG6C 3KF8B 4OIJA 2FADA 1PFNA 2WPTA 4YCVA 4EX5A 5HY6A 5CV6A 2EYLA 1LO5D 3FRPB 2JP1A 4LF5Q 4BXXH 2EIAA 1RF2D 3MXNB 2IW3A 2KGAA 1VQLA 3H91A 5D3DA 4RCOA 2RDFA 1A3UA 4DR5L 3HOUB 4Y52H 5AJ3L 2JA7B 3PIOA 3S24A 3A74A 4X3UA 4IFDI 1W6KA 4IFDG 3CC2P 2A6HD 5HVCA 4IZ8A 4RHRA 4DA2A 1HHVA 2LXKA 3I4NB 3QOLA 1QB5D 3OMGA 2ALYB 1LT6D 4A3FG 1VF5C 3GTMB 3EROA 1E2WA 3ERSX 3J7ZC 2PPBC 2GVBA 5E1FA 2VQFL 4BY7H 2SOBA 2MO1A 1D1KA 2K0XA 1QVGO 2JA6B 1JC7A 4XFXA 3V96A 1E0BA 1PRTD 2WACA 3M9BA 2Z44A 4BS9A 4BY1H 3OPOA 3ONAB 4RWSC 1STYA 1O7IA 3X3MA 4LF6Q 1FNVA 1A6XA 1D5XC 1M4VA 1I4XA 1XWEA 4RMFA 3OW2O 2MHVA 1EIAA 4LFBQ 2F1MA 1YEZA 2L15A 2HDLA 3NTKA 3BU2A 1X3EA 3PIP3 1YJWP 4OELB 4JI3L 5BN5A 3EQLC 2Z4IA 4IUUA 5CV4A 2E2JH 1Q81C 2HDMA 4A93H 1A3TA 1VHNA 1VQDA 3CW2C 2CWAA 1N36L 1CZWA 5JEAH 3K59A 3LGJA 2FMCA 1KDCA 1TIID 3Q22A 3FP9A 3A8IE 4LFCQ 2AFEA 4K0KL 3ULPA 1STGA 3HOWB 5M5WB 2B2YC 2HCIA 3P1HA 3M85A 3EJEA 2B8GA 3T53B 3I56A 4FVMA 4K0KQ 4HJ5A 1FJGQ 2B2WC 2I5HA 3SXHA 2EIFA 1KD1C 4GOPB 1Q8IA 1IL8A 3PF4A 1KLPA 5JEAJ 4AQYL 3DWQA 3TP8A 3GTPH 3WDNA 1PRTF 1U4RA 1EOVA 4JI2L 3S15B 3DHQA 5IYDH 1VQFA 5FJ8G 2F0UA 3P20A 5JAVA 2XT1A 2FJ2A 1TY2A 4CKEA 3Q0AA 1YJWA 4XQJA 4LWCA 4PXHB 4EVOA 1J5EQ 2FQ2A 4LF8Q 2ZTDA 4ZQ3A 1VQ6A 2E2HB 2IPKD 2MF4A 2Z46A 5C4XH 1B1ZA 3K0XA 3I3CA 3RZDH 5DAUA 2PEIA 1X9NA 2AHOB 1N36Q 3UDFA 3DS2A 2NVTH 1SDFA 1Q86Q 3SK4A 3E2DA 2AF8A 2ERHA 2F0MA 2MQHA 4S3SA 1VQ9A 4DK6C 1EQQA 1O7LA 2RVLA 3CC4A 3CF5A 3PUVA 1YVCA 2YV5A 2R93B 2I46A 2NWGA 5HGOA 1N34L 3S1MH 1KXLA 4DXFA 1E7ZA 1E2ZA 4HTHA 3KJOA 3UI2A 3WOFA 4PMCA 1K0RA 3SEBA 3HKZE 2AQ1B 2QNWA 4LUZA 1KC8C 1WTPA 2CQAA 4JBKA 2ZXPA 2K7VA 3QO2A 3GZMA 1J8IA 4F8MA 1IL2A 1CSQA 1XJVA 5DM63 4OL7A 4AQYQ 2UXDQ 2E5LL 1Y69U 3GTGH 3CCEP 3KF6A 4FDBA 3H47A 3CCJP 1F80D 2HHHQ 4JI7L 1CK1A 2CFMA 4RKLA 3CCSA 1UE7A 4H2XC 1HTLD 1SYEA 3DEOA 1TXYA 2DGYA 1JWUD 2I5LX 2MO0A 1WTQA 1TWCH 4LUVA 2MFIA 4C2MH 2R92H 3G21A 4KY7A 1KLGD 4XROA 4JI1L 3M3YB 1E0HA 4DR3L 2AQ3B 4X3TA 3L0OA 1S5CD 2UUAQ 1W2BO 5CBEE 4CJ2C 1ICWA 5J1ZA 5KNDA 1VQKP 2K03A 4DAYB 1ILQA 5EBCA 5ELBA 4H02A 5BS1A 2JA8G 5LMUQ 2PZTA 1BR9A 4UY8C 3PUZA 2N6ZA 2K5NA 1S72P 2I5MX 1XX8A 5IOCA 1SBBB 1CA5A 5AJ3Q 4TVAB 1U4MA 1JCKB 4JI6Q 2K1BA 2BDNA 1A8VA 1FVIA 3J80c 3H3VH 2BOSA 1WTXA 1LT4D 2EZVA 4J1MA 3PQIA 3I4LA 4FF2A 3FHWA 4DF7A 1HZ9A 3PO2B 1JICA 2N8NA 1BCPC 1I50B 4KMUC 1GXGA 1L0IA 4JBWA 2N6YA 1YHQP 1VS0A 2K52A 2UU9Q 4RH6A 3BS1A 1G6PA 1WCMB 4CGYB 2PI2A 5IGBA 4TQUS 4XFZA 2B2YA 2WKCA 1W2BA 2AUJD 4DR6Q 2JA5B 1MJEA 1HPCA 2VY3A 2LL8A 3NBHA 1DONA 3NWTA 1KC8Q 3NXWA 3TEHB 2NN6H 4A3GH 2LKIA 4U0FA 1RJTA 4RGMA 4GKKQ 3BDOA 3I91A 1L2FA 4BPFA 1CKNA 2E2IB 1SMYC 3K57A 1X3FA 2AVAA 3CCRA 2EQSA 3RN2A 3BYYB 1E3PA 3U9OA 3PF5A 2KOPA 1H9SB 3TREA 5IYBG 2RSNA 3NEMA 1M6EX 2L4BA 2A19A 1SYGA 1V1PA 4HCEA 1TWHH 3E3XA 2EOTA 4PZ8A 1C48A 3GJNA 5FOBB 1XPOA 1JOOA 2NZOA 2V4DA 2AFDA 4LUOA 2R7FA 3WOEA 1L1OB 4C56C 1G6ZA 4QGUA 1B53A 1BO0A 2GVAA 1SE3A 5EPJA 1HR0Q 3CCLA 1R9TB 2RBMA 1O78A 3S2DB 1MI2A 4QNBA 4A3MB 2K5DA 4DV7Q 1K9MQ 4QUCA 1QNKA 4ID6A 3KDFB 2Z4HA 1AN8A 4UPAA 1IXRA 4GLXA 3A0JA 3VR4A 1YIJP 1IBMQ 1NNXA 2N50A 2VS1A 2F0LA 4UAIA 2CH4A 1WVLA 1HY8A 4UP8A 3L9AX 3A7AB 2K92A 4BXXG 4DR5Q 1IBML 4DAVA 2CH4W 3NTEA 2CQOA 2NTTA 3M4QA 3E0EA 2E5LQ 4C1NI 3P75A 4DN4M 5CYUA 1F2YA 1AH9A 3R3OA 4K5XA 1X3QA 2Z9HA 4B08A 4B3TQ 2SDFA 2PO4A 1EFWA 3MXGA 4P2CB 4QL5A 4A3BH 2L9HA 2KEEA 4WORA 1MSHA 3CCQA 3JC66 3W1GA 3K5LA 1HZAA 2VB2X 5EPLA 1HQBA 2XN9C 2F4VQ 1PTOC 4UHVA 1ZMBA 4A3IH 3GTLB 2KQ3A 4ZUIA 2BA0A 2JO0A 2BE5D 4DNRB 5FO8B 4ZLTF 2A69C 1KNEA 3U4VA 2NUCA 1EWHA 4GNXC 3I55P 4A3LH 1A8OA 4A76A 2QF7A 4DG9A 1FNUA 5KIXA 1KRTA 3HOXB 4HIMA 2WB1G 4C3HH 3BZKA 4BA2I 1MKHA 1NSNS 5C3EB 1YNND 3RLFA 1NAPA 2KA7A 1Q86C 1XNRL 2VUMG 2EXDA 2H1EA 5BR8Q 5GADC 1TT2A 1CZGA 3SVMA 2F0DA 5EKIA 2Z8LA 2NTSA 4IQZA 3I73A 3TSSA 2UUCL 3GZLA 3EN2A 4HIOA 4QB4A 1H9MA 3S14H 1SJED 3BDCA 1NY4A 3A5ZB 5ELFA 4HJ8A 1TQOA 2F03A 3S17B 2M2LA 4K5WA 3RLNA 1VQOP 2N49A 2WP8J 4C2MB 1N9WA 3I70A 5T1GA 5KNBA 5I2XA 3GKLC 4FO2A 1S40A 2EYHA 3N52A 1TWGH 1EOQA 1ML0D 5GAEC 1I6VC 1BUVT 4JG2A 5T1IA 3G1IA 3LWUA 4A3GG 1PVOA 3MWYW 1EEID 2MY5A 1PTOB 2QGQA 2Q2HA 4EGVA 4NB3A 1HUMA 2EJGC 3J81j 3OMCA 5HGMA 2P9XA 1WCMH 4LF5L 5C44H 1B70B 3UDGA 2GZEA 1UE5A 3NHHA 4IUPA 4BBSB 3VRLC 1YITP 4YY3Q 3J81L 4DKAC 4B9XA 1EY5A 5HV8A 2HHHL 2L0QA 3K5MA 5C4XG 1G2SA 1PRTB 2X69A 1VQ9P 2LPKA 3H0GB 2R93H 1ET9A 4K5VA 2FACA 1YHAA 2ID0A 2B8FA 2PEOA 5HGQA 2K01A 1PH2A 1X3PA 5M5YH 1N33L 4OO1I 1JB7A 2ZJRA 3I4MG 2Q2IA 1J6QA 4EQOA 1SNOA 4ME3A 4DK3C 3R2IA 1G291 2KCCA 2KR5A 3K7AH 1VQHA 4IN3A 4DV6Q 5JPMC 3KLRA 1MJCA 1CSPA 3W5OA 4UP9A 4PZ6A 4JI5L 2IT1A 1I6HH 1GUGA 2OTJA 3MA2B 3QB3A 4KV6A 3VYUA 4FP5D 3IL8A 1II3A 3F1ZA 5F2KA 5ELOA 1PH6A 3WBHA 4H2WC 2F52A 3NK9A 3T1YQ 2FHTA 4MIUA 4KJOA 2OQKA 3NTHA 3DS1A 1WYDA 5M5XH 1QVGA 3VR3A 4DV5Q 4BBRG 1M74A 4HSVA 3MZ5A 5CV8A 5KP6B 3ND9A 3I72A 5M9OA 2YU9H 2B2VC 1OXXK 3HP3A 4I7ZC 3CMAP 1SE8A 4DFAA 4PV1C 2AWNA 1YHQA 3HEJA 2WIIB 4OIKA 4RGOS 3GTPB 4HCSA 2CG5B 4YIJA 4HIKA 3J7AV 3I8ZA 1L0XB 4ILWA 3SHLA 4DR2Q 2JU1A 2DY7A 1WOCA 3HRZC 1VMCA 1UNSA 3AMUA 1TWFH 1YJNA 2MGSA 4RG1A 1ILPA 2CQ8A 1OXVA 4RA8A 1TS5A 2PQAA 2JQ4A 1YZ6A 3ICEA 4AYBB 4R4OA 2JGPA 3UE0A 5A2QL 1VQ5A 4O42A 4IZ6A 4M8AA 1R4QB 1I50H 2RSOA 4J8QA 2MUYA 3S1QH 3AEVA 2RDHA 4C3HB 3M3YH 4IALA 3A7LA 4MN3A 1ACPA 2E74C 1EY8A 2K94A 1LTID 1VQLP 4DR6L 2O2LD 2LTEA 4K2LA 2RHQB 1D5MC 1QJOA 1K28A 3HOWG 5K36G 2EY1A 3G6EP 2G5DA 3PUWA 3SGIA 3D4RA 4PWVB 1SYCA 4WYMA 1HH2P 5JVG3 3I4NH 1VKUA 3GTGB 3Q8DA 4OGQC 4OX9L 3O13A 4YCWA 1BBUA 3M4OH 5M3MB 3G29A 5IGCA 1IW7C 3X3NA 2PYKA 3GV6A 1Y8NB 3SE0A 2ASBA 1EIHA 5FLXL 3E6ZX 2GA4B 1HZBA 2M8PA 1PYWD 4IPCA 4A3GB 1LV9A 2UXDL 4MTNA 2QEXA 1WTVA 5LMNL 1HQMC 1S5FD 3DWAA 2L9FA 1KNAA 5IYCG 4A3KG 2ROQA 1C4QA 1VQKA 1CQFA 1NBWA 2D5DA 3KJPA 4BY1G 5C4JB 3K7UC 1NCVA 1VQ6P 1TS3A 4A3JH 4A3MH 5EW5E 3KBXA 1I4PA 1SFOB 2IX0A 1AEXA 3DWPA 1BNZA 1NE3A 2Q2TA 4HN7A 4GKJQ 1IBLQ 4DK1A 1Z7TA 3DS0A 3T56B 3CCVP 1F2MA 1D5ZC 1A3VA 1PTOF 3AU7A 4UP7A 2L22A 1NUCA 4H2YC 1X54A 2IHEA 2MR7A 2IWHA 4U0DA 4CHTB 1KD1Q 3HOZG 3VA5A 1SEBD 1HNZL 5CV9A 2OWOA 5J3BA 3NENA 1TR5A 4IPDA 1YHBA 1XMQQ 2UUBQ 1DYQA 1NJIQ 2KHJA 4ZKBB 2XSCA 2ONTA 1IZ6A 2VB3X 1WI5A 2F0HA 1B8AA 3OWFA 4CDEC 4DUZQ 2X2BA 3ULJA 4AIMA 1UJZA 2QEJC 5COYA 4C3JB 2NVYH 2UU9L 5L37A 2XRQD 1C8CA 5A2QE 1XTCD 1VQ4A 1YNJC 2MJ8A 1JOKA 4IO9A 1Q1EA 2VQEL 2R7ZB 2VNUD 1N32Q 3CE7A 3I56P 1GUOA 4RGTA 3W1BA 4HSPA 1UE1A 1Y1VH 2VZAA 2Y0SB 1PMRA 4IPYA 1RODA 5K5PA 5IYCH 1I4GA 5IT9E 3KK7A 1W3SA 2EXZA 5A35A 5IODA 2CGQA 2LF4A 1SE4A 3J81E 1SAPA 3TP6A 3S9WA 4OXPA 1C9OA 4YWLA 5FO7B 4LF9L 4NXML 2F4IA 1CA6A 4Z9CB 5KYLA 1EOTA 2VUMH 1QVCA 4X3SA 1BCPB 4F37A 3AFQA 3OIPA 1BXIA 2KEDA 1T8KA 4LJZC 3CRKC 3HS0C 4A3JB 4H7BA 1VQ7A 5HGLA 2NN6I 2K05A 1ZYRC 4POFA 2LKVA 3MTSA 1DOKA 1UEAB 1DOLA 3HOWH 3SK6A 3FVQA 3C1EA 1V1QA 2FINB 3HOUH 1ZEQX 3D4WA 3JAME 5I4TG 1K3BC 4CDDC 2KG6A 1JJGA 3QWNA 1BBXC 2B2TA 4KD3A 1ESRA 2B63H 3A54A 3UE1A 3EJBA 4FNFA 4WJWA 1VQMP 1V8QA 4NXNL 3T1HL 2EHSA 1A63A 3TP7A 2KHIA 5C3EH 2PQEA 3JAMc 2CCZA 2OT2A 5M5XB 4GR2A 4XQNA 3OHXC 3HKSA 1DNYA 1CKOA 1JWMD 3J7A5 1GKHA 1BCPF 3B6YA 1VQJA 2LS01 2ZJPA 1RNIA 3RG2A 1MBYA 4QF4A 4JI4L 1NJIC 2K33A 1LTAD 4PMWA 1S5BD 4A3LG 1SR3A 2HT1A 2EPBA 1EU4A 2WAQG 2B3GA 1NR4A 2E2IH 3I4MB 2JAZA 2MVUA 2X6GA 2PEKA 2Z1CA 2PQAB 3G1GA 2UUAL 2A1AA 3K8AA 5CORA 4OEMB 2F0FA 1W6JA 1JJCB 4HAEA 4KHPL 3G7LA 2Q8RE 1QZGA 3U50C 3C2PA 2AMCB 3OOCA 2NVQB 3GV3A 2JK8A 4QKOA 4C3JH 2K28A 2XNAC 4OHJA 3MXUA 5C4JH 2JBGA 1ONLA 4RHSA 1I4QA 1DM0B 1GOZA 3TZDA 5KEEA 4B3RL 2I0QA 3V2TA 4LF6L 2BH8A 3SR1A 1AYIA 3ULLA 3RNUA 1VQBA 3PV0A 1STHA 4RKBA 2ZTCA 5BR8L 1JMCA 4GN3B 3D4DA 2G9HD 2PMZB 2A74C 2LOLA 4BBRB 4PH0A 2B39A 5DLQE 3E9IA 4R8IA 2R3ZA 2VL6A 1PV4A 4LMQD 2N88A 1K30A 2GDWA 1VDZA 1B44D 2Z6BA 3DLLA 3RUZA 3HYBA 4A3CH 4H13C 2KUMA 3NQIA 4A3FH 1CEIA 2ICIA 1LTSD 1VQ8P 5IT9c 1SMXA 4Y7NH 3J81i 1BF4A 1UE6A 2FFKB 1C0AA 4JK1C 1EZ8A 2JA8H 3S16H 1EIFA 3QJYA 1KL9A 1DJRD 2LFNA 3KLSX 5IGDA 5JPNC 4X3KA 7CEIA 3OW7A 2QDBA 2UXCL 4CA3A 1I94L 4JI0Q 1KQSA 4JI4Q 2PNRC 1PYSB 2SEBD 4KHZA 2A69D 1UEBA 4BBSH 2ZM6L 1K9MC 3R93A 2DNWA 2L4NA 4GN4B 1SNCA 3FDTA 2ZM6Q 5HGNA 4C3IG 4N9PA 1P16A 4R8NA 5EBDA 5I4DA 1JORA 4LF8L 1ASYA 1LT3D 2QCPX 2KGEA 4XFYA 4M1UB 4DR7Q 3KF8A 1ENFA 3CP0A 4NKLA 1QZHA 1EQRA 4B3SQ 5LL6X 5EKLA 1MZ8A 1V9PA 2RDGA 4QUFA 5IP9H 3CXCO 1K8AC 2MD9A 3CQZB 2PEMA 2GZJA 4DR1Q 3F8TA 4RAUC 1FNWA 2KWLA 2ICEC 5EKKA 1HR0L 3G0VA 1JE4A 1X65A 1HCZA 2F3IA 4L5QA 3VA7A 5K36H 1EQTA 4R4TA 3J80E 1PH8A 2NN6G 4LF9Q 3GTMH 2R92B 4EQPA 3M4OB 3ZYYX 1STAA 3H15A 3NUCA 1AW7A 2R6GA 4A3KB 1OO9B 3FPUB 3STBD 3AB9A 4HEDA 4TSSA 5IYDG 1I6HB 2MP1A 1DZ1A 4A3CG 3SK8A 2UUCQ 3KYHC 1TS4A 1LTLA 1YJNP 4EQNA 2EYJA 3DTJA 4U0CA 4YHHL 1PH9A 4JV5Q 1U5KA 4DUYQ 4LF4L 4H44C 1U4LA 1DOMA 2C9OA 3S1QB 2HIVA 2OEOA 1JQYD 2K4KA 2B2TC 1D6EC 1PXUA 2M5RA 2J0TD 4QJFA 3BDLA 2DY8A 4NMZA 4R4IA 1SE2A 1JJ2A 1TWFB 3CCUP 1BDOA 1F9QA 3NQTA 4O0AA 2FAEA 1L1OA 2L1BA 4U68A 1DCZA 1UWVA 1LLRD 2B2UA 2JXMB 1P8LA 3I55A 3NY7B 4P75A 1RD9D 2K0YA 4ZK9B 4KKSA 2B63B 2OTLP 1PFMA 1TKWB 4IUNA 4OWWB 1GJXA 5M3FB 4IUQA 2XZ0D 2KORA 1EYCA 4L5RC 4QCLA 5E3FA 4AH6A 2QA4A 2KCMA 4E6IA 4XXEA 1D7QA 2PZWA 1SRUA 1GXHA 4GOPA 1RIPA 2R7ZG 1EY0A 4R4QA 3PO2G 3CRLC 4X64Q 3S15H 4DV6L 2X6LA 5IWAQ 1K8MA 4A3EH 4GKJL 2NVXH 3NELA 1IYUA 2O5IC 5C0XH 4F88A 1NR2A 2IX3A 1Q82C 2GDYA 1Y1VB 1K8AQ 3CU7A 5E4WC 2G9DA 3BZCA 4U0BA 2LY7A 1BVSA 3MXPA 3M7NA 2NVTB 3ND8A 4JC0A 1YIJA 3EJIA 3DM3A 2EYFA 4ULLA 1GUWA 4L8JA 3S1NB 3B4QA 3W2DA 3M1MA 2IJ0A 1N33Q 2QW7A 2GZFA 1CT1D 5LMNW 4YHHQ 1M1KC 3TRZA 1L0HA 4K8IA 4KN4C 3FKIG 4ZRZA 4KK7A 2UXBL 1XNQL 2LIWA 1VQGA 4A3JG 3PMFA 1O80A 1J5EL 3A56A 3K5NA 2UXBQ 3QG1A 4BWGB 1KAWA 4OO1H 3LRYA 2CWPA 3JAML 1N32L 1PLFA 1S3OA 2K5VA 2EHTA 2A6EC 4CBVA 4O2DA 1K83B 1EUJA 1HRJA 2YTXA 1GVPA 5IP9G 4JW0A 4HR7B 5HURA 1TWAH 2HUGA 2F0NA 2FVAA 4C3IB 2NYZD 2OTJP 1KDAA 4DR1L 5ELEA 1M90Q 1WTWA 4QIWB 1WJJA 4C1NK 1I5FA 1JJ2O 3KDFA 2PMZE 4L6TB 1QG7A 5IIFA 3S2HB 3HOYB 4OX9Q 3PUXA 4P72A 1D2BA 4COPA 5C44B 1K73C 1HQRD 3HOYG 3VR2A 2C35B 1FYCA 5JJIA 3MAQA 4NW2A 3D31A 3HOXG 1QUQA 1LTRD 1Q8KA 2ZXRA 4L5TA 3H0DA 3ZJYC 2JA7H 3A8KE 1F9RA
chains in the Genus database with same CATH topology
4B3MQ 4LFBL 2XT1A 1VQPP 2E8GA 1HZBA 1YJWA 2Y0SG 1HJPA 1XMQL 2M8PA 2UUBL 1KRSA 4IPCA 1LUZA 4LWCA 1XMOQ 1IBKQ 1Y1VG 2UXDL 1J5EQ 4MTNA 2QEXA 4LF8Q 2ZTDA 1Q46A 1VQ6A 2CWOA 2RCNA 5LMNL 2A8VA 2Z46A 5C4XH 4BY7G 5IYCG 4WJ3M 1BAJA 4DV1L 5FLMH 4A3KG 3K0XA 1VQKA 2ES2A 2Q2UA 3RZDH 3U58A 3G28A 1VQMA 2PEIA 1X9NA 2AHOB 1NBWA 1N36Q 1VQPA 3UDFA 2UXDQ 3DS2A 4BY1G 3KJPA 2NVTH 3I4MG 1Q86Q 1HZCA 3E2DA 1RO0A 3K7UC 2MQHA 1VQ9A 4DR3Q 4DK6C 2OTLA 1EQQA 1VQ6P 3CC4A 3CMEA 1IUQA 3CF5A 4DV3Q 2M8NA 3PUVA 1YVCA 3RZOH 2YV5A 5JJKA 5HGOA 4X66L 4A3JH 3WWVA 4A3MH 1N34L 3S1MH 1KXLA 1E7ZA 5M5WH 3KJOA 4A75A 4X65L 1K0RA 2IX0A 1BBWA 2WAQE 1NE3A 3HKZE 1SFOH 4IOAA 2Q2TA 4GKJQ 3CC7A 1M90C 3NBHB 1VQIA 2JEBI 4PG3A 4LUZA 3D0FA 4A4IA 3PUYA 2KBNA 4APVA 1KC8C 3DS0A 1E1TA 4JBJA 4JBKA 2F4VL 1YBYA 2M8LA 1WFQA 3CCVP 1QVFA 4DV5L 4UP7A 4GNXA 4A93G 3GO5A 3EIVA 1M1KQ 4DV4Q 1X54A 2IHEA 4U0DA 4YY3L 1PH4A 3HOVH 1KD1Q 1IL2A 1CSQA 4JYAQ 1XJVA 3HOZG 4XIGS 4AQYQ 3KLWA 1HNZL 1PFSA 4JI8L 1OXSC 2OWOA 5J3BA 1IBKL 2E5LL 3NENA 4IPDA 3CCEP 3KF6A 3GTGH 1YHBA 4FDBA 3H47A 3CCJP 1XMQQ 2UUBQ 1NJIQ 2KHJA 3OYYA 2HHHQ 4JI7L 2CFMA 2B63G 2ONTA 1IZ6A 1SROA 1UE7A 1WI5A 2MNAA 3CCSA 2OARA 1B8AA 4DUZQ 4KLKA 3ULJA 1TXYA 2DGYA 4AIMA 5IP7G 2I5LX 2NVYH 3CC4P 2BA1A 2K50A 2RHSB 3UDIA 2MO0A 3HOYH 1TWCH 4LUVA 1YJ9A 4YWMA 2MFIA 4C2MH 5M3FH 2R92H 3G21A 1JE5A 2UU9L 4BA1I 4A3BG 5IWAL 1G51A 4AYBE 4XROA 4JI1L 1N8RC 3VDYA 2JA6H 4BBRH 3HOXH 2KODA 1YNXA 5M3MG 4DR3L 3L0OA 1VQ4A 4IO9A 2JA7G 1Q1EA 2VQEL 2UUAQ 2VNUD 1N32Q 1W2BO 3I56P 4HJ9A 3W1BA 4ALPA 1VQKP 3Q20A 1UE1A 1Y1VH 2VZAA 2Z0SA 3I4OA 4DAYB 1VQCA 3OTOQ 4IPYA 4H02A 1EIYB 1PA6A 5BS1A 4IPGA 2JA8G 5LMUQ 5IYCH 1H95A 1VQ4P 3TS0A 4A3KH 1XMOL 1IBLL 3PO3H 3T1HQ 4UY8C 1W3SA 2HQLA 4JI0L 3OTOL 3PUZA 4NXNQ 2K5NA 1S72P 2I5MX 2LF4A 1A62A 5LMUL 4MZ9A 4DR4Q 1Q82Q 4QQBX 2LSSA 1SLJA 2UXCQ 3G26A 5AJ3Q 4TVAB 4JI6Q 4OXPA 1XPUA 1C9OA 4YWLA 4XTCS 3CC2A 3CCSP 1A8VA 4LF9L 1FVIA 4DR4L 3J80c 1Q7YC 4NXML 1NTGA 3H3VH 4BBSG 3S2HH 1K3RA 4HJ7A 2VUMH 3CXCA 4A3MG 1S72A 3CPFA 4R4CA 1QVCA 3FHWA 3IRBA 3G6EA 4A3DG 5GROA 1HZ9A 3AFQA 4C3IH 4IOCA 1BKBA 2BHVA 2N8NA 1VQNP 3CQZH 3CCVA 5H1SE 1GD7A 3HFZB 1A0IA 1RL2A 4DAMA 5HGLA 1VQ7A 4LNQA 2NN6I 4JBWA 1KQSO 3I2ZA 1YHQP 4DUZL 1VS0A 2K52A 3H4EA 3F2BA 2UU9Q 1PH1A 4POFA 1LYLA 1G6PA 3F2DA 2PI2A 3HOWH 4P71A 4TQUS 3HOZH 1LM0A 4XFZA 1W2BA 1V1QA 1CKMA 1V43A 4QY7A 3GDEA 4GN5A 4DV0Q 3CD6A 3HOUH 4DR6Q 2D0PA 1MJEA 4EQ5A 5I4TG 1JJGA 2VY3A 3DS5A 1E22A 5GAHC 1YJ9P 2V1CC 4DV0L 2B63H 3MEFA 3UE1A 3DPHA 1KC8Q 4JOIA 2RF4A 1VQMP 3TEHB 3K80C 2ZTEA 4NXNL 4A3GH 4U0FA 1EWIA 4GKKQ 1GO3E 2JA9A 3T1HL 4DR7L 3G71P 1I3QH 5FJ8H 1A63A 2KHIA 4IPHA 1L2FA 4JI2Q 3KOJA 3JAMc 5C3EH 5M3FG 2CCZA 2XTIA 1CKNA 4YWKA 3S1RH 5C44G 2JA5H 4GR2A 3EBEA 2FXQA 2JJQA 5M3MH 4A3IG 4JV5L 1X3FA 3CCRA 3G4SP 3HKSA 1CKOA 2EQSA 3RN2A 3J7A5 1GKHA 1E3PA 3B6YA 1VQJA 2ZJPA 1RNIA 3MGEA 3TREA 2JQOA 5IYBG 2JYLA 1K73Q 3PF5A 1NJIC 4JI4L 3NEMA 1M6EX 2QEXP 2A19A 4PMWA 2R7DA 1AE2A 1SR3A 4A3LG 1E1OA 2HT1A 4DUYL 1TWHH 1QVFO 3H0GH 2WAQG 2B3GA 4DV1Q 4PZ8A 2E2IH 1X6OA 5C0XI 3RN5A 5LMNQ 1XPOA 2PEKA 2NZOA 2KCTA 1L1OC 2PQAB 1RO2A 3G1GA 2A1AA 3K8AA 2N78A 2VW9A 2VQEQ 2UUAL 2R7ZG 3E9HA 1N8RQ 5BS2A 1JJCB 4LUOA 2R7FA 3CCUA 4JI7Q 4KHPL 1L1OB 2E2HH 1QZGA 2B29A 3U50C 4QGUA 4LF7Q 2AMCB 3CCLA 2GVAA 1FJGL 1HR0Q 4X6AH 3AQQA 4DNIA 4X66Q 2JK8A 3J80i 4C3JH 3J81c 3I4MH 4LF7L 3G71A 4QNBA 2BUOA 4A3DH 3S17H 2D0OA 5C4JH 5FLXc 4JCVE 4DV7Q 1K9MQ 4JI1Q 3CC7P 1FL0A 1KIXA 3L7ZC 3KDFB 4B3ML 4PH1A 2AWOA 4B3RL 4UPAA 4L5SA 5IE8A 1IXRA 3HKZG 2VQFQ 4GLXA 2I0QA 3HOVG 3P05A 4KI0A 4JI8Q 3A0JA 4DV2Q 1YIJP 2BH8A 1IBMQ 4LF6L 2VS1A 4GR6A 3ULLA 4HIDA 3RNUA 4JYAL 3CMAA 4UP8A 1VQBA 3PV0A 3GTOH 1VQ5P 4BXXG 4DR5Q 2ZTCA 3CMEP 5BR8L 1YITA 4GN3B 1IBML 1E6JP 1JMCA 3NTEA 2CQOA 5JPAA 3K81C 3E0EA 3M4QA 2E5LQ 3CCJA 4PH0A 1AH9A 2HIXA 5GQOA 5DLQE 3E9IA 3S1NH 2K5HA 4B3TQ 2OQ0A 2VL6A 1OXUA 3PGZA 1PV4A 1EFWA 4QL5A 4LFAL 3CCMP 1K30A 4A3BH 2YTVA 2IY5B 4B3SL 3CCQA 2JA6G 4A3EG 1ASZA 3M4PA 5F2OA 3DLLA 3JC66 3W1GA 1N34Q 2OCEA 3CCLP 3HYBA 3CCRP 1HZAA 4A3CH 2H5XA 1XPRA 1SN8A 4KHPQ 2LXJA 2WB1E 2F4VQ 4A3FH 4HJAA 1VQ8P 5IT9c 4OONA 1ZMBA 2Z6KC 3F2CA 3CCMA 1SMXA 4Y7NH 3J81i 4A3IH 1VQOA 2E1MA 1HNXL 1UE6A 2BA0A 2JO0A 2YTYA 2YYZA 3PCOB 1C0AA 2NVQH 2JA8H 3S16H 1XNRQ 1EIFA 4DR2L 5JJLA 1KL9A 3PO3G 5DCKA 3U4VA 5E7NA 3STBC 4DV2L 4GNXC 3I55P 3UDXA 4A3LH 2UXCL 1A8OA 1I94L 4A76A 4JI0Q 1KQSA 1VQ8A 4JI4Q 1X56A 2XGTA 1KRTA 1M6NA 1PYSB 4KHZA 4GNXB 4HIMA 2WB1G 1UEBA 4C3HH 4LW1A 3BZKA 3L2PA 4BA2I 1FGUA 1MKHA 3FKIH 2PY8A 2IHFA 3RLFA 2ZJQA 2ZM6L 4JI3Q 1K9MC 3GTLH 4BBSH 3GTQH 1XNRL 1QRJA 1Q86C 2VUMG 2EXDA 4GN4B 5BR8Q 2Z45A 4POGA 2QA4P 1U0LA 5GADC 4M0IA 3KF6B 2ZM6Q 5HGNA 3RR5A 4LFAQ 1P16A 3AYHB 1CUKA 5GAGC 4LF8L 1ASYA 2UUCL 4B3TL 4BXXH 1VQEA 3EN2A 4HIOA 3BJUA 3RLOA 3CPWO 4XFYA 2ASBA 4DR7Q 4U0AA 3CP0A 3S14H 1E24A 1QZHA 1X55A 1EQRA 4MNOA 5C0XJ 4B3SQ 1NY4A 1V9PA 3A5ZB 1Z9FA 4HJ8A 5IP9H 1A43A 3CXCO 3CAMA 4OWTB 1K8AC 3RLNA 1VQOP 5ELNA 2PEMA 2N49A 2WP8J 3S2DH 3U4ZA 1Q12A 3F8TA 4DR1Q 1N9WA 4GOPC 1K83H 1HR0L 1S40A 3G0VA 1VQAA 4PZ7A 3JAMi 3HOUG 2PNHA 3G4SA 1TWGH 1EOQA 1X65A 1MIUA 1GM5A 2F3IA 4L5QA 2R7ZH 3PO2H 1IBLQ 5GAEC 4DV7L 3GD7A 2K75A 4JG2A 4R4TA 3G1IA 2XXMA 1PH8A 5C0XG 2PENA 2XV6A 2NN6G 1IYJB 4P74A 1PHJA 4LF9Q 3GTMH 4A3GG 3CCQP 1PVOA 4XRQA 1L0WA 2QGQA 3I4NG 2Q2HA 4NB3A 3H15A 1HNWQ 2CKZB 3J81j 1CKNB 5HGMA 2P9XA 4QIWE 2R6GA 1PH7A 1WCMH 2KENA 4LF5L 5C44H 1B70B 3STBD 3UDGA 2JA5G 1UE5A 1OXTA 1HNWL 5IYDG 1I94Q 1Z47A 4A3CG 1X3GA 1T9HA 1YI2P 3VRLC 1YITP 3HZQA 3KYHC 4YCUA 4YY3Q 2UUCQ 1LTLA 1YJNP 1NMGA 4DKAC 5IYBH 2NZHA 3DTJA 4U0CA 4YHHL 1Y1WH 3PSIA 1PH9A 4JV5Q 2EG5A 1U5KA 4DUYQ 4LF4L 1QUQB 2HHHL 3DS3A 2ATWA 3H0GG 5C4XG 4B3RQ 4X62Q 3CD6P 5F2NA 3DS4A 1VQ9P 5FLMG 1B7YB 1HNZQ 3A5UA 2R93H 1Q7YQ 2HIVA 1Y14B 1YHAA 1PH3A 2ID0A 4IJHA 4X65Q 2PEOA 2K4KA 5HGQA 3TS2A 1VQNA 1PH2A 4QJFA 5M5YH 1N33L 4R4IA 4OO1I 4DV3L 1JJ2A 1JB7A 2ZJRA 4OO1G 4AYBG 1VCIA 3CCUP 1PYBA 2JA7H 3G48A 4O0AA 4NPSA 4P73A 1AUMA 1R9TH 2Q2IA 1L1OA 1OTCA 1J6QA 2PEQA 1UWVA 4WJ4A 1P8LA 3I55A 4ME3A 2PEJA 4DK3C 1G291 3B5IA 4P75A 3K7AH 3RG6C 1VQHA 3KF8B 2OTLP 5JEAG 4JI5Q 4OWWB 4YCVA 4EX5A 4DV6Q 5HY6A 4L5RC 3CCEA 1MJCA 3T1YL 1CSPA 2EFJA 4LF5Q 3W5OA 3H3VI 2EIAA 4LF4Q 2N3SA 4UP9A 4PZ6A 4AH6A 3MXNB 4JI5L 2KCMA 2QA4A 1Q81Q 2IT1A 1I6HH 2OTJA 1D7QA 1AE3A 1VQ7P 1VQLA 4NXMQ 1SRUA 4GOPA 4GLVB 4DR5L 4Y52H 4JBMA 1C7YA 1RIPA 5AJ3L 3F1ZA 4R4QA 3S24A 5F2KA 5ELOA 3A74A 4DPGA 4X64Q 3PIOA 1PH6A 3PO2G 3PIPA 4GS3A 4DV6L 4LFCL 3S15H 3WBHA 4GLAC 2F52A 4R1JA 5IP7H 5IWAQ 4IFDI 4A3EH 4IFDG 3T1YQ 3AFPA 2NVXH 3NELA 4GKJL 3CC2P 3ER0A 5IY0A 2JE6I 2LXKA 2OQKA 3DS1A 2K14A 1WYDA 2R92G 5M5XH 4COCA 1Q82C 1QVGA 1YI2A 1K8AQ 1WCMG 2ALYB 4DV5Q 4A3FG 3BZCA 1M74A 4BBRG 2L6EA 4U0BA 4DV4L 1BVSA 1Q1BA 3M7NA 3ERSX 3J7ZC 4JC0A 1HR0W 2BH2A 2GVBA 1YIJA 2YU9H 4OWXB 2VQFL 3DM3A 4BY7H 1OXXK 2MO1A 1DGSA 3CMAP 1SE8A 3TQYA 3KFUA 3M1MA 1QVGO 4XFXA 1Y1WG 1N33Q 2JEAI 2AWNA 4JI6L 1YHQA 3M9BA 2Z44A 4BY1H 4J15A 1XNQQ 5LMNW 4YHHQ 4HIKA 1M1KC 3TRZA 1O7IA 4LF6Q 2R93G 3FKIG 4U0EA 4DR2Q 2UXBL 1XNQL 4X62L 1WOCA 1VQGA 4IJLA 3OW2O 4RMFA 4A3JG 1EIAA 2Y0SE 4LFBQ 1J5EL 1YEZA 5K36G 1TWFH 1YJNA 2L15A 3GTKH 2UXBQ 4JOIC 4RG1A 4X64L 1OXVA 1KAWA 3LRYA 2D62A 2CWPA 3BU2A 1X3EA 1YJWP 2PQAA 1N32L 1K8GA 1S3OA 1YZ6A 2K5VA 3ICEA 4JI3L 3OW2A 4R4OA 2E2JH 1VQ5A 4O2DA 1NMFA 1EUJA 3UE0A 1Q81C 2JYGA 2Z6KA 2IX1A 1GVPA 1I50H 2YTXA 4A93H 5IP9G 1VQDA 3CW2C 3GTJH 1KHIA 3AEVA 3S1QH 2CWAA 4IFDJ 3M3YH 1EYGA 1N36L 1TWAH 2WFWA 3LGJA 4LFCQ 2OTJP 3FP9A 4DR1L 1M90Q 3CPWA 1VQLP 5EAYA 3ULPA 4DR6L 4K0KL 1WJJA 1I5FA 2RHQB 1JT8A 1HNXQ 3M85A 1JJ2O 3HOWG 3KDFA 2PMZE 1D8LA 3I56A 4K0KQ 2AKWB 3G6EP 2PI2E 3PUWA 3SGIA 4OX9Q 3PUXA 4P72A 4HJ5A 1FJGQ 4COPA 2I5HA 1K73C 2DUDA 4WYMA 3HOYG 2EIFA 1HH2P 1KD1C 4GOPB 3I4NH 2C35B 3PF4A 3Q8DA 2GN5A 4OX9L 4YCWA 5JEAJ 5JJIA 1BBUA 4AQYL 3M4OH 3G29A 3D31A 3GTPH 3HOXG 1QUQA 1PH5A 4JI2L 1EOVA 1Q8KA 3I7FA 4L5TA 3H0DA 1VQFA 5FJ8G 5IYDH 3ZJYC 1D1DA 4GKKL 1XTDA 5C3EG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M Q;  4LFB L;  1YJW A;  2E8G A;  1HZB A;  2Y0S G;  1HJP A;  1XMQ L;  2UUB L;  1KRS A;  4IPC A;  1LUZ A;  4LWC A;  1XMO Q;  1IBK Q;  1Y1V G;  2UXD L;  1J5E Q;  4MTN A;  2QEX A;  4LF8 Q;  2ZTD A;  1Q46 A;  1VQ6 A;  2RCN A;  5LMN L;  2A8V A;  5C4X H;  4BY7 G;  5IYC G;  4WJ3 M;  4DV1 L;  4A3K G;  5FLM H;  3K0X A;  1VQK A;  2ES2 A;  2Q2U A;  3RZD H;  3U58 A;  1VQM A;  1X9N A;  1N36 Q;  2AHO B;  1NBW A;  1VQP A;  3UDF A;  3KJP A;  4BY1 G;  2NVT H;  1HZC A;  3K7U C;  2MQH A;  1VQ9 A;  4DR3 Q;  4DK6 C;  2OTL A;  1EQQ A;  3CC4 A;  3CME A;  3CF5 A;  4DV3 Q;  3PUV A;  1YVC A;  2YV5 A;  5JJK A;  4X66 L;  4A3J H;  4A3M H;  3WWV A;  1N34 L;  3S1M H;  1KXL A;  1E7Z A;  5M5W H;  3KJO A;  4A75 A;  4X65 L;  1K0R A;  2IX0 A;  1BBW A;  2WAQ E;  1NE3 A;  3HKZ E;  1SFO H;  4IOA A;  2Q2T A;  4GKJ Q;  3CC7 A;  1M90 C;  3NBH B;  1VQI A;  2JEB I;  4PG3 A;  4LUZ A;  3D0F A;  4A4I A;  3PUY A;  2KBN A;  4APV A;  1KC8 C;  4JBJ A;  1E1T A;  4JBK A;  2F4V L;  1YBY A;  1WFQ A;  1QVF A;  4DV5 L;  4UP7 A;  4GNX A;  4A93 G;  3GO5 A;  3EIV A;  4DV4 Q;  1X54 A;  2IHE A;  4YY3 L;  1PH4 A;  3HOV H;  1IL2 A;  1CSQ A;  4JYA Q;  1XJV A;  3HOZ G;  4XIG S;  4AQY Q;  3KLW A;  1HNZ L;  1PFS A;  4JI8 L;  1OXS C;  2OWO A;  5J3B A;  1IBK L;  2E5L L;  3NEN A;  4IPD A;  3GTG H;  3KF6 A;  2UXD Q;  1YHB A;  4FDB A;  1XMQ Q;  2UUB Q;  3OYY A;  2KHJ A;  2HHH Q;  4JI7 L;  2CFM A;  2B63 G;  2MNA A;  1IZ6 A;  1SRO A;  1UE7 A;  1WI5 A;  3CCS A;  1B8A A;  4DUZ Q;  4KLK A;  3ULJ A;  1TXY A;  2DGY A;  4AIM A;  5IP7 G;  2I5L X;  2NVY H;  1PH5 A;  2BA1 A;  2K50 A;  2RHS B;  3UDI A;  2MO0 A;  3HOY H;  1TWC H;  4LUV A;  1YJ9 A;  4YWM A;  2MFI A;  4C2M H;  5M3F H;  2R92 H;  1JE5 A;  2UU9 L;  4BA1 I;  4A3B G;  5IWA L;  1G51 A;  4AYB E;  4JI1 L;  1N8R C;  3VDY A;  2JA6 H;  4BBR H;  3HOX H;  5M3M G;  1YNX A;  4DR3 L;  3L0O A;  1VQ4 A;  4IO9 A;  2JA7 G;  1Q1E A;  2VQE L;  2UUA Q;  2VNU D;  1N32 Q;  4HJ9 A;  3W1B A;  4ALP A;  1UE1 A;  1Y1V H;  2VZA A;  2Z0S A;  3I4O A;  4DAY B;  1VQC A;  3OTO Q;  1EIY B;  4H02 A;  1PA6 A;  4IPG A;  2JA8 G;  5LMU Q;  5IYC H;  1H95 A;  3TS0 A;  4A3K H;  1XMO L;  3PO3 H;  1IBL L;  3T1H Q;  4UY8 C;  1W3S A;  2HQL A;  4JI0 L;  3OTO L;  3PUZ A;  4NXN Q;  2K5N A;  2I5M X;  1A62 A;  5LMU L;  4MZ9 A;  4DR4 Q;  4QQB X;  2LSS A;  1SLJ A;  2UXC Q;  5AJ3 Q;  4TVA B;  4JI6 Q;  4OXP A;  1XPU A;  1C9O A;  4YWL A;  4XTC S;  3CC2 A;  1A8V A;  4LF9 L;  1FVI A;  4DR4 L;  3J80 c;  1Q7Y C;  4NXM L;  1NTG A;  3H3V H;  4BBS G;  3S2H H;  1K3R A;  4HJ7 A;  2VUM H;  3CXC A;  4A3M G;  1S72 A;  3CPF A;  4R4C A;  1QVC A;  3FHW A;  3IRB A;  3G6E A;  4A3D G;  5GRO A;  1HZ9 A;  3AFQ A;  4C3I H;  4IOC A;  1BKB A;  2N8N A;  3CCV A;  3CQZ H;  5H1S E;  1GD7 A;  3HFZ B;  1A0I A;  1RL2 A;  4DAM A;  1VQ7 A;  4LNQ A;  2NN6 I;  4JBW A;  3I2Z A;  4DUZ L;  1VS0 A;  2K52 A;  2UU9 Q;  3F2B A;  1PH1 A;  4POF A;  1LYL A;  1G6P A;  3F2D A;  2PI2 A;  3HOW H;  4P71 A;  4TQU S;  3HOZ H;  1LM0 A;  1W2B A;  1V1Q A;  1CKM A;  1V43 A;  4QY7 A;  3GDE A;  4GN5 A;  4DV0 Q;  3CD6 A;  3HOU H;  4DR6 Q;  2D0P A;  1MJE A;  4EQ5 A;  1JJG A;  2VY3 A;  1E22 A;  5GAH C;  2V1C C;  4DV0 L;  2B63 H;  3MEF A;  3UE1 A;  4JOI A;  2RF4 A;  3TEH B;  3K80 C;  2ZTE A;  4NXN L;  4A3G H;  1EWI A;  4GKK Q;  1GO3 E;  2JA9 A;  3T1H L;  4DR7 L;  5FJ8 H;  1I3Q H;  1A63 A;  2KHI A;  4IPH A;  1L2F A;  4JI2 Q;  3KOJ A;  3JAM c;  5C3E H;  5M3F G;  2CCZ A;  2XTI A;  1CKN A;  4YWK A;  3S1R H;  5C44 G;  2JA5 H;  5M3M H;  3EBE A;  2FXQ A;  2JJQ A;  4JV5 L;  4A3I G;  1X3F A;  3CCR A;  3HKS A;  3J7A 5;  1CKO A;  2EQS A;  3RN2 A;  1GKH A;  1E3P A;  3B6Y A;  1VQJ A;  2ZJP A;  3PF5 A;  3TRE A;  2JQO A;  5IYB G;  4JI4 L;  1NJI C;  3NEM A;  2A19 A;  4PMW A;  2R7D A;  1AE2 A;  1SR3 A;  4A3L G;  1E1O A;  2HT1 A;  4DUY L;  1TWH H;  3H0G H;  2WAQ G;  2B3G A;  4DV1 Q;  4PZ8 A;  2E2I H;  1X6O A;  5C0X I;  3RN5 A;  5LMN Q;  1XPO A;  2NZO A;  2KCT A;  1L1O C;  2PQA B;  2VQE Q;  2UUA L;  2A1A A;  3K8A A;  2N78 A;  2VW9 A;  2R7Z G;  3E9H A;  1JJC B;  4LUO A;  2R7F A;  3CCU A;  4JI7 Q;  4KHP L;  1L1O B;  2E2H H;  1QZG A;  2B29 A;  3U50 C;  4QGU A;  4LF7 Q;  2AMC B;  3CCL A;  2GVA A;  1FJG L;  1HR0 Q;  4X6A H;  3AQQ A;  4DNI A;  4X66 Q;  2JK8 A;  3J80 i;  4C3J H;  3J81 c;  3I4M H;  4LF7 L;  3G71 A;  4A3D H;  3S17 H;  2D0O A;  5C4J H;  5FLX c;  4JCV E;  4DV7 Q;  4JI1 Q;  1FL0 A;  1KIX A;  3L7Z C;  3KDF B;  4B3M L;  2AWO A;  4B3R L;  4UPA A;  4L5S A;  5IE8 A;  1IXR A;  3HKZ G;  2VQF Q;  4GLX A;  2I0Q A;  3HOV G;  3RZO H;  4KI0 A;  4JI8 Q;  3A0J A;  4DV2 Q;  2BH8 A;  4LF6 L;  1IBM Q;  2VS1 A;  3ULL A;  4HID A;  3RNU A;  4JYA L;  3CMA A;  4UP8 A;  1VQB A;  3PV0 A;  3GTO H;  4BXX G;  4DR5 Q;  2ZTC A;  1IBM L;  5BR8 L;  1YIT A;  4GN3 B;  1JMC A;  2CQO A;  3K81 C;  3E0E A;  3M4Q A;  2E5L Q;  3CCJ A;  1AH9 A;  2HIX A;  5GQO A;  5DLQ E;  3E9I A;  3S1N H;  2K5H A;  4B3T Q;  2OQ0 A;  2VL6 A;  1OXU A;  3PGZ A;  1PV4 A;  1EFW A;  4QL5 A;  4LFA L;  4A3B H;  2YTV A;  2IY5 B;  4B3S L;  3CCQ A;  2JA6 G;  4A3E G;  1ASZ A;  3M4P A;  3DLL A;  1N34 Q;  3JC6 6;  3W1G A;  2OCE A;  1HZA A;  4A3C H;  2H5X A;  1XPR A;  1SN8 A;  4KHP Q;  2LXJ A;  2WB1 E;  2F4V Q;  4A3F H;  4HJA A;  5IT9 c;  4OON A;  3F2C A;  2Z6K C;  3CCM A;  4A3I H;  1SMX A;  4Y7N H;  3J81 i;  1VQO A;  1HNX L;  1UE6 A;  2BA0 A;  2YYZ A;  2YTY A;  3PCO B;  1C0A A;  2NVQ H;  2JA8 H;  3S16 H;  1XNR Q;  1EIF A;  4DR2 L;  5JJL A;  1KL9 A;  3PO3 G;  3U4V A;  5E7N A;  3STB C;  4DV2 L;  4GNX C;  3UDX A;  4A3L H;  2UXC L;  1I94 L;  4JI0 Q;  4A76 A;  1KQS A;  1VQ8 A;  4JI4 Q;  1X56 A;  2XGT A;  1KRT A;  1PYS B;  4KHZ A;  4GNX B;  4HIM A;  2WB1 G;  1UEB A;  4C3H H;  4LW1 A;  3BZK A;  3L2P A;  4BA2 I;  1FGU A;  1MKH A;  3FKI H;  2IHF A;  4JI3 Q;  3RLF A;  2ZJQ A;  2ZM6 L;  3GTL H;  1K9M C;  4BBS H;  3GTQ H;  1XNR L;  1Q86 C;  2VUM G;  2EXD A;  4GN4 B;  5BR8 Q;  4POG A;  1U0L A;  5GAD C;  3KF6 B;  2ZM6 Q;  3RR5 A;  4LFA Q;  1P16 A;  3AYH B;  1CUK A;  5GAG C;  4LF8 L;  1ASY A;  2UUC L;  4B3T L;  1VQE A;  3EN2 A;  4HIO A;  3BJU A;  3RLO A;  2ASB A;  4DR7 Q;  3CP0 A;  3S14 H;  1E24 A;  1QZH A;  1X55 A;  1EQR A;  4MNO A;  5C0X J;  4B3S Q;  1NY4 A;  1V9P A;  3A5Z B;  1Z9F A;  4HJ8 A;  5IP9 H;  3CAM A;  4OWT B;  1K8A C;  3RLN A;  3S2D H;  5ELN A;  2N49 A;  2WP8 J;  3U4Z A;  1Q12 A;  3F8T A;  4DR1 Q;  1N9W A;  4GOP C;  1K83 H;  1HR0 L;  1S40 A;  1VQA A;  4PZ7 A;  3JAM i;  3HOU G;  2PNH A;  3G4S A;  1TWG H;  1X65 A;  1MIU A;  1GM5 A;  2F3I A;  4L5Q A;  2R7Z H;  3PO2 H;  1IBL Q;  5GAE C;  4DV7 L;  3GD7 A;  2K75 A;  4JG2 A;  4R4T A;  1PH8 A;  5C0X G;  2NN6 G;  1IYJ B;  4P74 A;  1PHJ A;  4LF9 Q;  3GTM H;  4A3G G;  1PVO A;  1L0W A;  2QGQ A;  3I4N G;  2Q2H A;  4NB3 A;  3H15 A;  1HNW Q;  2CKZ B;  3J81 j;  1CKN B;  4QIW E;  1PH7 A;  2R6G A;  1WCM H;  2KEN A;  4LF5 L;  5C44 H;  1B70 B;  3STB D;  3UDG A;  2JA5 G;  1UE5 A;  1OXT A;  1HNW L;  5IYD G;  1I94 Q;  1Z47 A;  4A3C G;  1X3G A;  1T9H A;  2UUC Q;  3KYH C;  4YCU A;  4YY3 Q;  1LTL A;  5IYB H;  1NMG A;  4DKA C;  2NZH A;  1PH9 A;  4YHH L;  1Y1W H;  4JV5 Q;  3PSI A;  1U5K A;  4DUY Q;  4LF4 L;  1QUQ B;  2HHH L;  2ATW A;  3H0G G;  5C4X G;  4B3R Q;  4X62 Q;  5FLM G;  1HNZ Q;  1B7Y B;  3A5U A;  2R93 H;  2HIV A;  1Y14 B;  1YHA A;  1PH3 A;  2ID0 A;  4IJH A;  4X65 Q;  2K4K A;  5HGQ A;  3TS2 A;  1VQN A;  1PH2 A;  4QJF A;  5M5Y H;  1N33 L;  4R4I A;  4OO1 I;  4DV3 L;  1JJ2 A;  1JB7 A;  2ZJR A;  4OO1 G;  4AYB G;  1VCI A;  1PYB A;  2JA7 H;  3G48 A;  4O0A A;  4NPS A;  4P73 A;  1OTC A;  1R9T H;  2Q2I A;  1L1O A;  3I4M G;  1J6Q A;  1UWV A;  4WJ4 A;  1P8L A;  3I55 A;  4ME3 A;  4DK3 C;  1G29 1;  4P75 A;  3K7A H;  3KF8 B;  1VQH A;  5JEA G;  4OWW B;  4YCV A;  4EX5 A;  4DV6 Q;  5HY6 A;  4L5R C;  3CCE A;  1MJC A;  3T1Y L;  1CSP A;  4LF5 Q;  3H3V I;  3W5O A;  4BXX H;  4LF4 Q;  2N3S A;  4UP9 A;  4PZ6 A;  4AH6 A;  3MXN B;  4JI5 L;  2KCM A;  2QA4 A;  2IT1 A;  1I6H H;  2OTJ A;  1D7Q A;  1AE3 A;  1VQL A;  4NXM Q;  1SRU A;  4GOP A;  4GLV B;  4DR5 L;  4Y52 H;  4JBM A;  1C7Y A;  1RIP A;  5AJ3 L;  3F1Z A;  4R4Q A;  3S24 A;  4DPG A;  5ELO A;  3A74 A;  4X64 Q;  3PIO A;  1PH6 A;  3PO2 G;  3PIP A;  4GS3 A;  4DV6 L;  4LFC L;  3S15 H;  4IFD I;  4GLA C;  2F52 A;  4R1J A;  5IP7 H;  5IWA Q;  4IFD G;  4A3E H;  4GKJ L;  3T1Y Q;  3AFP A;  2NVX H;  3NEL A;  3ER0 A;  5IY0 A;  2JE6 I;  2LXK A;  2OQK A;  2R92 G;  2K14 A;  1WYD A;  5M5X H;  1Q82 C;  1QVG A;  1YI2 A;  1WCM G;  2ALY B;  4DV5 Q;  4A3F G;  3BZC A;  4BBR G;  4DV4 L;  1BVS A;  1Q1B A;  3M7N A;  3ERS X;  3J7Z C;  4JC0 A;  1HR0 W;  2BH2 A;  2GVB A;  1YIJ A;  2YU9 H;  4OWX B;  2VQF L;  3DM3 A;  4BY7 H;  1OXX K;  2MO1 A;  1DGS A;  3KFU A;  1SE8 A;  3TQY A;  1Y1W G;  1N33 Q;  2JEA I;  2AWN A;  4JI6 L;  1YHQ A;  3M9B A;  4BY1 H;  4J15 A;  1XNQ Q;  5LMN W;  4YHH Q;  4HIK A;  1M1K C;  3TRZ A;  1O7I A;  4LF6 Q;  2R93 G;  3FKI G;  4DR2 Q;  2UXB L;  1XNQ L;  4X62 L;  1WOC A;  1VQG A;  4IJL A;  4RMF A;  4A3J G;  2Y0S E;  4LFB Q;  1J5E L;  1YEZ A;  1TWF H;  1YJN A;  2L15 A;  3GTK H;  2UXB Q;  4JOI C;  4RG1 A;  4X64 L;  1OXV A;  1KAW A;  2D62 A;  2CWP A;  3BU2 A;  1X3E A;  1N32 L;  2PQA A;  1K8G A;  1S3O A;  1YZ6 A;  2K5V A;  3ICE A;  4JI3 L;  3OW2 A;  4R4O A;  2E2J H;  1VQ5 A;  4O2D A;  1NMF A;  1EUJ A;  3UE0 A;  1Q81 C;  2Z6K A;  2IX1 A;  1GVP A;  1I50 H;  2YTX A;  4A93 H;  5IP9 G;  1VQD A;  3CW2 C;  3GTJ H;  1KHI A;  3AEV A;  3S1Q H;  2CWA A;  4IFD J;  3M3Y H;  1EYG A;  1N36 L;  1TWA H;  2WFW A;  3LGJ A;  4LFC Q;  3FP9 A;  4DR1 L;  4K0K L;  3CPW A;  3ULP A;  5EAY A;  4DR6 L;  1WJJ A;  1I5F A;  2RHQ B;  1JT8 A;  1HNX Q;  3M85 A;  3HOW G;  3KDF A;  2PMZ E;  1D8L A;  3I56 A;  4K0K Q;  2AKW B;  2PI2 E;  3PUW A;  3SGI A;  4OX9 Q;  5K36 G;  3PUX A;  4P72 A;  4HJ5 A;  1FJG Q;  2I5H A;  1K73 C;  2DUD A;  3HOY G;  2EIF A;  1HH2 P;  1KD1 C;  4GOP B;  3I4N H;  2C35 B;  3PF4 A;  3Q8D A;  2GN5 A;  4OX9 L;  4YCW A;  5JEA J;  5JJI A;  1BBU A;  4AQY L;  3M4O H;  3D31 A;  3GTP H;  3HOX G;  1QUQ A;  4JI2 L;  1EOV A;  1Q8K A;  3I7F A;  4L5T A;  1VQF A;  5IYD H;  5FJ8 G;  3ZJY C;  4JI5 Q;  4GKK L;  1XTD A;  5C3E G; 
#chains in the Genus database with same CATH topology
 3FEW X;  1SND A;  4R9W A;  1HJP A;  1XMQ L;  2EVB A;  2UUB L;  2VUM B;  1KRS A;  1XMO Q;  1IW7 D;  1WTR A;  2CWO A;  2RCN A;  4BY7 G;  4WJ3 M;  4DV1 L;  5FLM H;  2Q2U A;  3T13 A;  3U58 A;  4BY7 B;  2K0D X;  1VQP A;  1ZXT A;  5DNF A;  4DR3 Q;  2OTL A;  4DV3 Q;  2M8N A;  1A2T A;  3CKI B;  4UHP B;  3WWV A;  4A3D B;  3PIO 3;  3J7A F;  1JB3 A;  3HGB A;  4A75 A;  1QIL A;  4X65 L;  5I6W A;  1AFP A;  1QCB D;  2WAQ E;  2FVF A;  4IOA A;  3CC7 A;  3NBH B;  2JEB I;  4A4I A;  4APV A;  3PUY A;  2KBN A;  1EU3 A;  4JBJ A;  2E76 C;  1B2T A;  5CGK A;  1WFQ A;  1L0Y B;  1PDQ A;  1ESF A;  3H3V C;  4GNX A;  2MVV A;  1V1O A;  2OF1 A;  3KLS A;  1MHW C;  2VXW A;  2NVY B;  1M1K Q;  5C3X A;  4DV4 Q;  1MD2 D;  1PH4 A;  4IUR A;  2K6A A;  1GUS A;  4R0M A;  4LK1 C;  2M9V A;  1NQ4 A;  4JI8 L;  2VLP A;  4KY5 A;  1EYA A;  1IBK L;  1CFM A;  2JSO A;  4FF3 A;  2PW5 A;  2H4O A;  3OYY A;  3TZU A;  2B63 G;  2MNA A;  1VF7 A;  2XIW A;  2F0Q A;  3MFY A;  4KLK A;  3MHB A;  3CC4 P;  2BA1 A;  2K50 A;  3UDI A;  3HOY H;  1YJ9 A;  4YWM A;  5M3F H;  1JE5 A;  4BA1 I;  1I3Q B;  1F77 A;  4AYB E;  5IWA L;  1EWC A;  4I65 A;  3J7Y W;  4K2K A;  2EY5 A;  4BBR H;  3HOX H;  2KOD A;  5M3M G;  2P5Z X;  2F0E A;  1STN A;  3C3L A;  1CHQ D;  2Z0S A;  3I4O A;  2DN8 A;  1VQC A;  1EIY B;  2EY6 A;  4IPG A;  1ET6 A;  3VYR A;  1VQ4 P;  1XMO L;  3PO3 H;  4JI0 L;  2HQL A;  1AZP A;  2CW0 C;  1TWA B;  4MZ9 A;  1Q82 Q;  3G26 A;  5EPK A;  2VSQ A;  2WKD A;  1EZ6 A;  4XTC S;  4ZYS A;  3CCS P;  3QR8 A;  4BBS G;  3S2H H;  1NTG A;  2F0V A;  2L12 A;  1F2Z A;  4HJ7 A;  4A3M G;  3CPF A;  4R4C A;  4G4K A;  5GRO A;  3FKI B;  4O1N A;  4IOC A;  2BHV A;  3CCV A;  3CQZ H;  1A15 A;  3K7A B;  5H1S E;  3HFZ B;  1A0I A;  5ELC A;  4DAM A;  4LNQ A;  1B9N A;  4DGZ A;  4DUZ L;  1SSO A;  2K32 A;  4G7Z C;  4V0B A;  3H09 A;  1PH1 A;  5E4X A;  4QMG A;  4A3F B;  2KOQ A;  2PNG A;  1DXM A;  1EY9 A;  5I9O A;  3K58 A;  4GZY C;  2M00 A;  1V43 A;  3A8J E;  3GDE A;  4GN5 A;  4G7O C;  2D0P A;  1EIG A;  4EQ5 A;  4U67 3;  3TDQ A;  3DS5 A;  1E22 A;  1SYD A;  2JYO A;  5GAH C;  4DV0 L;  3MEF A;  2F0S A;  3GQB A;  4NP5 A;  4UDU C;  2RF4 A;  2ZTE A;  3NP8 A;  2JA9 A;  1LTT D;  4DR7 L;  3G71 P;  4IPH A;  3KOJ A;  2XTI A;  4YWK A;  4A3I B;  4KD4 A;  5ISR A;  5C44 G;  5M3M H;  2FXQ A;  4JV5 L;  4A3I G;  1CI3 M;  3G4S P;  2HCC A;  1AP0 A;  3MC0 B;  1EY4 A;  1PZK D;  3MGE A;  4CDF C;  1K73 Q;  3IFD A;  2QEX P;  2F0K A;  1AE2 A;  1E1O A;  1QVF O;  4DV1 Q;  4ZCK A;  1PTO H;  1JWS D;  1X6O A;  1IHZ A;  2RQX A;  5LL6 S;  4C3H G;  2WAQ B;  3RN5 A;  2VQE Q;  2N78 A;  3E9H A;  3E0J A;  2J4X A;  3CCU A;  1U9R A;  2I07 B;  4JI7 Q;  2A73 B;  2E2H H;  4LF7 Q;  3RD4 A;  3S16 B;  1JR0 D;  3J80 i;  3I4M H;  4LF7 L;  3G71 A;  2LML A;  3S17 H;  1SNQ A;  2D0O A;  4Q5V A;  1ZNV A;  4JI1 Q;  5G3L D;  3HKZ B;  4B3M L;  4PH1 A;  5IT9 L;  4L5S A;  2GDX A;  5IE8 A;  2VQF Q;  3HOV G;  3RZO H;  4FXG C;  2E2D C;  4DV2 Q;  3BYT B;  2F0O A;  3HOV B;  4GR6 A;  4IUV A;  4KHV A;  4JYA L;  5HGT A;  5C4Z A;  2SNM A;  1VQ5 P;  4K14 A;  3CME P;  1F2L A;  1E6J P;  1LTG D;  5JPA A;  3K81 C;  1SYB A;  4KKT A;  5EJD A;  3A55 A;  2OQ0 A;  4LFA L;  3CCM P;  2JN4 A;  4B9W A;  3NSW A;  2YTV A;  1RTN A;  2IY5 B;  4IFD H;  1ASZ A;  2O5J C;  3CCL P;  1BOS A;  2H5X A;  2K04 A;  2WB1 E;  1EEF D;  4G7H C;  5IGF A;  4HJA A;  4OON A;  1VQO A;  1TU2 B;  2OXP A;  2Z6K C;  4RCN A;  1EY7 A;  2E1M A;  5CV5 A;  2YTY A;  1FGB D;  3I90 A;  3PCO B;  2NVQ H;  3H6M A;  5KP7 B;  2NB0 A;  1XNR Q;  3GP7 A;  4DR2 L;  5JJL A;  3STB C;  5KGU A;  3P7J A;  1E2V A;  3BVZ A;  1OR5 A;  3UDX A;  2K2Q A;  1VQ8 A;  1X56 A;  2J7Z A;  3BVM A;  2KW2 A;  3IKJ A;  1LAC A;  4LAA A;  4PNY A;  1FGU A;  3L2P A;  2IHF A;  4Y7N B;  4JI3 Q;  3GTQ H;  1QRJ A;  2KCN A;  2B2U C;  4POG A;  2QA4 P;  3TME A;  2KG9 A;  2Q8T A;  1H9S A;  4LFA Q;  3AYH B;  5GAG C;  3GTK B;  4B3T L;  3BJU A;  3MVV A;  3CPW O;  4C3J G;  4BPH A;  4U0A A;  1E24 A;  1B9M A;  1X55 A;  3W3A A;  4MNO A;  2GZI A;  5C4H A;  1A43 A;  1SNP A;  3CAM A;  4OWT B;  1M8A A;  2BCO A;  3S2D H;  5ELN A;  2VLO A;  3ITP A;  5F2D A;  3U4Z A;  4GOP C;  5IGE A;  1K83 H;  1UUP A;  5AFW A;  1VQA A;  3DM1 A;  3HOU G;  1A2U A;  2BDO A;  2PNH A;  3G4S A;  5I2Y A;  1MIU A;  1CQV A;  1QWY A;  2CHB D;  3T51 B;  1X32 A;  1GM5 A;  3TBI B;  3PO2 H;  1WD0 A;  4DV7 L;  3GD7 A;  1T5E A;  2XXM A;  1PHJ A;  2RKS A;  3HZX A;  1STB A;  1L0W A;  3I4N G;  4NEO A;  2F0T A;  1HNW Q;  3EVQ A;  3K5O A;  4MHE A;  3OSO A;  1HNW L;  4DK0 A;  1I94 Q;  1Z47 A;  2N5I A;  1X3G A;  1KAA A;  3HZQ A;  5I9P A;  3RZD B;  1H9J A;  1NMG A;  1UNK A;  2NZH A;  3PSI A;  1PFB A;  2KHS A;  2EJF C;  1TS2 A;  4CKB A;  2IL8 A;  2A68 D;  4ZUJ A;  1LT5 D;  5BN3 A;  3CD6 P;  5F2N A;  1SMY D;  1ENC A;  1IKM A;  5D14 A;  1ENA A;  1Q7Y Q;  4H0L C;  4CKC A;  4CJ0 B;  2QKI C;  4IJH A;  2PW7 A;  1WD1 A;  3TS2 A;  1HXY D;  1KDB A;  1Z6H A;  2TSS A;  4OO1 G;  2EYM A;  5M5Y B;  4AYB G;  1PYB A;  2WIN B;  1OTC A;  4P73 A;  1AUM A;  2PEQ A;  4WJ4 A;  2L5T A;  2PEJ A;  1FR3 A;  2EE1 A;  3B5I A;  5JEA G;  2EDG A;  1LAB A;  1KAB A;  3NE5 B;  1BCP D;  1RDP D;  1VMP A;  3CCE A;  3T1Y L;  2EFJ A;  3H3V I;  2A6E D;  4LF4 Q;  2N3S A;  1YNN C;  1Q81 Q;  5KRU A;  5G3L F;  1AE3 A;  1EMV A;  1VQ7 P;  4NXM Q;  1GHK A;  1PZJ D;  1S5E D;  4GLV B;  1G91 A;  4JBM A;  5C3W A;  1C7Y A;  4DPG A;  2E75 C;  4GS3 A;  3PIP A;  4LFC L;  4GLA C;  4R1J A;  5IP7 H;  1G8Z D;  3AFP A;  3ER0 A;  4HMI A;  5IY0 A;  2JE6 I;  1UAP A;  5FKA C;  5C5L A;  2CNR A;  2K14 A;  2R92 G;  4COC A;  1YI2 A;  1WCM G;  2KEC A;  3VR5 A;  2L6E A;  1PRT C;  4DV4 L;  1Q1B A;  1WTO A;  1WTH A;  1HR0 W;  2N98 A;  3FMC A;  2KGC A;  2BH2 A;  4OWX B;  1DGS A;  3KFU A;  1GHJ A;  4N8X 1;  3TQY A;  1Y1W G;  2GYK A;  2EY2 A;  4DAY A;  2JEA I;  4JI6 L;  4DU9 A;  4DXG A;  4J15 A;  3EA6 A;  1S5D D;  1XNQ Q;  2R93 G;  2Q8I B;  4U0E A;  4KN7 C;  4X62 L;  1ZKO A;  4IJL A;  2B2V A;  3QOJ A;  1RHP A;  2Y0S E;  3PO3 B;  2KOO A;  3Q6S A;  5FLX E;  3GTK H;  4JOI C;  4X64 L;  5KNC A;  2D62 A;  1K8G A;  3OW2 A;  1NMF A;  2JYG A;  3BG3 A;  2Z6K A;  2IX1 A;  3C1F A;  3GTJ H;  1KHI A;  4N9T A;  2GZG A;  2EJM A;  4IFD J;  1MGS A;  1EYG A;  2F0I A;  4XT3 B;  2CW0 D;  1RCV D;  5EJW A;  2WFW A;  1O7Y A;  2KG8 A;  3CPW A;  5EAY A;  2KOL A;  1Y8O B;  3SK5 A;  4KTA A;  3M7G A;  1JT8 A;  1HNX Q;  1D8L A;  2AKW B;  2PI2 E;  4ZKC B;  5JJZ A;  2DUD A;  1SJH D;  4WRD A;  4FF4 A;  2GN5 A;  4BPG A;  2NVX B;  2K5X A;  1SNM A;  3C46 A;  1HTP A;  3I7F A;  2L55 A;  3J80 L;  5C0X G;  1D1D A;  4JI5 Q;  1XTD A;  1Q3L A;  4GKK L;  5C3E G;  4B3M Q;  4LFB L;  1VQP P;  2E8G A;  2Y0S G;  1TWG B;  5CR3 A;  1X3O A;  1IYV A;  1LUZ A;  1IBK Q;  2L0C A;  2JU2 A;  1Y1V G;  3K0Y A;  2JA8 B;  1Q46 A;  2XWB B;  2A8V A;  4MTK A;  2ZXO A;  1BAJ A;  1TWC B;  2ES2 A;  3G28 A;  1VQM A;  1TWH B;  4MRT C;  3NWS A;  1HZC A;  1RO0 A;  1IKL A;  1KTK A;  1AZQ A;  2MPM A;  3CME A;  1IUQ A;  1J9O A;  4DNT B;  1Y8P B;  4HMJ A;  2D9U A;  5JJK A;  4X66 L;  3LMO A;  1GXD C;  5M5W H;  1F9P A;  2MR8 A;  3OWE B;  1DD2 A;  5C6A A;  2HQE A;  1BBW A;  4ZAI A;  1SFO H;  3G6J B;  1M90 C;  5DM7 3;  1VQI A;  2VLN A;  4PG3 A;  3D0F A;  1E1T A;  2F4V L;  1YBY A;  4A93 B;  3VYT A;  2M8L A;  1F9S A;  1QVF A;  4DV5 L;  4A93 G;  3GO5 A;  3EIV A;  3KUP A;  1R4P B;  2WB1 B;  1B3A A;  1I4H A;  3QIA A;  4YY3 L;  5CV7 A;  3HOV H;  4JYA Q;  3URY A;  4XIG S;  3KLW A;  4G57 A;  1PFS A;  1OXS C;  3D6W A;  4A3E B;  1DV5 A;  2RA4 A;  3LX0 A;  1SRO A;  2OAR A;  1FR2 A;  5IP7 G;  1PH5 A;  5C4X B;  2RHS B;  2JB0 A;  4A3B B;  2XWJ B;  1GPJ A;  4A3B G;  1G51 A;  5EGT A;  1N8R C;  3VDY A;  2JA6 H;  1YNX A;  5JVH 3;  4ME5 A;  1STE A;  2JA7 G;  2F0P A;  1U4P A;  5LHY 1;  4FXD A;  4KY6 A;  2F0J A;  4HJ9 A;  1B4O A;  1H9K A;  2HD3 A;  3DMU A;  4Q0F A;  4ALP A;  3S1M B;  3Q20 A;  2KJX A;  3OTO Q;  3N6R A;  2NO8 A;  1PA6 A;  1H95 A;  3TS0 A;  4A3K H;  1IBL L;  1HA5 A;  3T1H Q;  3BZD B;  1EY6 A;  4KJN A;  3OTO L;  4NXN Q;  2DNC A;  1A62 A;  3VYS A;  5LMU L;  4FYD A;  4QQB X;  4DR4 Q;  2SNS A;  2LSS A;  1SLJ A;  2UXC Q;  1FD7 D;  2DJF C;  1XPU A;  2FVE A;  3CC2 A;  1TY0 A;  4DR4 L;  3NTI A;  1Q7Y C;  1EL0 A;  4RFB A;  4V19 0;  1K3R A;  3FPP A;  3CXC A;  3K6O A;  1S72 A;  3U43 A;  1GUN A;  1XYI A;  3IRB A;  3G6E A;  4A3D G;  1T5X D;  4C3I H;  1BKB A;  1VQN P;  5FK9 C;  4IUT A;  2E2J B;  4XYO A;  1GD7 A;  1RL2 A;  3NBI A;  4XT1 B;  1KQS O;  3I2Z A;  3IFT A;  3H4E A;  3F2B A;  5IGG A;  1LYL A;  2ENB A;  1Z6M A;  2EYO A;  3F2D A;  4P71 A;  3HOZ H;  1LM0 A;  4DV0 Q;  1CKM A;  1IMP A;  4QY7 A;  3CD6 A;  1K0S A;  5FO9 B;  5DEH A;  1YJ9 P;  2V1C C;  3DPH A;  4JOI A;  3K80 C;  1EWI A;  1S4Z A;  1GO3 E;  5FJ8 H;  1I3Q H;  1H9R A;  1D1I A;  1LTB D;  3VR6 A;  1IMQ A;  1HFG A;  4JI2 Q;  4NDX A;  4TKO B;  4XYQ A;  5M3F G;  3R8B A;  3S1R H;  1B3Q A;  2ZT9 C;  3LWE A;  2JA5 H;  3EBE A;  3MEH A;  2JJQ A;  3KBG A;  3E5S A;  1QOH A;  4XDX A;  2FHS C;  5CC4 A;  2JQO A;  2JYL A;  5D3I B;  1GUT A;  2AUK A;  1RTO A;  2R7D A;  1RKN A;  4F87 A;  4DUY L;  3H0G H;  3TP5 A;  4K6D A;  2L11 A;  4WFN 3;  5C0X I;  5LMN Q;  2KCT A;  1L1O C;  1RO2 A;  3BVG A;  2VW9 A;  1BQQ T;  1Q90 A;  3EFX D;  5NUC A;  1N8R Q;  5BS2 A;  2KGD A;  2D2C C;  5KP8 B;  1YNJ D;  1CM9 A;  2B29 A;  2A5H A;  1FJG L;  2F3W A;  4FXK C;  4ABN A;  4JPB W;  3AQQ A;  4X6A H;  4DNI A;  4X66 Q;  3L3O C;  3J81 c;  1AF8 A;  1ICF B;  4A3D H;  2BUO A;  2A68 C;  5FLX c;  4JCV E;  2XVS A;  3S14 B;  3CC7 P;  1FL0 A;  1KIX A;  2N55 A;  3L7Z C;  3LNN A;  1CHP D;  2AWO A;  3HKZ G;  4I7A A;  5CBA E;  3P05 A;  2DJG C;  4KI0 A;  4JI8 Q;  1HA6 A;  4HID A;  3CMA A;  3GTO H;  5JOB A;  5J39 A;  3DEP A;  4JVZ A;  3T4A C;  1YIT A;  2NBF A;  3EJD A;  2QIL A;  3CCJ A;  2HIX A;  3DUZ A;  5GQO A;  3S1N H;  2K5H A;  1OXU A;  3PGZ A;  5I6Y A;  4FF1 A;  1QE6 A;  1EQV A;  2CVR A;  4B3S L;  2JA6 G;  4A3E G;  1Y1W B;  3M4P A;  5F2O A;  2XZ1 C;  1EYD A;  1N34 Q;  2OCE A;  3CCR P;  1O7Z A;  2BE5 C;  3IAY A;  4K8J A;  1XPR A;  1SN8 A;  4KHP Q;  2LXJ A;  1ZYR D;  3R2T A;  3MXN A;  4L63 B;  3F2C A;  3CCM A;  3S1R B;  1HNX L;  4CDC C;  2YYZ A;  5D65 A;  5CZD B;  3ERQ A;  4J6H A;  3PO3 G;  5DCK A;  5E7N A;  1B50 A;  4DV2 L;  2XGT A;  1SYF A;  1M6N A;  1JOQ A;  4GNX B;  2K5W A;  3V05 A;  4LW1 A;  3FKI H;  2B2W A;  2PY8 A;  3GTL H;  2ZJQ A;  3HOZ B;  4PQX A;  3T16 A;  4RGN A;  1EFI D;  2Z45 A;  1U0L A;  4M0I A;  4TRD A;  3KF6 B;  2LMC B;  3RR5 A;  3MFG A;  3CHB D;  1G2T A;  1CUK A;  4XQQ A;  1VQE A;  4KKU A;  3M4Y A;  3RLO A;  5EQ0 A;  4K6L A;  4BY1 B;  2KOS A;  1HFN A;  5C0X J;  3HG9 A;  3NPP A;  1Z9F A;  5ELD A;  3D8G A;  1CTM A;  1SXT A;  2R61 A;  1Q12 A;  2PZU A;  1PZI D;  3D6C A;  4PZ7 A;  3JAM i;  2WV6 D;  2R7Z H;  3H94 A;  1I4R A;  2RCF A;  2EYP A;  2K75 A;  2VLQ A;  3Q23 A;  2PEN A;  2XV6 A;  1PTO D;  1IYJ B;  4P74 A;  1BXT A;  3CCQ P;  4XRQ A;  2FQ0 A;  4HKG A;  2K93 A;  4ODG A;  1TVX A;  2FQ1 A;  2CKZ B;  1CKN B;  4QIW E;  1PH7 A;  2KEN A;  2JA5 G;  3SDZ A;  2N5H A;  2F3V A;  2O4X A;  2PCF B;  5KYI A;  1OXT A;  3RMH A;  4N8F A;  5BN4 A;  1QNU A;  1MSG A;  1YI2 P;  1T9H A;  4YCU A;  5IYB H;  5C5M A;  1Y1W H;  1KLU D;  2EG5 A;  1QUQ B;  3DS3 A;  4PMB A;  3D3R A;  2ATW A;  2XRS D;  3H0G G;  4B3R Q;  4X62 Q;  5J22 A;  3TN2 A;  3DS4 A;  5FLM G;  1HNZ Q;  1B7Y B;  3GTJ B;  3A5U A;  2F0W A;  2A6H C;  2NZ1 D;  4CJ1 B;  3GTQ B;  1Y14 B;  2C5C A;  2KVM A;  3U9S A;  4X65 Q;  1PH3 A;  1V1P B;  1XXG A;  5CMD A;  2LIU A;  1K8O A;  3F2U A;  5TSS A;  2AQ2 B;  1VQN A;  1HUN A;  3GTO B;  2YU9 B;  2QDL A;  4DV3 L;  1VCI A;  4F7X A;  3G48 A;  2DNE A;  3RZO B;  3Q24 A;  4NPS A;  1R9T H;  2FMM A;  4DAP A;  3OIQ A;  2K5Q A;  2F0G A;  3DXJ C;  2TMP A;  3RG6 C;  3KF8 B;  4OIJ A;  2FAD A;  1PFN A;  2WPT A;  4YCV A;  4EX5 A;  5HY6 A;  5CV6 A;  2EYL A;  1LO5 D;  3FRP B;  2JP1 A;  4LF5 Q;  4BXX H;  2EIA A;  1RF2 D;  3MXN B;  2IW3 A;  2KGA A;  1VQL A;  3H91 A;  5D3D A;  4RCO A;  2RDF A;  1A3U A;  4DR5 L;  3HOU B;  4Y52 H;  5AJ3 L;  2JA7 B;  3PIO A;  3S24 A;  3A74 A;  4X3U A;  4IFD I;  1W6K A;  4IFD G;  3CC2 P;  2A6H D;  5HVC A;  4IZ8 A;  4RHR A;  4DA2 A;  1HHV A;  2LXK A;  3I4N B;  3QOL A;  1QB5 D;  3OMG A;  2ALY B;  1LT6 D;  4A3F G;  1VF5 C;  3GTM B;  3ERO A;  1E2W A;  3ERS X;  3J7Z C;  2PPB C;  2GVB A;  5E1F A;  2VQF L;  4BY7 H;  2SOB A;  2MO1 A;  1D1K A;  2K0X A;  1QVG O;  2JA6 B;  1JC7 A;  4XFX A;  3V96 A;  1E0B A;  1PRT D;  2WAC A;  3M9B A;  2Z44 A;  4BS9 A;  4BY1 H;  3OPO A;  3ONA B;  4RWS C;  1STY A;  1O7I A;  3X3M A;  4LF6 Q;  1FNV A;  1A6X A;  1D5X C;  1M4V A;  1I4X A;  1XWE A;  4RMF A;  3OW2 O;  2MHV A;  1EIA A;  4LFB Q;  2F1M A;  1YEZ A;  2L15 A;  2HDL A;  3NTK A;  3BU2 A;  1X3E A;  3PIP 3;  1YJW P;  4OEL B;  4JI3 L;  5BN5 A;  3EQL C;  2Z4I A;  4IUU A;  5CV4 A;  2E2J H;  1Q81 C;  2HDM A;  4A93 H;  1A3T A;  1VHN A;  1VQD A;  3CW2 C;  2CWA A;  1N36 L;  1CZW A;  5JEA H;  3K59 A;  3LGJ A;  2FMC A;  1KDC A;  1TII D;  3Q22 A;  3FP9 A;  3A8I E;  4LFC Q;  2AFE A;  4K0K L;  3ULP A;  1STG A;  3HOW B;  5M5W B;  2B2Y C;  2HCI A;  3P1H A;  3M85 A;  3EJE A;  2B8G A;  3T53 B;  3I56 A;  4FVM A;  4K0K Q;  4HJ5 A;  1FJG Q;  2B2W C;  2I5H A;  3SXH A;  2EIF A;  1KD1 C;  4GOP B;  1Q8I A;  1IL8 A;  3PF4 A;  1KLP A;  5JEA J;  4AQY L;  3DWQ A;  3TP8 A;  3GTP H;  3WDN A;  1PRT F;  1U4R A;  1EOV A;  4JI2 L;  3S15 B;  3DHQ A;  5IYD H;  1VQF A;  5FJ8 G;  2F0U A;  3P20 A;  5JAV A;  2XT1 A;  2FJ2 A;  1TY2 A;  4CKE A;  3Q0A A;  1YJW A;  4XQJ A;  4LWC A;  4PXH B;  4EVO A;  1J5E Q;  2FQ2 A;  4LF8 Q;  2ZTD A;  4ZQ3 A;  1VQ6 A;  2E2H B;  2IPK D;  2MF4 A;  2Z46 A;  5C4X H;  1B1Z A;  3K0X A;  3I3C A;  3RZD H;  5DAU A;  2PEI A;  1X9N A;  2AHO B;  1N36 Q;  3UDF A;  3DS2 A;  2NVT H;  1SDF A;  1Q86 Q;  3SK4 A;  3E2D A;  2AF8 A;  2ERH A;  2F0M A;  2MQH A;  4S3S A;  1VQ9 A;  4DK6 C;  1EQQ A;  1O7L A;  2RVL A;  3CC4 A;  3CF5 A;  3PUV A;  1YVC A;  2YV5 A;  2R93 B;  2I46 A;  2NWG A;  5HGO A;  1N34 L;  3S1M H;  1KXL A;  4DXF A;  1E7Z A;  1E2Z A;  4HTH A;  3KJO A;  3UI2 A;  3WOF A;  4PMC A;  1K0R A;  3SEB A;  3HKZ E;  2AQ1 B;  2QNW A;  4LUZ A;  1KC8 C;  1WTP A;  2CQA A;  4JBK A;  2ZXP A;  2K7V A;  3QO2 A;  3GZM A;  1J8I A;  4F8M A;  1IL2 A;  1CSQ A;  1XJV A;  5DM6 3;  4OL7 A;  4AQY Q;  2UXD Q;  2E5L L;  1Y69 U;  3GTG H;  3CCE P;  3KF6 A;  4FDB A;  3H47 A;  3CCJ P;  1F80 D;  2HHH Q;  4JI7 L;  1CK1 A;  2CFM A;  4RKL A;  3CCS A;  1UE7 A;  4H2X C;  1HTL D;  1SYE A;  3DEO A;  1TXY A;  2DGY A;  1JWU D;  2I5L X;  2MO0 A;  1WTQ A;  1TWC H;  4LUV A;  2MFI A;  4C2M H;  2R92 H;  3G21 A;  4KY7 A;  1KLG D;  4XRO A;  4JI1 L;  3M3Y B;  1E0H A;  4DR3 L;  2AQ3 B;  4X3T A;  3L0O A;  1S5C D;  2UUA Q;  1W2B O;  5CBE E;  4CJ2 C;  1ICW A;  5J1Z A;  5KND A;  1VQK P;  2K03 A;  4DAY B;  1ILQ A;  5EBC A;  5ELB A;  4H02 A;  5BS1 A;  2JA8 G;  5LMU Q;  2PZT A;  1BR9 A;  4UY8 C;  3PUZ A;  2N6Z A;  2K5N A;  1S72 P;  2I5M X;  1XX8 A;  5IOC A;  1SBB B;  1CA5 A;  5AJ3 Q;  4TVA B;  1U4M A;  1JCK B;  4JI6 Q;  2K1B A;  2BDN A;  1A8V A;  1FVI A;  3J80 c;  3H3V H;  2BOS A;  1WTX A;  1LT4 D;  2EZV A;  4J1M A;  3PQI A;  3I4L A;  4FF2 A;  3FHW A;  4DF7 A;  1HZ9 A;  3PO2 B;  1JIC A;  2N8N A;  1BCP C;  1I50 B;  4KMU C;  1GXG A;  1L0I A;  4JBW A;  2N6Y A;  1YHQ P;  1VS0 A;  2K52 A;  2UU9 Q;  4RH6 A;  3BS1 A;  1G6P A;  1WCM B;  4CGY B;  2PI2 A;  5IGB A;  4TQU S;  4XFZ A;  2B2Y A;  2WKC A;  1W2B A;  2AUJ D;  4DR6 Q;  2JA5 B;  1MJE A;  1HPC A;  2VY3 A;  2LL8 A;  3NBH A;  1DON A;  3NWT A;  1KC8 Q;  3NXW A;  3TEH B;  2NN6 H;  4A3G H;  2LKI A;  4U0F A;  1RJT A;  4RGM A;  4GKK Q;  3BDO A;  3I91 A;  1L2F A;  4BPF A;  1CKN A;  2E2I B;  1SMY C;  3K57 A;  1X3F A;  2AVA A;  3CCR A;  2EQS A;  3RN2 A;  3BYY B;  1E3P A;  3U9O A;  3PF5 A;  2KOP A;  1H9S B;  3TRE A;  5IYB G;  2RSN A;  3NEM A;  1M6E X;  2L4B A;  2A19 A;  1SYG A;  1V1P A;  4HCE A;  1TWH H;  3E3X A;  2EOT A;  4PZ8 A;  1C48 A;  3GJN A;  5FOB B;  1XPO A;  1JOO A;  2NZO A;  2V4D A;  2AFD A;  4LUO A;  2R7F A;  3WOE A;  1L1O B;  4C56 C;  1G6Z A;  4QGU A;  1B53 A;  1BO0 A;  2GVA A;  1SE3 A;  5EPJ A;  1HR0 Q;  3CCL A;  1R9T B;  2RBM A;  1O78 A;  3S2D B;  1MI2 A;  4QNB A;  4A3M B;  2K5D A;  4DV7 Q;  1K9M Q;  4QUC A;  1QNK A;  4ID6 A;  3KDF B;  2Z4H A;  1AN8 A;  4UPA A;  1IXR A;  4GLX A;  3A0J A;  3VR4 A;  1YIJ P;  1IBM Q;  1NNX A;  2N50 A;  2VS1 A;  2F0L A;  4UAI A;  2CH4 A;  1WVL A;  1HY8 A;  4UP8 A;  3L9A X;  3A7A B;  2K92 A;  4BXX G;  4DR5 Q;  1IBM L;  4DAV A;  2CH4 W;  3NTE A;  2CQO A;  2NTT A;  3M4Q A;  3E0E A;  2E5L Q;  4C1N I;  3P75 A;  4DN4 M;  5CYU A;  1F2Y A;  1AH9 A;  3R3O A;  4K5X A;  1X3Q A;  2Z9H A;  4B08 A;  4B3T Q;  2SDF A;  2PO4 A;  1EFW A;  3MXG A;  4P2C B;  4QL5 A;  4A3B H;  2L9H A;  2KEE A;  4WOR A;  1MSH A;  3CCQ A;  3JC6 6;  3W1G A;  3K5L A;  1HZA A;  2VB2 X;  5EPL A;  1HQB A;  2XN9 C;  2F4V Q;  1PTO C;  4UHV A;  1ZMB A;  4A3I H;  3GTL B;  2KQ3 A;  4ZUI A;  2BA0 A;  2JO0 A;  2BE5 D;  4DNR B;  5FO8 B;  4ZLT F;  2A69 C;  1KNE A;  3U4V A;  2NUC A;  1EWH A;  4GNX C;  3I55 P;  4A3L H;  1A8O A;  4A76 A;  2QF7 A;  4DG9 A;  1FNU A;  5KIX A;  1KRT A;  3HOX B;  4HIM A;  2WB1 G;  4C3H H;  3BZK A;  4BA2 I;  1MKH A;  1NSN S;  5C3E B;  1YNN D;  3RLF A;  1NAP A;  2KA7 A;  1Q86 C;  1XNR L;  2VUM G;  2EXD A;  2H1E A;  5BR8 Q;  5GAD C;  1TT2 A;  1CZG A;  3SVM A;  2F0D A;  5EKI A;  2Z8L A;  2NTS A;  4IQZ A;  3I73 A;  3TSS A;  2UUC L;  3GZL A;  3EN2 A;  4HIO A;  4QB4 A;  1H9M A;  3S14 H;  1SJE D;  3BDC A;  1NY4 A;  3A5Z B;  5ELF A;  4HJ8 A;  1TQO A;  2F03 A;  3S17 B;  2M2L A;  4K5W A;  3RLN A;  1VQO P;  2N49 A;  2WP8 J;  4C2M B;  1N9W A;  3I70 A;  5T1G A;  5KNB A;  5I2X A;  3GKL C;  4FO2 A;  1S40 A;  2EYH A;  3N52 A;  1TWG H;  1EOQ A;  1ML0 D;  5GAE C;  1I6V C;  1BUV T;  4JG2 A;  5T1I A;  3G1I A;  3LWU A;  4A3G G;  1PVO A;  3MWY W;  1EEI D;  2MY5 A;  1PTO B;  2QGQ A;  2Q2H A;  4EGV A;  4NB3 A;  1HUM A;  2EJG C;  3J81 j;  3OMC A;  5HGM A;  2P9X A;  1WCM H;  4LF5 L;  5C44 H;  1B70 B;  3UDG A;  2GZE A;  1UE5 A;  3NHH A;  4IUP A;  4BBS B;  3VRL C;  1YIT P;  4YY3 Q;  3J81 L;  4DKA C;  4B9X A;  1EY5 A;  5HV8 A;  2HHH L;  2L0Q A;  3K5M A;  5C4X G;  1G2S A;  1PRT B;  2X69 A;  1VQ9 P;  2LPK A;  3H0G B;  2R93 H;  1ET9 A;  4K5V A;  2FAC A;  1YHA A;  2ID0 A;  2B8F A;  2PEO A;  5HGQ A;  2K01 A;  1PH2 A;  1X3P A;  5M5Y H;  1N33 L;  4OO1 I;  1JB7 A;  2ZJR A;  3I4M G;  2Q2I A;  1J6Q A;  4EQO A;  1SNO A;  4ME3 A;  4DK3 C;  3R2I A;  1G29 1;  2KCC A;  2KR5 A;  3K7A H;  1VQH A;  4IN3 A;  4DV6 Q;  5JPM C;  3KLR A;  1MJC A;  1CSP A;  3W5O A;  4UP9 A;  4PZ6 A;  4JI5 L;  2IT1 A;  1I6H H;  1GUG A;  2OTJ A;  3MA2 B;  3QB3 A;  4KV6 A;  3VYU A;  4FP5 D;  3IL8 A;  1II3 A;  3F1Z A;  5F2K A;  5ELO A;  1PH6 A;  3WBH A;  4H2W C;  2F52 A;  3NK9 A;  3T1Y Q;  2FHT A;  4MIU A;  4KJO A;  2OQK A;  3NTH A;  3DS1 A;  1WYD A;  5M5X H;  1QVG A;  3VR3 A;  4DV5 Q;  4BBR G;  1M74 A;  4HSV A;  3MZ5 A;  5CV8 A;  5KP6 B;  3ND9 A;  3I72 A;  5M9O A;  2YU9 H;  2B2V C;  1OXX K;  3HP3 A;  4I7Z C;  3CMA P;  1SE8 A;  4DFA A;  4PV1 C;  2AWN A;  1YHQ A;  3HEJ A;  2WII B;  4OIK A;  4RGO S;  3GTP B;  4HCS A;  2CG5 B;  4YIJ A;  4HIK A;  3J7A V;  3I8Z A;  1L0X B;  4ILW A;  3SHL A;  4DR2 Q;  2JU1 A;  2DY7 A;  1WOC A;  3HRZ C;  1VMC A;  1UNS A;  3AMU A;  1TWF H;  1YJN A;  2MGS A;  4RG1 A;  1ILP A;  2CQ8 A;  1OXV A;  4RA8 A;  1TS5 A;  2PQA A;  2JQ4 A;  1YZ6 A;  3ICE A;  4AYB B;  4R4O A;  2JGP A;  3UE0 A;  5A2Q L;  1VQ5 A;  4O42 A;  4IZ6 A;  4M8A A;  1R4Q B;  1I50 H;  2RSO A;  4J8Q A;  2MUY A;  3S1Q H;  3AEV A;  2RDH A;  4C3H B;  3M3Y H;  4IAL A;  3A7L A;  4MN3 A;  1ACP A;  2E74 C;  1EY8 A;  2K94 A;  1LTI D;  1VQL P;  4DR6 L;  2O2L D;  2LTE A;  4K2L A;  2RHQ B;  1D5M C;  1QJO A;  1K28 A;  3HOW G;  5K36 G;  2EY1 A;  3G6E P;  2G5D A;  3PUW A;  3SGI A;  3D4R A;  4PWV B;  1SYC A;  4WYM A;  1HH2 P;  5JVG 3;  3I4N H;  1VKU A;  3GTG B;  3Q8D A;  4OGQ C;  4OX9 L;  3O13 A;  4YCW A;  1BBU A;  3M4O H;  5M3M B;  3G29 A;  5IGC A;  1IW7 C;  3X3N A;  2PYK A;  3GV6 A;  1Y8N B;  3SE0 A;  2ASB A;  1EIH A;  5FLX L;  3E6Z X;  2GA4 B;  1HZB A;  2M8P A;  1PYW D;  4IPC A;  4A3G B;  1LV9 A;  2UXD L;  4MTN A;  2QEX A;  1WTV A;  5LMN L;  1HQM C;  1S5F D;  3DWA A;  2L9F A;  1KNA A;  5IYC G;  4A3K G;  2ROQ A;  1C4Q A;  1VQK A;  1CQF A;  1NBW A;  2D5D A;  3KJP A;  4BY1 G;  5C4J B;  3K7U C;  1NCV A;  1VQ6 P;  1TS3 A;  4A3J H;  4A3M H;  5EW5 E;  3KBX A;  1I4P A;  1SFO B;  2IX0 A;  1AEX A;  3DWP A;  1BNZ A;  1NE3 A;  2Q2T A;  4HN7 A;  4GKJ Q;  1IBL Q;  4DK1 A;  1Z7T A;  3DS0 A;  3T56 B;  3CCV P;  1F2M A;  1D5Z C;  1A3V A;  1PTO F;  3AU7 A;  4UP7 A;  2L22 A;  1NUC A;  4H2Y C;  1X54 A;  2IHE A;  2MR7 A;  2IWH A;  4U0D A;  4CHT B;  1KD1 Q;  3HOZ G;  3VA5 A;  1SEB D;  1HNZ L;  5CV9 A;  2OWO A;  5J3B A;  3NEN A;  1TR5 A;  4IPD A;  1YHB A;  1XMQ Q;  2UUB Q;  1DYQ A;  1NJI Q;  2KHJ A;  4ZKB B;  2XSC A;  2ONT A;  1IZ6 A;  2VB3 X;  1WI5 A;  2F0H A;  1B8A A;  3OWF A;  4CDE C;  4DUZ Q;  2X2B A;  3ULJ A;  4AIM A;  1UJZ A;  2QEJ C;  5COY A;  4C3J B;  2NVY H;  2UU9 L;  5L37 A;  2XRQ D;  1C8C A;  5A2Q E;  1XTC D;  1VQ4 A;  1YNJ C;  2MJ8 A;  1JOK A;  4IO9 A;  1Q1E A;  2VQE L;  2R7Z B;  2VNU D;  1N32 Q;  3CE7 A;  3I56 P;  1GUO A;  4RGT A;  3W1B A;  4HSP A;  1UE1 A;  1Y1V H;  2VZA A;  2Y0S B;  1PMR A;  4IPY A;  1ROD A;  5K5P A;  5IYC H;  1I4G A;  5IT9 E;  3KK7 A;  1W3S A;  2EXZ A;  5A35 A;  5IOD A;  2CGQ A;  2LF4 A;  1SE4 A;  3J81 E;  1SAP A;  3TP6 A;  3S9W A;  4OXP A;  1C9O A;  4YWL A;  5FO7 B;  4LF9 L;  4NXM L;  2F4I A;  1CA6 A;  4Z9C B;  5KYL A;  1EOT A;  2VUM H;  1QVC A;  4X3S A;  1BCP B;  4F37 A;  3AFQ A;  3OIP A;  1BXI A;  2KED A;  1T8K A;  4LJZ C;  3CRK C;  3HS0 C;  4A3J B;  4H7B A;  1VQ7 A;  5HGL A;  2NN6 I;  2K05 A;  1ZYR C;  4POF A;  2LKV A;  3MTS A;  1DOK A;  1UEA B;  1DOL A;  3HOW H;  3SK6 A;  3FVQ A;  3C1E A;  1V1Q A;  2FIN B;  3HOU H;  1ZEQ X;  3D4W A;  3JAM E;  5I4T G;  1K3B C;  4CDD C;  2KG6 A;  1JJG A;  3QWN A;  1BBX C;  2B2T A;  4KD3 A;  1ESR A;  2B63 H;  3A54 A;  3UE1 A;  3EJB A;  4FNF A;  4WJW A;  1VQM P;  1V8Q A;  4NXN L;  3T1H L;  2EHS A;  1A63 A;  3TP7 A;  2KHI A;  5C3E H;  2PQE A;  3JAM c;  2CCZ A;  2OT2 A;  5M5X B;  4GR2 A;  4XQN A;  3OHX C;  3HKS A;  1DNY A;  1CKO A;  1JWM D;  3J7A 5;  1GKH A;  1BCP F;  3B6Y A;  1VQJ A;  2LS0 1;  2ZJP A;  1RNI A;  3RG2 A;  1MBY A;  4QF4 A;  4JI4 L;  1NJI C;  2K33 A;  1LTA D;  4PMW A;  1S5B D;  4A3L G;  1SR3 A;  2HT1 A;  2EPB A;  1EU4 A;  2WAQ G;  2B3G A;  1NR4 A;  2E2I H;  3I4M B;  2JAZ A;  2MVU A;  2X6G A;  2PEK A;  2Z1C A;  2PQA B;  3G1G A;  2UUA L;  2A1A A;  3K8A A;  5COR A;  4OEM B;  2F0F A;  1W6J A;  1JJC B;  4HAE A;  4KHP L;  3G7L A;  2Q8R E;  1QZG A;  3U50 C;  3C2P A;  2AMC B;  3OOC A;  2NVQ B;  3GV3 A;  2JK8 A;  4QKO A;  4C3J H;  2K28 A;  2XNA C;  4OHJ A;  3MXU A;  5C4J H;  2JBG A;  1ONL A;  4RHS A;  1I4Q A;  1DM0 B;  1GOZ A;  3TZD A;  5KEE A;  4B3R L;  2I0Q A;  3V2T A;  4LF6 L;  2BH8 A;  3SR1 A;  1AYI A;  3ULL A;  3RNU A;  1VQB A;  3PV0 A;  1STH A;  4RKB A;  2ZTC A;  5BR8 L;  1JMC A;  4GN3 B;  3D4D A;  2G9H D;  2PMZ B;  2A74 C;  2LOL A;  4BBR B;  4PH0 A;  2B39 A;  5DLQ E;  3E9I A;  4R8I A;  2R3Z A;  2VL6 A;  1PV4 A;  4LMQ D;  2N88 A;  1K30 A;  2GDW A;  1VDZ A;  1B44 D;  2Z6B A;  3DLL A;  3RUZ A;  3HYB A;  4A3C H;  4H13 C;  2KUM A;  3NQI A;  4A3F H;  1CEI A;  2ICI A;  1LTS D;  1VQ8 P;  5IT9 c;  1SMX A;  4Y7N H;  3J81 i;  1BF4 A;  1UE6 A;  2FFK B;  1C0A A;  4JK1 C;  1EZ8 A;  2JA8 H;  3S16 H;  1EIF A;  3QJY A;  1KL9 A;  1DJR D;  2LFN A;  3KLS X;  5IGD A;  5JPN C;  4X3K A;  7CEI A;  3OW7 A;  2QDB A;  2UXC L;  4CA3 A;  1I94 L;  4JI0 Q;  1KQS A;  4JI4 Q;  2PNR C;  1PYS B;  2SEB D;  4KHZ A;  2A69 D;  1UEB A;  4BBS H;  2ZM6 L;  1K9M C;  3R93 A;  2DNW A;  2L4N A;  4GN4 B;  1SNC A;  3FDT A;  2ZM6 Q;  5HGN A;  4C3I G;  4N9P A;  1P16 A;  4R8N A;  5EBD A;  5I4D A;  1JOR A;  4LF8 L;  1ASY A;  1LT3 D;  2QCP X;  2KGE A;  4XFY A;  4M1U B;  4DR7 Q;  3KF8 A;  1ENF A;  3CP0 A;  4NKL A;  1QZH A;  1EQR A;  4B3S Q;  5LL6 X;  5EKL A;  1MZ8 A;  1V9P A;  2RDG A;  4QUF A;  5IP9 H;  3CXC O;  1K8A C;  2MD9 A;  3CQZ B;  2PEM A;  2GZJ A;  4DR1 Q;  3F8T A;  4RAU C;  1FNW A;  2KWL A;  2ICE C;  5EKK A;  1HR0 L;  3G0V A;  1JE4 A;  1X65 A;  1HCZ A;  2F3I A;  4L5Q A;  3VA7 A;  5K36 H;  1EQT A;  4R4T A;  3J80 E;  1PH8 A;  2NN6 G;  4LF9 Q;  3GTM H;  2R92 B;  4EQP A;  3M4O B;  3ZYY X;  1STA A;  3H15 A;  3NUC A;  1AW7 A;  2R6G A;  4A3K B;  1OO9 B;  3FPU B;  3STB D;  3AB9 A;  4HED A;  4TSS A;  5IYD G;  1I6H B;  2MP1 A;  1DZ1 A;  4A3C G;  3SK8 A;  2UUC Q;  3KYH C;  1TS4 A;  1LTL A;  1YJN P;  4EQN A;  2EYJ A;  3DTJ A;  4U0C A;  4YHH L;  1PH9 A;  4JV5 Q;  1U5K A;  4DUY Q;  4LF4 L;  4H44 C;  1U4L A;  1DOM A;  2C9O A;  3S1Q B;  2HIV A;  2OEO A;  1JQY D;  2K4K A;  2B2T C;  1D6E C;  1PXU A;  2M5R A;  2J0T D;  4QJF A;  3BDL A;  2DY8 A;  4NMZ A;  4R4I A;  1SE2 A;  1JJ2 A;  1TWF B;  3CCU P;  1BDO A;  1F9Q A;  3NQT A;  4O0A A;  2FAE A;  1L1O A;  2L1B A;  4U68 A;  1DCZ A;  1UWV A;  1LLR D;  2B2U A;  2JXM B;  1P8L A;  3I55 A;  3NY7 B;  4P75 A;  1RD9 D;  2K0Y A;  4ZK9 B;  4KKS A;  2B63 B;  2OTL P;  1PFM A;  1TKW B;  4IUN A;  4OWW B;  1GJX A;  5M3F B;  4IUQ A;  2XZ0 D;  2KOR A;  1EYC A;  4L5R C;  4QCL A;  5E3F A;  4AH6 A;  2QA4 A;  2KCM A;  4E6I A;  4XXE A;  1D7Q A;  2PZW A;  1SRU A;  1GXH A;  4GOP A;  1RIP A;  2R7Z G;  1EY0 A;  4R4Q A;  3PO2 G;  3CRL C;  4X64 Q;  3S15 H;  4DV6 L;  2X6L A;  5IWA Q;  1K8M A;  4A3E H;  4GKJ L;  2NVX H;  3NEL A;  1IYU A;  2O5I C;  5C0X H;  4F88 A;  1NR2 A;  2IX3 A;  1Q82 C;  2GDY A;  1Y1V B;  1K8A Q;  3CU7 A;  5E4W C;  2G9D A;  3BZC A;  4U0B A;  2LY7 A;  1BVS A;  3MXP A;  3M7N A;  2NVT B;  3ND8 A;  4JC0 A;  1YIJ A;  3EJI A;  3DM3 A;  2EYF A;  4ULL A;  1GUW A;  4L8J A;  3S1N B;  3B4Q A;  3W2D A;  3M1M A;  2IJ0 A;  1N33 Q;  2QW7 A;  2GZF A;  1CT1 D;  5LMN W;  4YHH Q;  1M1K C;  3TRZ A;  1L0H A;  4K8I A;  4KN4 C;  3FKI G;  4ZRZ A;  4KK7 A;  2UXB L;  1XNQ L;  2LIW A;  1VQG A;  4A3J G;  3PMF A;  1O80 A;  1J5E L;  3A56 A;  3K5N A;  2UXB Q;  3QG1 A;  4BWG B;  1KAW A;  4OO1 H;  3LRY A;  2CWP A;  3JAM L;  1N32 L;  1PLF A;  1S3O A;  2K5V A;  2EHT A;  2A6E C;  4CBV A;  4O2D A;  1K83 B;  1EUJ A;  1HRJ A;  2YTX A;  1GVP A;  5IP9 G;  4JW0 A;  4HR7 B;  5HUR A;  1TWA H;  2HUG A;  2F0N A;  2FVA A;  4C3I B;  2NYZ D;  2OTJ P;  1KDA A;  4DR1 L;  5ELE A;  1M90 Q;  1WTW A;  4QIW B;  1WJJ A;  4C1N K;  1I5F A;  1JJ2 O;  3KDF A;  2PMZ E;  4L6T B;  1QG7 A;  5IIF A;  3S2H B;  3HOY B;  4OX9 Q;  3PUX A;  4P72 A;  1D2B A;  4COP A;  5C44 B;  1K73 C;  1HQR D;  3HOY G;  3VR2 A;  2C35 B;  1FYC A;  5JJI A;  3MAQ A;  4NW2 A;  3D31 A;  3HOX G;  1QUQ A;  1LTR D;  1Q8K A;  2ZXR A;  4L5T A;  3H0D A;  3ZJY C;  2JA7 H;  3A8K E;  1F9R A; 
#chains in the Genus database with same CATH homology
 4B3M Q;  4LFB L;  2XT1 A;  1VQP P;  2E8G A;  1HZB A;  1YJW A;  2Y0S G;  1HJP A;  1XMQ L;  2M8P A;  2UUB L;  1KRS A;  4IPC A;  1LUZ A;  4LWC A;  1XMO Q;  1IBK Q;  1Y1V G;  2UXD L;  1J5E Q;  4MTN A;  2QEX A;  4LF8 Q;  2ZTD A;  1Q46 A;  1VQ6 A;  2CWO A;  2RCN A;  5LMN L;  2A8V A;  2Z46 A;  5C4X H;  4BY7 G;  5IYC G;  4WJ3 M;  1BAJ A;  4DV1 L;  5FLM H;  4A3K G;  3K0X A;  1VQK A;  2ES2 A;  2Q2U A;  3RZD H;  3U58 A;  3G28 A;  1VQM A;  2PEI A;  1X9N A;  2AHO B;  1NBW A;  1N36 Q;  1VQP A;  3UDF A;  2UXD Q;  3DS2 A;  4BY1 G;  3KJP A;  2NVT H;  3I4M G;  1Q86 Q;  1HZC A;  3E2D A;  1RO0 A;  3K7U C;  2MQH A;  1VQ9 A;  4DR3 Q;  4DK6 C;  2OTL A;  1EQQ A;  1VQ6 P;  3CC4 A;  3CME A;  1IUQ A;  3CF5 A;  4DV3 Q;  2M8N A;  3PUV A;  1YVC A;  3RZO H;  2YV5 A;  5JJK A;  5HGO A;  4X66 L;  4A3J H;  3WWV A;  4A3M H;  1N34 L;  3S1M H;  1KXL A;  1E7Z A;  5M5W H;  3KJO A;  4A75 A;  4X65 L;  1K0R A;  2IX0 A;  1BBW A;  2WAQ E;  1NE3 A;  3HKZ E;  1SFO H;  4IOA A;  2Q2T A;  4GKJ Q;  3CC7 A;  1M90 C;  3NBH B;  1VQI A;  2JEB I;  4PG3 A;  4LUZ A;  3D0F A;  4A4I A;  3PUY A;  2KBN A;  4APV A;  1KC8 C;  3DS0 A;  1E1T A;  4JBJ A;  4JBK A;  2F4V L;  1YBY A;  2M8L A;  1WFQ A;  3CCV P;  1QVF A;  4DV5 L;  4UP7 A;  4GNX A;  4A93 G;  3GO5 A;  3EIV A;  1M1K Q;  4DV4 Q;  1X54 A;  2IHE A;  4U0D A;  4YY3 L;  1PH4 A;  3HOV H;  1KD1 Q;  1IL2 A;  1CSQ A;  4JYA Q;  1XJV A;  3HOZ G;  4XIG S;  4AQY Q;  3KLW A;  1HNZ L;  1PFS A;  4JI8 L;  1OXS C;  2OWO A;  5J3B A;  1IBK L;  2E5L L;  3NEN A;  4IPD A;  3CCE P;  3KF6 A;  3GTG H;  1YHB A;  4FDB A;  3H47 A;  3CCJ P;  1XMQ Q;  2UUB Q;  1NJI Q;  2KHJ A;  3OYY A;  2HHH Q;  4JI7 L;  2CFM A;  2B63 G;  2ONT A;  1IZ6 A;  1SRO A;  1UE7 A;  1WI5 A;  2MNA A;  3CCS A;  2OAR A;  1B8A A;  4DUZ Q;  4KLK A;  3ULJ A;  1TXY A;  2DGY A;  4AIM A;  5IP7 G;  2I5L X;  2NVY H;  3CC4 P;  2BA1 A;  2K50 A;  2RHS B;  3UDI A;  2MO0 A;  3HOY H;  1TWC H;  4LUV A;  1YJ9 A;  4YWM A;  2MFI A;  4C2M H;  5M3F H;  2R92 H;  3G21 A;  1JE5 A;  2UU9 L;  4BA1 I;  4A3B G;  5IWA L;  1G51 A;  4AYB E;  4XRO A;  4JI1 L;  1N8R C;  3VDY A;  2JA6 H;  4BBR H;  3HOX H;  2KOD A;  1YNX A;  5M3M G;  4DR3 L;  3L0O A;  1VQ4 A;  4IO9 A;  2JA7 G;  1Q1E A;  2VQE L;  2UUA Q;  2VNU D;  1N32 Q;  1W2B O;  3I56 P;  4HJ9 A;  3W1B A;  4ALP A;  1VQK P;  3Q20 A;  1UE1 A;  1Y1V H;  2VZA A;  2Z0S A;  3I4O A;  4DAY B;  1VQC A;  3OTO Q;  4IPY A;  4H02 A;  1EIY B;  1PA6 A;  5BS1 A;  4IPG A;  2JA8 G;  5LMU Q;  5IYC H;  1H95 A;  1VQ4 P;  3TS0 A;  4A3K H;  1XMO L;  1IBL L;  3PO3 H;  3T1H Q;  4UY8 C;  1W3S A;  2HQL A;  4JI0 L;  3OTO L;  3PUZ A;  4NXN Q;  2K5N A;  1S72 P;  2I5M X;  2LF4 A;  1A62 A;  5LMU L;  4MZ9 A;  4DR4 Q;  1Q82 Q;  4QQB X;  2LSS A;  1SLJ A;  2UXC Q;  3G26 A;  5AJ3 Q;  4TVA B;  4JI6 Q;  4OXP A;  1XPU A;  1C9O A;  4YWL A;  4XTC S;  3CC2 A;  3CCS P;  1A8V A;  4LF9 L;  1FVI A;  4DR4 L;  3J80 c;  1Q7Y C;  4NXM L;  1NTG A;  3H3V H;  4BBS G;  3S2H H;  1K3R A;  4HJ7 A;  2VUM H;  3CXC A;  4A3M G;  1S72 A;  3CPF A;  4R4C A;  1QVC A;  3FHW A;  3IRB A;  3G6E A;  4A3D G;  5GRO A;  1HZ9 A;  3AFQ A;  4C3I H;  4IOC A;  1BKB A;  2BHV A;  2N8N A;  1VQN P;  3CQZ H;  3CCV A;  5H1S E;  1GD7 A;  3HFZ B;  1A0I A;  1RL2 A;  4DAM A;  5HGL A;  1VQ7 A;  4LNQ A;  2NN6 I;  4JBW A;  1KQS O;  3I2Z A;  1YHQ P;  4DUZ L;  1VS0 A;  2K52 A;  3H4E A;  3F2B A;  2UU9 Q;  1PH1 A;  4POF A;  1LYL A;  1G6P A;  3F2D A;  2PI2 A;  3HOW H;  4P71 A;  4TQU S;  3HOZ H;  1LM0 A;  4XFZ A;  1W2B A;  1V1Q A;  1CKM A;  1V43 A;  4QY7 A;  3GDE A;  4GN5 A;  4DV0 Q;  3CD6 A;  3HOU H;  4DR6 Q;  2D0P A;  1MJE A;  4EQ5 A;  5I4T G;  1JJG A;  2VY3 A;  3DS5 A;  1E22 A;  5GAH C;  1YJ9 P;  2V1C C;  4DV0 L;  2B63 H;  3MEF A;  3UE1 A;  3DPH A;  1KC8 Q;  4JOI A;  2RF4 A;  1VQM P;  3TEH B;  3K80 C;  2ZTE A;  4NXN L;  4A3G H;  4U0F A;  1EWI A;  4GKK Q;  1GO3 E;  2JA9 A;  3T1H L;  4DR7 L;  3G71 P;  1I3Q H;  5FJ8 H;  1A63 A;  2KHI A;  4IPH A;  1L2F A;  4JI2 Q;  3KOJ A;  3JAM c;  5C3E H;  5M3F G;  2CCZ A;  2XTI A;  1CKN A;  4YWK A;  3S1R H;  5C44 G;  2JA5 H;  4GR2 A;  3EBE A;  2FXQ A;  2JJQ A;  5M3M H;  4A3I G;  4JV5 L;  1X3F A;  3CCR A;  3G4S P;  3HKS A;  1CKO A;  2EQS A;  3RN2 A;  3J7A 5;  1GKH A;  1E3P A;  3B6Y A;  1VQJ A;  2ZJP A;  1RNI A;  3MGE A;  3TRE A;  2JQO A;  5IYB G;  2JYL A;  1K73 Q;  3PF5 A;  1NJI C;  4JI4 L;  3NEM A;  1M6E X;  2QEX P;  2A19 A;  4PMW A;  2R7D A;  1AE2 A;  1SR3 A;  4A3L G;  1E1O A;  2HT1 A;  4DUY L;  1TWH H;  1QVF O;  3H0G H;  2WAQ G;  2B3G A;  4DV1 Q;  4PZ8 A;  2E2I H;  1X6O A;  5C0X I;  3RN5 A;  5LMN Q;  1XPO A;  2PEK A;  2NZO A;  2KCT A;  1L1O C;  2PQA B;  1RO2 A;  3G1G A;  2A1A A;  3K8A A;  2N78 A;  2VW9 A;  2VQE Q;  2UUA L;  2R7Z G;  3E9H A;  1N8R Q;  5BS2 A;  1JJC B;  4LUO A;  2R7F A;  3CCU A;  4JI7 Q;  4KHP L;  1L1O B;  2E2H H;  1QZG A;  2B29 A;  3U50 C;  4QGU A;  4LF7 Q;  2AMC B;  3CCL A;  2GVA A;  1FJG L;  1HR0 Q;  4X6A H;  3AQQ A;  4DNI A;  4X66 Q;  2JK8 A;  3J80 i;  4C3J H;  3J81 c;  3I4M H;  4LF7 L;  3G71 A;  4QNB A;  2BUO A;  4A3D H;  3S17 H;  2D0O A;  5C4J H;  5FLX c;  4JCV E;  4DV7 Q;  1K9M Q;  4JI1 Q;  3CC7 P;  1FL0 A;  1KIX A;  3L7Z C;  3KDF B;  4B3M L;  4PH1 A;  2AWO A;  4B3R L;  4UPA A;  4L5S A;  5IE8 A;  1IXR A;  3HKZ G;  2VQF Q;  4GLX A;  2I0Q A;  3HOV G;  3P05 A;  4KI0 A;  4JI8 Q;  3A0J A;  4DV2 Q;  1YIJ P;  2BH8 A;  1IBM Q;  4LF6 L;  2VS1 A;  4GR6 A;  3ULL A;  4HID A;  3RNU A;  4JYA L;  3CMA A;  4UP8 A;  1VQB A;  3PV0 A;  3GTO H;  1VQ5 P;  4BXX G;  4DR5 Q;  2ZTC A;  3CME P;  5BR8 L;  1YIT A;  4GN3 B;  1IBM L;  1E6J P;  1JMC A;  3NTE A;  2CQO A;  5JPA A;  3K81 C;  3E0E A;  3M4Q A;  2E5L Q;  3CCJ A;  4PH0 A;  1AH9 A;  2HIX A;  5GQO A;  5DLQ E;  3E9I A;  3S1N H;  2K5H A;  4B3T Q;  2OQ0 A;  2VL6 A;  1OXU A;  3PGZ A;  1PV4 A;  1EFW A;  4QL5 A;  4LFA L;  3CCM P;  1K30 A;  4A3B H;  2YTV A;  2IY5 B;  4B3S L;  3CCQ A;  2JA6 G;  4A3E G;  1ASZ A;  3M4P A;  5F2O A;  3DLL A;  3JC6 6;  3W1G A;  1N34 Q;  2OCE A;  3CCL P;  3HYB A;  3CCR P;  1HZA A;  4A3C H;  2H5X A;  1XPR A;  1SN8 A;  4KHP Q;  2LXJ A;  2WB1 E;  2F4V Q;  4A3F H;  4HJA A;  1VQ8 P;  5IT9 c;  4OON A;  1ZMB A;  2Z6K C;  3F2C A;  3CCM A;  1SMX A;  4Y7N H;  3J81 i;  4A3I H;  1VQO A;  2E1M A;  1HNX L;  1UE6 A;  2BA0 A;  2JO0 A;  2YTY A;  2YYZ A;  3PCO B;  1C0A A;  2NVQ H;  2JA8 H;  3S16 H;  1XNR Q;  1EIF A;  4DR2 L;  5JJL A;  1KL9 A;  3PO3 G;  5DCK A;  3U4V A;  5E7N A;  3STB C;  4DV2 L;  4GNX C;  3I55 P;  3UDX A;  4A3L H;  2UXC L;  1A8O A;  1I94 L;  4A76 A;  4JI0 Q;  1KQS A;  1VQ8 A;  4JI4 Q;  1X56 A;  2XGT A;  1KRT A;  1M6N A;  1PYS B;  4KHZ A;  4GNX B;  4HIM A;  2WB1 G;  1UEB A;  4C3H H;  4LW1 A;  3BZK A;  3L2P A;  4BA2 I;  1FGU A;  1MKH A;  3FKI H;  2PY8 A;  2IHF A;  3RLF A;  2ZJQ A;  2ZM6 L;  4JI3 Q;  1K9M C;  3GTL H;  4BBS H;  3GTQ H;  1XNR L;  1QRJ A;  1Q86 C;  2VUM G;  2EXD A;  4GN4 B;  5BR8 Q;  2Z45 A;  4POG A;  2QA4 P;  1U0L A;  5GAD C;  4M0I A;  3KF6 B;  2ZM6 Q;  5HGN A;  3RR5 A;  4LFA Q;  1P16 A;  3AYH B;  1CUK A;  5GAG C;  4LF8 L;  1ASY A;  2UUC L;  4B3T L;  4BXX H;  1VQE A;  3EN2 A;  4HIO A;  3BJU A;  3RLO A;  3CPW O;  4XFY A;  2ASB A;  4DR7 Q;  4U0A A;  3CP0 A;  3S14 H;  1E24 A;  1QZH A;  1X55 A;  1EQR A;  4MNO A;  5C0X J;  4B3S Q;  1NY4 A;  1V9P A;  3A5Z B;  1Z9F A;  4HJ8 A;  5IP9 H;  1A43 A;  3CXC O;  3CAM A;  4OWT B;  1K8A C;  3RLN A;  1VQO P;  5ELN A;  2PEM A;  2N49 A;  2WP8 J;  3S2D H;  3U4Z A;  1Q12 A;  3F8T A;  4DR1 Q;  1N9W A;  4GOP C;  1K83 H;  1HR0 L;  1S40 A;  3G0V A;  1VQA A;  4PZ7 A;  3JAM i;  3HOU G;  2PNH A;  3G4S A;  1TWG H;  1EOQ A;  1X65 A;  1MIU A;  1GM5 A;  2F3I A;  4L5Q A;  2R7Z H;  3PO2 H;  1IBL Q;  5GAE C;  4DV7 L;  3GD7 A;  2K75 A;  4JG2 A;  4R4T A;  3G1I A;  2XXM A;  1PH8 A;  5C0X G;  2PEN A;  2XV6 A;  2NN6 G;  1IYJ B;  4P74 A;  1PHJ A;  4LF9 Q;  3GTM H;  4A3G G;  3CCQ P;  1PVO A;  4XRQ A;  1L0W A;  2QGQ A;  3I4N G;  2Q2H A;  4NB3 A;  3H15 A;  1HNW Q;  2CKZ B;  3J81 j;  1CKN B;  5HGM A;  2P9X A;  4QIW E;  2R6G A;  1PH7 A;  1WCM H;  2KEN A;  4LF5 L;  5C44 H;  1B70 B;  3STB D;  3UDG A;  2JA5 G;  1UE5 A;  1OXT A;  1HNW L;  5IYD G;  1I94 Q;  1Z47 A;  4A3C G;  1X3G A;  1T9H A;  1YI2 P;  3VRL C;  1YIT P;  3HZQ A;  3KYH C;  4YCU A;  4YY3 Q;  2UUC Q;  1LTL A;  1YJN P;  1NMG A;  4DKA C;  5IYB H;  2NZH A;  3DTJ A;  4U0C A;  4YHH L;  1Y1W H;  3PSI A;  1PH9 A;  4JV5 Q;  2EG5 A;  1U5K A;  4DUY Q;  4LF4 L;  1QUQ B;  2HHH L;  3DS3 A;  2ATW A;  3H0G G;  5C4X G;  4B3R Q;  4X62 Q;  3CD6 P;  5F2N A;  3DS4 A;  1VQ9 P;  5FLM G;  1B7Y B;  1HNZ Q;  3A5U A;  2R93 H;  1Q7Y Q;  2HIV A;  1Y14 B;  1YHA A;  1PH3 A;  2ID0 A;  4IJH A;  4X65 Q;  2PEO A;  2K4K A;  5HGQ A;  3TS2 A;  1VQN A;  1PH2 A;  4QJF A;  5M5Y H;  1N33 L;  4R4I A;  4OO1 I;  4DV3 L;  1JJ2 A;  1JB7 A;  2ZJR A;  4OO1 G;  4AYB G;  1VCI A;  3CCU P;  1PYB A;  2JA7 H;  3G48 A;  4O0A A;  4NPS A;  4P73 A;  1AUM A;  1R9T H;  2Q2I A;  1L1O A;  1OTC A;  1J6Q A;  2PEQ A;  1UWV A;  4WJ4 A;  1P8L A;  3I55 A;  4ME3 A;  2PEJ A;  4DK3 C;  1G29 1;  3B5I A;  4P75 A;  3K7A H;  3RG6 C;  1VQH A;  3KF8 B;  2OTL P;  5JEA G;  4JI5 Q;  4OWW B;  4YCV A;  4EX5 A;  4DV6 Q;  5HY6 A;  4L5R C;  3CCE A;  1MJC A;  3T1Y L;  1CSP A;  2EFJ A;  4LF5 Q;  3W5O A;  3H3V I;  2EIA A;  4LF4 Q;  2N3S A;  4UP9 A;  4PZ6 A;  4AH6 A;  3MXN B;  4JI5 L;  2KCM A;  2QA4 A;  1Q81 Q;  2IT1 A;  1I6H H;  2OTJ A;  1D7Q A;  1AE3 A;  1VQ7 P;  1VQL A;  4NXM Q;  1SRU A;  4GOP A;  4GLV B;  4DR5 L;  4Y52 H;  4JBM A;  1C7Y A;  1RIP A;  5AJ3 L;  3F1Z A;  4R4Q A;  3S24 A;  5F2K A;  5ELO A;  3A74 A;  4DPG A;  4X64 Q;  3PIO A;  1PH6 A;  3PO2 G;  3PIP A;  4GS3 A;  4DV6 L;  4LFC L;  3S15 H;  3WBH A;  4GLA C;  2F52 A;  4R1J A;  5IP7 H;  5IWA Q;  4IFD I;  4A3E H;  4IFD G;  3T1Y Q;  3AFP A;  2NVX H;  3NEL A;  4GKJ L;  3CC2 P;  3ER0 A;  5IY0 A;  2JE6 I;  2LXK A;  2OQK A;  3DS1 A;  2K14 A;  1WYD A;  2R92 G;  5M5X H;  4COC A;  1Q82 C;  1QVG A;  1YI2 A;  1K8A Q;  1WCM G;  2ALY B;  4DV5 Q;  4A3F G;  3BZC A;  1M74 A;  4BBR G;  2L6E A;  4U0B A;  4DV4 L;  1BVS A;  1Q1B A;  3M7N A;  3ERS X;  3J7Z C;  4JC0 A;  1HR0 W;  2BH2 A;  2GVB A;  1YIJ A;  2YU9 H;  4OWX B;  2VQF L;  3DM3 A;  4BY7 H;  1OXX K;  2MO1 A;  1DGS A;  3CMA P;  1SE8 A;  3TQY A;  3KFU A;  3M1M A;  1QVG O;  4XFX A;  1Y1W G;  1N33 Q;  2JEA I;  2AWN A;  4JI6 L;  1YHQ A;  3M9B A;  2Z44 A;  4BY1 H;  4J15 A;  1XNQ Q;  5LMN W;  4YHH Q;  4HIK A;  1M1K C;  3TRZ A;  1O7I A;  4LF6 Q;  2R93 G;  3FKI G;  4U0E A;  4DR2 Q;  2UXB L;  1XNQ L;  4X62 L;  1WOC A;  1VQG A;  4IJL A;  3OW2 O;  4RMF A;  4A3J G;  1EIA A;  2Y0S E;  4LFB Q;  1J5E L;  1YEZ A;  5K36 G;  1TWF H;  1YJN A;  2L15 A;  3GTK H;  2UXB Q;  4JOI C;  4RG1 A;  4X64 L;  1OXV A;  1KAW A;  3LRY A;  2D62 A;  2CWP A;  3BU2 A;  1X3E A;  1YJW P;  2PQA A;  1N32 L;  1K8G A;  1S3O A;  1YZ6 A;  2K5V A;  3ICE A;  4JI3 L;  3OW2 A;  4R4O A;  2E2J H;  1VQ5 A;  4O2D A;  1NMF A;  1EUJ A;  3UE0 A;  1Q81 C;  2JYG A;  2Z6K A;  2IX1 A;  1GVP A;  1I50 H;  2YTX A;  4A93 H;  5IP9 G;  1VQD A;  3CW2 C;  3GTJ H;  1KHI A;  3AEV A;  3S1Q H;  2CWA A;  4IFD J;  3M3Y H;  1EYG A;  1N36 L;  1TWA H;  2WFW A;  3LGJ A;  4LFC Q;  2OTJ P;  3FP9 A;  4DR1 L;  1M90 Q;  3CPW A;  1VQL P;  5EAY A;  3ULP A;  4DR6 L;  4K0K L;  1WJJ A;  1I5F A;  2RHQ B;  1JT8 A;  1HNX Q;  3M85 A;  1JJ2 O;  3HOW G;  3KDF A;  2PMZ E;  1D8L A;  3I56 A;  4K0K Q;  2AKW B;  3G6E P;  2PI2 E;  3PUW A;  3SGI A;  4OX9 Q;  3PUX A;  4P72 A;  4HJ5 A;  1FJG Q;  4COP A;  2I5H A;  1K73 C;  2DUD A;  4WYM A;  3HOY G;  2EIF A;  1HH2 P;  1KD1 C;  4GOP B;  3I4N H;  2C35 B;  3PF4 A;  3Q8D A;  2GN5 A;  4OX9 L;  4YCW A;  5JEA J;  5JJI A;  1BBU A;  4AQY L;  3M4O H;  3G29 A;  3D31 A;  3GTP H;  3HOX G;  1QUQ A;  1PH5 A;  4JI2 L;  1EOV A;  1Q8K A;  3I7F A;  4L5T A;  3H0D A;  1VQF A;  5FJ8 G;  5IYD H;  3ZJY C;  1D1D A;  4GKK L;  1XTD A;  5C3E G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...