2DHOA

Crystal structure of human ipp isomerase i in space group p212121
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
215
structure length
215
Chain Sequence
b'QVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRMNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isopentenyl-diphosphate delta-isomerase 1
publication title Crystal structures of human IPP isomerase: new insights into the catalytic mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 81
structure length 215
sequence length 215
ec nomenclature ec 5.3.3.2: Isopentenyl-diphosphate Delta-isomerase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2dhoA00
1V8SA 1VCDA 3MDIA 2PNYA 5ANTA 3AC9A 1PPVA 1X84A 2A8RA 3BAPA 3GRNA 2ICJA 3A6UA 3F6AA 1XSCA 4V14A 3G0QA 4C9XA 3X0IA 2A8TA 5FSOA 1SOIA 2O5WA 2J8QA 3A6SA 2A8QA 3Q1PA 1RRQA 3FK9A 1MUTA 3Q91A 1Q27A 3Q2TA 1K26A 5FSLA 3SMDA 4YOQA 3MCFA 5FSKA 1IRYA 2KDWA 3SONA 1MQEA 3L85A 5C7TA 1V8YA 1V8VA 2GT2A 1MP2A 1V8NA 4ICKA 1TUMA 4IJXA 3E57A 3N77A 4YPHA 4JZVA 2DSDA 1VHGA 5GHMA 2FVVA 1V8UA 1X51A 1X83A 5DPKA 4NFWA 3KVHA 5GHIA 2KDVA 2Q9PA 3X0LA 1JKNA 1NQZA 3DUPA 2B2KA 2AZWA 1NFZA 1V8LA 1PPWA 2DSCA 1R67A 1Q54A 3U53A 3X0MA 5FSMA 1F3YA 2B06A 1PVFA 3QSJA 4KTBA 1G9QA 5C7QA 5DD4A 4HVYA 1PPXA 3J7Ye 1Q33A 5GHQA 2I6KA 5HZXA 2QKMB 1HZTA 2DSBA 3FFUA 4KYXA 3GZ8A 2W4EA 2YVPA 1QVJA 2YVOA 2DUKA 3FCMA 1VIQA 2B0VA 3EF5A 4JZTA 4ILQA 3OGAA 3O6ZA 4S2WA 5ANUA 3EXQA 1MK1A 3WHWA 3X0RA 3GWYA 3X0QA 3EESA 3X0OA 1MQWA 1XSAA 3RH7A 3X0PA 3I9XA 3BHOA 1PUQA 3FJYA 1MR2A 3I7UA 3GZ5A 3COUA 2GB5A 5GHPA 1VC9A 5C8LA 3HHJA 1KHZA 3MGMA 3O69A 1VIUA 2I8UA 1OW2A 3ID9A 4HFQA 5FSNA 2YVMA 2QJOA 2YVNA 3N9UA 3SHDA 2O1CA 3Q4IA 5LPGA 3GG6A 5BS6A 2VNPA 4N1UA 1GA7A 3H95A 5CFJA 5ANSA 1VC8A 3Q93A 5CFIA 1V8IA 1KT9A 5GHJA 4DYWA 3A6VA 3FSPA 2RRKA 2XSQA 1VHZA 5IW5A 3F13A 5BONA 2O5FA 4ZG0A 4JZSA 1V8WA 1I9AA 4C9WA 5I8UA 3CNGA 2YYHA 2QJTA 1G0SA 1V8TA 2JVBA 4S2YA 3P6YA 2I8TA 3X0KA 1U20A 1V8MA 1PUNA 3O8SA 5ISYA 4JZUA 3O61A 3Q2SA 1RYAA 5DEQA 4KG3A 3EEUA 3O52A 5GHNA 1VRLA 2PQVA 3X0SA 3I7VA 4K6EA 1PUSA 2R5WA 1NQYA 5FSIA 4S2XA 5ANWA 3ZR1A 4KG4A 3ZR0A 3X0NA 2FMLA 4N1TA 3MDGA 1JRKA 1SZ3A 2A8SA 3DKUA 1K2EA 2G73A 2GT4A 2ICKA 1VK6A 3A6TA 3ACAA 1NFSA 2VNQA 5DDGA 2A8PA 1KTGA 1XSBA 1HX3A 3GZ6A 4MPOA 5GHOA 2FKBA 3X0JA 3BM4A 5IW4A 2G74A 4S2VA 2CL3A 3R03A 5ANVA 4YPRA 1SU2A 3P5TA 1SJYA 4NFXA 1V8RA 2A6TA 2DHOA 1RRSA 3HYQA
chains in the Genus database with same CATH superfamily
1V8SA 1VCDA 3MDIA 2PNYA 5ANTA 3AC9A 1PPVA 1X84A 2A8RA 3BAPA 3GRNA 2ICJA 3A6UA 3F6AA 1XSCA 4V14A 3G0QA 4C9XA 3X0IA 2A8TA 5FSOA 1SOIA 2O5WA 2J8QA 3A6SA 2A8QA 3Q1PA 1RRQA 3FK9A 1MUTA 3Q91A 1Q27A 3Q2TA 1K26A 5FSLA 3SMDA 4YOQA 3MCFA 5FSKA 1IRYA 2KDWA 3SONA 1MQEA 3L85A 5C7TA 1V8YA 1V8VA 2GT2A 1MP2A 1V8NA 4ICKA 1TUMA 4IJXA 3E57A 3N77A 4YPHA 4JZVA 2DSDA 1VHGA 5GHMA 2FVVA 1V8UA 1X51A 1X83A 5DPKA 4NFWA 3KVHA 5GHIA 2KDVA 2Q9PA 3X0LA 1JKNA 1NQZA 3DUPA 2B2KA 2AZWA 1NFZA 1V8LA 1PPWA 2DSCA 1R67A 1Q54A 3U53A 3X0MA 5FSMA 1F3YA 2B06A 1PVFA 3QSJA 4KTBA 1G9QA 5C7QA 5DD4A 4HVYA 1PPXA 3J7Ye 1Q33A 5GHQA 2I6KA 5HZXA 2QKMB 1HZTA 2DSBA 3FFUA 4KYXA 3GZ8A 2W4EA 2YVPA 1QVJA 2YVOA 2DUKA 3FCMA 1VIQA 2B0VA 3EF5A 4JZTA 4ILQA 3OGAA 3O6ZA 4S2WA 5ANUA 3EXQA 1MK1A 3WHWA 3X0RA 3GWYA 3X0QA 3EESA 3X0OA 1MQWA 1XSAA 3RH7A 3X0PA 3I9XA 3BHOA 1PUQA 3FJYA 1MR2A 3I7UA 3GZ5A 3COUA 2GB5A 5GHPA 1VC9A 5C8LA 3HHJA 1KHZA 3MGMA 3O69A 1VIUA 2I8UA 1OW2A 3ID9A 4HFQA 5FSNA 2YVMA 2QJOA 2YVNA 3N9UA 3SHDA 2O1CA 3Q4IA 5LPGA 3GG6A 5BS6A 2VNPA 4N1UA 1GA7A 3H95A 5CFJA 5ANSA 1VC8A 3Q93A 5CFIA 1V8IA 1KT9A 5GHJA 4DYWA 3A6VA 3FSPA 2RRKA 2XSQA 1VHZA 5IW5A 3F13A 5BONA 2O5FA 4ZG0A 4JZSA 1V8WA 1I9AA 4C9WA 5I8UA 3CNGA 2YYHA 2QJTA 2CZRA 1G0SA 1V8TA 2JVBA 4S2YA 3P6YA 2I8TA 3X0KA 1U20A 1V8MA 1PUNA 3O8SA 5ISYA 4JZUA 3O61A 3Q2SA 1RYAA 5DEQA 4KG3A 3EEUA 3O52A 5GHNA 1VRLA 2PQVA 3X0SA 3I7VA 4K6EA 1PUSA 2R5WA 1NQYA 5FSIA 4S2XA 5ANWA 3ZR1A 4KG4A 3ZR0A 3X0NA 2FMLA 4N1TA 3MDGA 1JRKA 1SZ3A 2A8SA 3DKUA 1K2EA 2G73A 2GT4A 2ICKA 1VK6A 3A6TA 3ACAA 1NFSA 2VNQA 4J7GA 5DDGA 2A8PA 1KTGA 1XSBA 1HX3A 3GZ6A 4MPOA 5GHOA 2FKBA 3X0JA 3BM4A 5IW4A 4J7HA 2G74A 4S2VA 2CL3A 3R03A 5ANVA 4YPRA 1SU2A 3P5TA 1SJYA 4NFXA 1V8RA 2A6TA 2DHOA 1RRSA 3HYQA
chains in the Genus database with same CATH topology
1V8SA 1VCDA 3MDIA 2PNYA 5ANTA 3AC9A 1PPVA 1X84A 2A8RA 3BAPA 3GRNA 2ICJA 3A6UA 3F6AA 1XSCA 4V14A 3G0QA 4C9XA 3X0IA 2A8TA 5FSOA 1SOIA 2O5WA 2J8QA 3A6SA 2A8QA 3Q1PA 1RRQA 3FK9A 1MUTA 3Q91A 1Q27A 3Q2TA 1K26A 5FSLA 3SMDA 4YOQA 3MCFA 5FSKA 1IRYA 2KDWA 3SONA 1MQEA 3L85A 5C7TA 1V8YA 1V8VA 2GT2A 1MP2A 1V8NA 4ICKA 1TUMA 4IJXA 3E57A 3N77A 4YPHA 4JZVA 2DSDA 1VHGA 5GHMA 2FVVA 1V8UA 1X51A 1X83A 5DPKA 4NFWA 3KVHA 5GHIA 2KDVA 2Q9PA 3X0LA 1JKNA 1NQZA 3DUPA 2B2KA 2AZWA 1NFZA 1V8LA 1PPWA 2DSCA 1R67A 1Q54A 3U53A 3X0MA 5FSMA 1F3YA 2B06A 1PVFA 3QSJA 4KTBA 1G9QA 5C7QA 5DD4A 4HVYA 1PPXA 3J7Ye 1Q33A 5GHQA 2I6KA 5HZXA 2QKMB 1HZTA 2DSBA 3FFUA 4KYXA 3GZ8A 2W4EA 2YVPA 1QVJA 2YVOA 2DUKA 3FCMA 1VIQA 2B0VA 3EF5A 4JZTA 4ILQA 3OGAA 3O6ZA 4S2WA 5ANUA 3EXQA 1MK1A 3WHWA 3X0RA 3GWYA 3X0QA 3EESA 3X0OA 1MQWA 1XSAA 3RH7A 3X0PA 3I9XA 3BHOA 1PUQA 3FJYA 1MR2A 3I7UA 3GZ5A 3COUA 2GB5A 5GHPA 1VC9A 5C8LA 3HHJA 1KHZA 3MGMA 3O69A 1VIUA 2I8UA 1OW2A 3ID9A 4HFQA 5FSNA 2YVMA 2QJOA 2YVNA 3N9UA 3SHDA 2O1CA 3Q4IA 5LPGA 3GG6A 5BS6A 2VNPA 4N1UA 1GA7A 3H95A 5CFJA 5ANSA 1VC8A 3Q93A 5CFIA 1V8IA 1KT9A 5GHJA 4DYWA 3A6VA 3FSPA 2RRKA 2XSQA 1VHZA 5IW5A 3F13A 5BONA 2O5FA 4ZG0A 4JZSA 1V8WA 1I9AA 4C9WA 5I8UA 3CNGA 2YYHA 2QJTA 2CZRA 1G0SA 1V8TA 2JVBA 4S2YA 3P6YA 2I8TA 3X0KA 1U20A 1V8MA 1PUNA 3O8SA 5ISYA 4JZUA 3O61A 3Q2SA 1RYAA 5DEQA 4KG3A 3EEUA 3O52A 5GHNA 1VRLA 2PQVA 3X0SA 3I7VA 4K6EA 1PUSA 2R5WA 1NQYA 5FSIA 4S2XA 5ANWA 3ZR1A 4KG4A 3ZR0A 3X0NA 2FMLA 4N1TA 3MDGA 1JRKA 1SZ3A 2A8SA 3DKUA 1K2EA 2G73A 2GT4A 2ICKA 1VK6A 3A6TA 3ACAA 1NFSA 2VNQA 4J7GA 5DDGA 2A8PA 1KTGA 1XSBA 1HX3A 3GZ6A 4MPOA 5GHOA 2FKBA 3X0JA 3BM4A 5IW4A 4J7HA 2G74A 4S2VA 2CL3A 3R03A 5ANVA 4YPRA 1SU2A 3P5TA 1SJYA 4NFXA 1V8RA 2A6TA 2DHOA 1RRSA 3HYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V8S A;  1VCD A;  3MDI A;  2PNY A;  5ANT A;  3AC9 A;  1PPV A;  1X84 A;  2A8R A;  3BAP A;  3GRN A;  2ICJ A;  3A6U A;  3F6A A;  1XSC A;  4V14 A;  3G0Q A;  4C9X A;  3X0I A;  2A8T A;  5FSO A;  1SOI A;  2O5W A;  2J8Q A;  3A6S A;  2A8Q A;  3Q1P A;  1RRQ A;  3FK9 A;  1MUT A;  3Q91 A;  1Q27 A;  3Q2T A;  1K26 A;  5FSL A;  3SMD A;  4YOQ A;  3MCF A;  5FSK A;  1IRY A;  2KDW A;  3SON A;  1MQE A;  3L85 A;  5C7T A;  1V8Y A;  1V8V A;  2GT2 A;  1MP2 A;  1V8N A;  4ICK A;  1TUM A;  4IJX A;  3E57 A;  3N77 A;  4YPH A;  4JZV A;  2DSD A;  1VHG A;  5GHM A;  2FVV A;  1V8U A;  1X51 A;  1X83 A;  5DPK A;  4NFW A;  3KVH A;  5GHI A;  2KDV A;  2Q9P A;  3X0L A;  1JKN A;  1NQZ A;  3DUP A;  2B2K A;  2AZW A;  1NFZ A;  1V8L A;  1PPW A;  2DSC A;  1R67 A;  1Q54 A;  3U53 A;  3X0M A;  5FSM A;  1F3Y A;  2B06 A;  1PVF A;  3QSJ A;  4KTB A;  1G9Q A;  5C7Q A;  5DD4 A;  4HVY A;  1PPX A;  3J7Y e;  1Q33 A;  5GHQ A;  2I6K A;  5HZX A;  2QKM B;  1HZT A;  2DSB A;  3FFU A;  4KYX A;  3GZ8 A;  2W4E A;  2YVP A;  1QVJ A;  2YVO A;  2DUK A;  3FCM A;  1VIQ A;  2B0V A;  3EF5 A;  4JZT A;  4ILQ A;  3OGA A;  3O6Z A;  4S2W A;  5ANU A;  3EXQ A;  1MK1 A;  3WHW A;  3X0R A;  3GWY A;  3X0Q A;  3EES A;  3X0O A;  1MQW A;  1XSA A;  3RH7 A;  3X0P A;  3I9X A;  3BHO A;  1PUQ A;  3FJY A;  1MR2 A;  3I7U A;  3GZ5 A;  3COU A;  2GB5 A;  5GHP A;  1VC9 A;  5C8L A;  3HHJ A;  1KHZ A;  3MGM A;  3O69 A;  1VIU A;  2I8U A;  1OW2 A;  3ID9 A;  4HFQ A;  5FSN A;  2YVM A;  2QJO A;  2YVN A;  3N9U A;  3SHD A;  2O1C A;  3Q4I A;  5LPG A;  3GG6 A;  5BS6 A;  2VNP A;  4N1U A;  1GA7 A;  3H95 A;  5CFJ A;  5ANS A;  1VC8 A;  3Q93 A;  5CFI A;  1V8I A;  1KT9 A;  5GHJ A;  4DYW A;  3A6V A;  3FSP A;  2RRK A;  2XSQ A;  1VHZ A;  5IW5 A;  3F13 A;  5BON A;  2O5F A;  4ZG0 A;  4JZS A;  1V8W A;  1I9A A;  4C9W A;  5I8U A;  3CNG A;  2YYH A;  2QJT A;  1G0S A;  1V8T A;  2JVB A;  4S2Y A;  3P6Y A;  2I8T A;  3X0K A;  1U20 A;  1V8M A;  1PUN A;  3O8S A;  5ISY A;  4JZU A;  3O61 A;  3Q2S A;  1RYA A;  5DEQ A;  4KG3 A;  3EEU A;  3O52 A;  5GHN A;  1VRL A;  2PQV A;  3X0S A;  3I7V A;  4K6E A;  1PUS A;  2R5W A;  1NQY A;  5FSI A;  4S2X A;  5ANW A;  3ZR1 A;  4KG4 A;  3ZR0 A;  3X0N A;  2FML A;  4N1T A;  3MDG A;  1JRK A;  1SZ3 A;  2A8S A;  3DKU A;  1K2E A;  2G73 A;  2GT4 A;  2ICK A;  1VK6 A;  3A6T A;  3ACA A;  1NFS A;  2VNQ A;  5DDG A;  2A8P A;  1KTG A;  1XSB A;  1HX3 A;  3GZ6 A;  4MPO A;  5GHO A;  2FKB A;  3X0J A;  3BM4 A;  5IW4 A;  2G74 A;  4S2V A;  2CL3 A;  3R03 A;  5ANV A;  4YPR A;  1SU2 A;  3P5T A;  1SJY A;  4NFX A;  1V8R A;  2A6T A;  2DHO A;  1RRS A;  3HYQ A; 
#chains in the Genus database with same CATH topology
 1V8S A;  1VCD A;  3MDI A;  2PNY A;  5ANT A;  3AC9 A;  1PPV A;  1X84 A;  2A8R A;  3BAP A;  3GRN A;  2ICJ A;  3A6U A;  3F6A A;  1XSC A;  4V14 A;  3G0Q A;  4C9X A;  3X0I A;  2A8T A;  5FSO A;  1SOI A;  2O5W A;  2J8Q A;  3A6S A;  2A8Q A;  3Q1P A;  1RRQ A;  3FK9 A;  1MUT A;  3Q91 A;  1Q27 A;  3Q2T A;  1K26 A;  5FSL A;  3SMD A;  4YOQ A;  3MCF A;  5FSK A;  1IRY A;  2KDW A;  3SON A;  1MQE A;  3L85 A;  5C7T A;  1V8Y A;  1V8V A;  2GT2 A;  1MP2 A;  1V8N A;  4ICK A;  1TUM A;  4IJX A;  3E57 A;  3N77 A;  4YPH A;  4JZV A;  2DSD A;  1VHG A;  5GHM A;  2FVV A;  1V8U A;  1X51 A;  1X83 A;  5DPK A;  4NFW A;  3KVH A;  5GHI A;  2KDV A;  2Q9P A;  3X0L A;  1JKN A;  1NQZ A;  3DUP A;  2B2K A;  2AZW A;  1NFZ A;  1V8L A;  1PPW A;  2DSC A;  1R67 A;  1Q54 A;  3U53 A;  3X0M A;  5FSM A;  1F3Y A;  2B06 A;  1PVF A;  3QSJ A;  4KTB A;  1G9Q A;  5C7Q A;  5DD4 A;  4HVY A;  1PPX A;  3J7Y e;  1Q33 A;  5GHQ A;  2I6K A;  5HZX A;  2QKM B;  1HZT A;  2DSB A;  3FFU A;  4KYX A;  3GZ8 A;  2W4E A;  2YVP A;  1QVJ A;  2YVO A;  2DUK A;  3FCM A;  1VIQ A;  2B0V A;  3EF5 A;  4JZT A;  4ILQ A;  3OGA A;  3O6Z A;  4S2W A;  5ANU A;  3EXQ A;  1MK1 A;  3WHW A;  3X0R A;  3GWY A;  3X0Q A;  3EES A;  3X0O A;  1MQW A;  1XSA A;  3RH7 A;  3X0P A;  3I9X A;  3BHO A;  1PUQ A;  3FJY A;  1MR2 A;  3I7U A;  3GZ5 A;  3COU A;  2GB5 A;  5GHP A;  1VC9 A;  5C8L A;  3HHJ A;  1KHZ A;  3MGM A;  3O69 A;  1VIU A;  2I8U A;  1OW2 A;  3ID9 A;  4HFQ A;  5FSN A;  2YVM A;  2QJO A;  2YVN A;  3N9U A;  3SHD A;  2O1C A;  3Q4I A;  5LPG A;  3GG6 A;  5BS6 A;  2VNP A;  4N1U A;  1GA7 A;  3H95 A;  5CFJ A;  5ANS A;  1VC8 A;  3Q93 A;  5CFI A;  1V8I A;  1KT9 A;  5GHJ A;  4DYW A;  3A6V A;  3FSP A;  2RRK A;  2XSQ A;  1VHZ A;  5IW5 A;  3F13 A;  5BON A;  2O5F A;  4ZG0 A;  4JZS A;  1V8W A;  1I9A A;  4C9W A;  5I8U A;  3CNG A;  2YYH A;  2QJT A;  2CZR A;  1G0S A;  1V8T A;  2JVB A;  4S2Y A;  3P6Y A;  2I8T A;  3X0K A;  1U20 A;  1V8M A;  1PUN A;  3O8S A;  5ISY A;  4JZU A;  3O61 A;  3Q2S A;  1RYA A;  5DEQ A;  4KG3 A;  3EEU A;  3O52 A;  5GHN A;  1VRL A;  2PQV A;  3X0S A;  3I7V A;  4K6E A;  1PUS A;  2R5W A;  1NQY A;  5FSI A;  4S2X A;  5ANW A;  3ZR1 A;  4KG4 A;  3ZR0 A;  3X0N A;  2FML A;  4N1T A;  3MDG A;  1JRK A;  1SZ3 A;  2A8S A;  3DKU A;  1K2E A;  2G73 A;  2GT4 A;  2ICK A;  1VK6 A;  3A6T A;  3ACA A;  1NFS A;  2VNQ A;  4J7G A;  5DDG A;  2A8P A;  1KTG A;  1XSB A;  1HX3 A;  3GZ6 A;  4MPO A;  5GHO A;  2FKB A;  3X0J A;  3BM4 A;  5IW4 A;  4J7H A;  2G74 A;  4S2V A;  2CL3 A;  3R03 A;  5ANV A;  4YPR A;  1SU2 A;  3P5T A;  1SJY A;  4NFX A;  1V8R A;  2A6T A;  2DHO A;  1RRS A;  3HYQ A; 
#chains in the Genus database with same CATH homology
 1V8S A;  1VCD A;  3MDI A;  2PNY A;  5ANT A;  3AC9 A;  1PPV A;  1X84 A;  2A8R A;  3BAP A;  3GRN A;  2ICJ A;  3A6U A;  3F6A A;  1XSC A;  4V14 A;  3G0Q A;  4C9X A;  3X0I A;  2A8T A;  5FSO A;  1SOI A;  2O5W A;  2J8Q A;  3A6S A;  2A8Q A;  3Q1P A;  1RRQ A;  3FK9 A;  1MUT A;  3Q91 A;  1Q27 A;  3Q2T A;  1K26 A;  5FSL A;  3SMD A;  4YOQ A;  3MCF A;  5FSK A;  1IRY A;  2KDW A;  3SON A;  1MQE A;  3L85 A;  5C7T A;  1V8Y A;  1V8V A;  2GT2 A;  1MP2 A;  1V8N A;  4ICK A;  1TUM A;  4IJX A;  3E57 A;  3N77 A;  4YPH A;  4JZV A;  2DSD A;  1VHG A;  5GHM A;  2FVV A;  1V8U A;  1X51 A;  1X83 A;  5DPK A;  4NFW A;  3KVH A;  5GHI A;  2KDV A;  2Q9P A;  3X0L A;  1JKN A;  1NQZ A;  3DUP A;  2B2K A;  2AZW A;  1NFZ A;  1V8L A;  1PPW A;  2DSC A;  1R67 A;  1Q54 A;  3U53 A;  3X0M A;  5FSM A;  1F3Y A;  2B06 A;  1PVF A;  3QSJ A;  4KTB A;  1G9Q A;  5C7Q A;  5DD4 A;  4HVY A;  1PPX A;  3J7Y e;  1Q33 A;  5GHQ A;  2I6K A;  5HZX A;  2QKM B;  1HZT A;  2DSB A;  3FFU A;  4KYX A;  3GZ8 A;  2W4E A;  2YVP A;  1QVJ A;  2YVO A;  2DUK A;  3FCM A;  1VIQ A;  2B0V A;  3EF5 A;  4JZT A;  4ILQ A;  3OGA A;  3O6Z A;  4S2W A;  5ANU A;  3EXQ A;  1MK1 A;  3WHW A;  3X0R A;  3GWY A;  3X0Q A;  3EES A;  3X0O A;  1MQW A;  1XSA A;  3RH7 A;  3X0P A;  3I9X A;  3BHO A;  1PUQ A;  3FJY A;  1MR2 A;  3I7U A;  3GZ5 A;  3COU A;  2GB5 A;  5GHP A;  1VC9 A;  5C8L A;  3HHJ A;  1KHZ A;  3MGM A;  3O69 A;  1VIU A;  2I8U A;  1OW2 A;  3ID9 A;  4HFQ A;  5FSN A;  2YVM A;  2QJO A;  2YVN A;  3N9U A;  3SHD A;  2O1C A;  3Q4I A;  5LPG A;  3GG6 A;  5BS6 A;  2VNP A;  4N1U A;  1GA7 A;  3H95 A;  5CFJ A;  5ANS A;  1VC8 A;  3Q93 A;  5CFI A;  1V8I A;  1KT9 A;  5GHJ A;  4DYW A;  3A6V A;  3FSP A;  2RRK A;  2XSQ A;  1VHZ A;  5IW5 A;  3F13 A;  5BON A;  2O5F A;  4ZG0 A;  4JZS A;  1V8W A;  1I9A A;  4C9W A;  5I8U A;  3CNG A;  2YYH A;  2QJT A;  2CZR A;  1G0S A;  1V8T A;  2JVB A;  4S2Y A;  3P6Y A;  2I8T A;  3X0K A;  1U20 A;  1V8M A;  1PUN A;  3O8S A;  5ISY A;  4JZU A;  3O61 A;  3Q2S A;  1RYA A;  5DEQ A;  4KG3 A;  3EEU A;  3O52 A;  5GHN A;  1VRL A;  2PQV A;  3X0S A;  3I7V A;  4K6E A;  1PUS A;  2R5W A;  1NQY A;  5FSI A;  4S2X A;  5ANW A;  3ZR1 A;  4KG4 A;  3ZR0 A;  3X0N A;  2FML A;  4N1T A;  3MDG A;  1JRK A;  1SZ3 A;  2A8S A;  3DKU A;  1K2E A;  2G73 A;  2GT4 A;  2ICK A;  1VK6 A;  3A6T A;  3ACA A;  1NFS A;  2VNQ A;  4J7G A;  5DDG A;  2A8P A;  1KTG A;  1XSB A;  1HX3 A;  3GZ6 A;  4MPO A;  5GHO A;  2FKB A;  3X0J A;  3BM4 A;  5IW4 A;  4J7H A;  2G74 A;  4S2V A;  2CL3 A;  3R03 A;  5ANV A;  4YPR A;  1SU2 A;  3P5T A;  1SJY A;  4NFX A;  1V8R A;  2A6T A;  2DHO A;  1RRS A;  3HYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...