2DHOA

Crystal structure of human ipp isomerase i in space group p212121
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
215
structure length
215
Chain Sequence
QVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRMNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isopentenyl-diphosphate delta-isomerase 1
publication title Crystal structures of human IPP isomerase: new insights into the catalytic mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 81
structure length 215
sequence length 215
ec nomenclature ec 5.3.3.2: Isopentenyl-diphosphate Delta-isomerase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2dhoA00
4ZG0A 2GT4A 2ICJA 2KDVA 3DKUA 5ANSA 2KDWA 3Q91A 3O6ZA 3QSJA 3Q2TA 1RYAA 4S2YA 3EXQA 2Q9PA 2I8TA 4JZUA 1RRSA 1F3YA 2YVPA 3A6UA 1Q54A 3Q93A 1Q27A 2AZWA 5CFIA 1VCDA 1SZ3A 2ICKA 3N77A 1MR2A 1VK6A 3R03A 2YYHA 3O52A 1PUNA 3WHWA 1HX3A 3COUA 5IW4A 3N9UA 4ILQA 1G0SA 1NFSA 3AC9A 2CL3A 4HFQA 5DEQA 5DDGA 1MP2A 1VHGA 5LPGA 2QJTA 3GZ6A 3EESA 5FSIA 3SHDA 2FKBA 3I7UA 3X0RA 4HVYA 1V8WA 1SU2A 5GHPA 2FMLA 2B2KA 3X0KA 2GB5A 3U53A 2I8UA 1JRKA 2VNPA 3X0OA 3MCFA 1V8YA 2A6TA 4K6EA 1V8TA 5IW5A 3P6YA 3FCMA 1PPXA 1XSBA 3SONA 1QVJA 3I7VA 1PUQA 4C9XA 3F6AA 3Q1PA 2A8PA 3A6VA 4NFXA 1Q33A 3J7Ye 3A6TA 5FSMA 2RRKA 3FSPA 4KYXA 5GHMA 2J8QA 2GT2A 3SMDA 3ZR1A 3Q2SA 2JVBA 5BONA 2G74A 2YVNA 5HZXA 2VNQA 3GZ8A 1GA7A 3DUPA 3H95A 2A8SA 2DUKA 4YPHA 1V8VA 3A6SA 3MDIA 4JZSA 1KTGA 1V8SA 2A8TA 3EF5A 5ANUA 1R67A 4NFWA 3G0QA 2YVMA 3MGMA 5FSKA 1NFZA 3P5TA 1XSCA 2QJOA 3HHJA 1U20A 2PQVA 4V14A 4KG4A 3X0QA 2A8RA 1OW2A 1K26A 1K2EA 1V8MA 1X84A 5GHJA 1KHZA 3X0SA 5GHQA 3X0IA 2O5FA 2G73A 1V8NA 3RH7A 3BM4A 4YOQA 1SJYA 2W4EA 2DSDA 2DSBA 4S2VA 4N1TA 1VRLA 1VC8A 1VIUA 1XSAA 1MUTA 2R5WA 3OGAA 4MPOA 3HYQA 5I8UA 5C8LA 4C9WA 2O5WA 3O69A 3BAPA 4JZVA 4DYWA 2XSQA 1V8RA 3ZR0A 5FSOA 1G9QA 2DHOA 3GWYA 5ANTA 1SOIA 5BS6A 4S2XA 1PPWA 1NQYA 4YPRA 2B0VA 2QKMB 2YVOA 2A8QA 3E57A 3EEUA 4ICKA 4KG3A 5GHNA 3GRNA 4N1UA 2FVVA 5FSLA 3BHOA 5ANWA 1X83A 3O8SA 1MQWA 5C7QA 3X0PA 3FK9A 5DD4A 3I9XA 5GHOA 3KVHA 1NQZA 1V8UA 3X0NA 1PVFA 3ACAA 5ISYA 1V8LA 1VIQA 2PNYA 3L85A 4IJXA 3F13A 3GG6A 3O61A 1HZTA 1PPVA 5CFJA 3X0MA 1VC9A 5FSNA 1JKNA 2I6KA 1KT9A 3X0LA 5ANVA 1TUMA 2O1CA 5GHIA 5DPKA 2DSCA 3GZ5A 1PUSA 3FJYA 4S2WA 3MDGA 5C7TA 1I9AA 1MK1A 3Q4IA 4JZTA 4KTBA 3ID9A 3X0JA 1MQEA 3CNGA 3FFUA 1IRYA 1VHZA 1RRQA 1V8IA 2B06A 1X51A
chains in the Genus database with same CATH superfamily
4ZG0A 2GT4A 2ICJA 2KDVA 3DKUA 5ANSA 2KDWA 3Q91A 3O6ZA 3QSJA 3Q2TA 1RYAA 4S2YA 3EXQA 2Q9PA 2I8TA 4JZUA 1RRSA 1F3YA 2YVPA 3A6UA 1Q54A 3Q93A 1Q27A 2AZWA 5CFIA 1VCDA 1SZ3A 2ICKA 3N77A 1MR2A 1VK6A 3R03A 2YYHA 3O52A 1PUNA 3WHWA 1HX3A 3COUA 5IW4A 3N9UA 4ILQA 1G0SA 1NFSA 3AC9A 2CL3A 4HFQA 5DEQA 5DDGA 1MP2A 1VHGA 5LPGA 2QJTA 3GZ6A 3EESA 5FSIA 3SHDA 2FKBA 3I7UA 3X0RA 4HVYA 1V8WA 1SU2A 5GHPA 2FMLA 2B2KA 3X0KA 2GB5A 3U53A 2CZRA 4J7GA 2I8UA 1JRKA 2VNPA 3X0OA 3MCFA 1V8YA 2A6TA 4K6EA 1V8TA 5IW5A 3P6YA 3FCMA 1PPXA 1XSBA 3SONA 1QVJA 3I7VA 1PUQA 4C9XA 3F6AA 3Q1PA 2A8PA 3A6VA 4NFXA 1Q33A 3J7Ye 3A6TA 5FSMA 2RRKA 3FSPA 4KYXA 5GHMA 2J8QA 2GT2A 3SMDA 3ZR1A 3Q2SA 2JVBA 5BONA 2G74A 2YVNA 5HZXA 2VNQA 3GZ8A 1GA7A 3DUPA 3H95A 2A8SA 2DUKA 4YPHA 1V8VA 3A6SA 3MDIA 4JZSA 1KTGA 1V8SA 2A8TA 3EF5A 5ANUA 1R67A 4NFWA 3G0QA 2YVMA 3MGMA 5FSKA 1NFZA 4J7HA 3P5TA 1XSCA 2QJOA 3HHJA 1U20A 2PQVA 4V14A 4KG4A 3X0QA 2A8RA 1OW2A 1K26A 1K2EA 1V8MA 1X84A 5GHJA 1KHZA 3X0SA 5GHQA 3X0IA 2O5FA 2G73A 1V8NA 3RH7A 3BM4A 4YOQA 1SJYA 2W4EA 2DSDA 2DSBA 4S2VA 4N1TA 1VRLA 1VC8A 1VIUA 1XSAA 1MUTA 2R5WA 3OGAA 4MPOA 3HYQA 5I8UA 5C8LA 4C9WA 2O5WA 3O69A 3BAPA 4JZVA 4DYWA 2XSQA 1V8RA 3ZR0A 5FSOA 1G9QA 2DHOA 3GWYA 5ANTA 1SOIA 5BS6A 4S2XA 1PPWA 1NQYA 4YPRA 2B0VA 2QKMB 2YVOA 2A8QA 3E57A 3EEUA 4ICKA 4KG3A 5GHNA 3GRNA 4N1UA 2FVVA 5FSLA 3BHOA 5ANWA 1X83A 3O8SA 1MQWA 5C7QA 3X0PA 3FK9A 5DD4A 3I9XA 5GHOA 3KVHA 1NQZA 1V8UA 3X0NA 1PVFA 3ACAA 5ISYA 1V8LA 1VIQA 2PNYA 3L85A 4IJXA 3F13A 3GG6A 3O61A 1HZTA 1PPVA 5CFJA 3X0MA 1VC9A 5FSNA 1JKNA 2I6KA 1KT9A 3X0LA 5ANVA 1TUMA 2O1CA 5GHIA 5DPKA 2DSCA 3GZ5A 1PUSA 3FJYA 4S2WA 3MDGA 5C7TA 1I9AA 1MK1A 3Q4IA 4JZTA 4KTBA 3ID9A 3X0JA 1MQEA 3CNGA 3FFUA 1IRYA 1VHZA 1RRQA 1V8IA 2B06A 1X51A
chains in the Genus database with same CATH topology
4ZG0A 2GT4A 2ICJA 2KDVA 3DKUA 5ANSA 2KDWA 3Q91A 3O6ZA 3QSJA 3Q2TA 1RYAA 4S2YA 3EXQA 2Q9PA 2I8TA 4JZUA 1RRSA 1F3YA 2YVPA 3A6UA 1Q54A 3Q93A 1Q27A 2AZWA 5CFIA 1VCDA 1SZ3A 2ICKA 3N77A 1MR2A 1VK6A 3R03A 2YYHA 3O52A 1PUNA 3WHWA 1HX3A 3COUA 5IW4A 3N9UA 4ILQA 1G0SA 1NFSA 3AC9A 2CL3A 4HFQA 5DEQA 5DDGA 1MP2A 1VHGA 5LPGA 2QJTA 3GZ6A 3EESA 5FSIA 3SHDA 2FKBA 3I7UA 3X0RA 4HVYA 1V8WA 1SU2A 5GHPA 2FMLA 2B2KA 3X0KA 2GB5A 3U53A 2CZRA 4J7GA 2I8UA 1JRKA 2VNPA 3X0OA 3MCFA 1V8YA 2A6TA 4K6EA 1V8TA 5IW5A 3P6YA 3FCMA 1PPXA 1XSBA 3SONA 1QVJA 3I7VA 1PUQA 4C9XA 3F6AA 3Q1PA 2A8PA 3A6VA 4NFXA 1Q33A 3J7Ye 3A6TA 5FSMA 2RRKA 3FSPA 4KYXA 5GHMA 2J8QA 2GT2A 3SMDA 3ZR1A 3Q2SA 2JVBA 5BONA 2G74A 2YVNA 5HZXA 2VNQA 3GZ8A 1GA7A 3DUPA 3H95A 2A8SA 2DUKA 4YPHA 1V8VA 3A6SA 3MDIA 4JZSA 1KTGA 1V8SA 2A8TA 3EF5A 5ANUA 1R67A 4NFWA 3G0QA 2YVMA 3MGMA 5FSKA 1NFZA 4J7HA 3P5TA 1XSCA 2QJOA 3HHJA 1U20A 2PQVA 4V14A 4KG4A 3X0QA 2A8RA 1OW2A 1K26A 1K2EA 1V8MA 1X84A 5GHJA 1KHZA 3X0SA 5GHQA 3X0IA 2O5FA 2G73A 1V8NA 3RH7A 3BM4A 4YOQA 1SJYA 2W4EA 2DSDA 2DSBA 4S2VA 4N1TA 1VRLA 1VC8A 1VIUA 1XSAA 1MUTA 2R5WA 3OGAA 4MPOA 3HYQA 5I8UA 5C8LA 4C9WA 2O5WA 3O69A 3BAPA 4JZVA 4DYWA 2XSQA 1V8RA 3ZR0A 5FSOA 1G9QA 2DHOA 3GWYA 5ANTA 1SOIA 5BS6A 4S2XA 1PPWA 1NQYA 4YPRA 2B0VA 2QKMB 2YVOA 2A8QA 3E57A 3EEUA 4ICKA 4KG3A 5GHNA 3GRNA 4N1UA 2FVVA 5FSLA 3BHOA 5ANWA 1X83A 3O8SA 1MQWA 5C7QA 3X0PA 3FK9A 5DD4A 3I9XA 5GHOA 3KVHA 1NQZA 1V8UA 3X0NA 1PVFA 3ACAA 5ISYA 1V8LA 1VIQA 2PNYA 3L85A 4IJXA 3F13A 3GG6A 3O61A 1HZTA 1PPVA 5CFJA 3X0MA 1VC9A 5FSNA 1JKNA 2I6KA 1KT9A 3X0LA 5ANVA 1TUMA 2O1CA 5GHIA 5DPKA 2DSCA 3GZ5A 1PUSA 3FJYA 4S2WA 3MDGA 5C7TA 1I9AA 1MK1A 3Q4IA 4JZTA 4KTBA 3ID9A 3X0JA 1MQEA 3CNGA 3FFUA 1IRYA 1VHZA 1RRQA 1V8IA 2B06A 1X51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZG0 A;  2GT4 A;  2ICJ A;  2KDV A;  3DKU A;  5ANS A;  2KDW A;  3Q91 A;  3O6Z A;  3QSJ A;  3Q2T A;  1RYA A;  4S2Y A;  3EXQ A;  2Q9P A;  2I8T A;  4JZU A;  1RRS A;  1F3Y A;  2YVP A;  3A6U A;  1Q54 A;  3Q93 A;  1Q27 A;  2AZW A;  5CFI A;  1VCD A;  1SZ3 A;  2ICK A;  3N77 A;  1MR2 A;  1VK6 A;  3R03 A;  2YYH A;  3O52 A;  1PUN A;  3WHW A;  1HX3 A;  3COU A;  5IW4 A;  3N9U A;  4ILQ A;  1G0S A;  1NFS A;  3AC9 A;  2CL3 A;  4HFQ A;  5DEQ A;  5DDG A;  1MP2 A;  1VHG A;  5LPG A;  2QJT A;  3GZ6 A;  3EES A;  5FSI A;  3SHD A;  2FKB A;  3I7U A;  3X0R A;  4HVY A;  1V8W A;  1SU2 A;  5GHP A;  2FML A;  2B2K A;  3X0K A;  2GB5 A;  3U53 A;  2I8U A;  1JRK A;  2VNP A;  3X0O A;  3MCF A;  1V8Y A;  2A6T A;  4K6E A;  1V8T A;  5IW5 A;  3P6Y A;  3FCM A;  1PPX A;  1XSB A;  3SON A;  1QVJ A;  3I7V A;  1PUQ A;  4C9X A;  3F6A A;  3Q1P A;  2A8P A;  3A6V A;  4NFX A;  1Q33 A;  3J7Y e;  3A6T A;  5FSM A;  2RRK A;  3FSP A;  4KYX A;  5GHM A;  2J8Q A;  2GT2 A;  3SMD A;  3ZR1 A;  3Q2S A;  2JVB A;  5BON A;  2G74 A;  2YVN A;  5HZX A;  2VNQ A;  3GZ8 A;  1GA7 A;  3DUP A;  3H95 A;  2A8S A;  2DUK A;  4YPH A;  1V8V A;  3A6S A;  3MDI A;  4JZS A;  1KTG A;  1V8S A;  2A8T A;  3EF5 A;  5ANU A;  1R67 A;  4NFW A;  3G0Q A;  2YVM A;  3MGM A;  5FSK A;  1NFZ A;  3P5T A;  1XSC A;  2QJO A;  3HHJ A;  1U20 A;  2PQV A;  4V14 A;  4KG4 A;  3X0Q A;  2A8R A;  1OW2 A;  1K26 A;  1K2E A;  1V8M A;  1X84 A;  5GHJ A;  1KHZ A;  3X0S A;  5GHQ A;  3X0I A;  2O5F A;  2G73 A;  1V8N A;  3RH7 A;  3BM4 A;  4YOQ A;  1SJY A;  2W4E A;  2DSD A;  2DSB A;  4S2V A;  4N1T A;  1VRL A;  1VC8 A;  1VIU A;  1XSA A;  1MUT A;  2R5W A;  3OGA A;  4MPO A;  3HYQ A;  5I8U A;  5C8L A;  4C9W A;  2O5W A;  3O69 A;  3BAP A;  4JZV A;  4DYW A;  2XSQ A;  1V8R A;  3ZR0 A;  5FSO A;  1G9Q A;  2DHO A;  3GWY A;  5ANT A;  1SOI A;  5BS6 A;  4S2X A;  1PPW A;  1NQY A;  4YPR A;  2B0V A;  2QKM B;  2YVO A;  2A8Q A;  3E57 A;  3EEU A;  4ICK A;  4KG3 A;  5GHN A;  3GRN A;  4N1U A;  2FVV A;  5FSL A;  3BHO A;  5ANW A;  1X83 A;  3O8S A;  1MQW A;  5C7Q A;  3X0P A;  3FK9 A;  5DD4 A;  3I9X A;  5GHO A;  3KVH A;  1NQZ A;  1V8U A;  3X0N A;  1PVF A;  3ACA A;  5ISY A;  1V8L A;  1VIQ A;  2PNY A;  3L85 A;  4IJX A;  3F13 A;  3GG6 A;  3O61 A;  1HZT A;  1PPV A;  5CFJ A;  3X0M A;  1VC9 A;  5FSN A;  1JKN A;  2I6K A;  1KT9 A;  3X0L A;  5ANV A;  1TUM A;  2O1C A;  5GHI A;  5DPK A;  2DSC A;  3GZ5 A;  1PUS A;  3FJY A;  4S2W A;  3MDG A;  5C7T A;  1I9A A;  1MK1 A;  3Q4I A;  4JZT A;  4KTB A;  3ID9 A;  3X0J A;  1MQE A;  3CNG A;  3FFU A;  1IRY A;  1VHZ A;  1RRQ A;  1V8I A;  2B06 A;  1X51 A; 
#chains in the Genus database with same CATH topology
 4ZG0 A;  2GT4 A;  2ICJ A;  2KDV A;  3DKU A;  5ANS A;  2KDW A;  3Q91 A;  3O6Z A;  3QSJ A;  3Q2T A;  1RYA A;  4S2Y A;  3EXQ A;  2Q9P A;  2I8T A;  4JZU A;  1RRS A;  1F3Y A;  2YVP A;  3A6U A;  1Q54 A;  3Q93 A;  1Q27 A;  2AZW A;  5CFI A;  1VCD A;  1SZ3 A;  2ICK A;  3N77 A;  1MR2 A;  1VK6 A;  3R03 A;  2YYH A;  3O52 A;  1PUN A;  3WHW A;  1HX3 A;  3COU A;  5IW4 A;  3N9U A;  4ILQ A;  1G0S A;  1NFS A;  3AC9 A;  2CL3 A;  4HFQ A;  5DEQ A;  5DDG A;  1MP2 A;  1VHG A;  5LPG A;  2QJT A;  3GZ6 A;  3EES A;  5FSI A;  3SHD A;  2FKB A;  3I7U A;  3X0R A;  4HVY A;  1V8W A;  1SU2 A;  5GHP A;  2FML A;  2B2K A;  3X0K A;  2GB5 A;  3U53 A;  2CZR A;  4J7G A;  2I8U A;  1JRK A;  2VNP A;  3X0O A;  3MCF A;  1V8Y A;  2A6T A;  4K6E A;  1V8T A;  5IW5 A;  3P6Y A;  3FCM A;  1PPX A;  1XSB A;  3SON A;  1QVJ A;  3I7V A;  1PUQ A;  4C9X A;  3F6A A;  3Q1P A;  2A8P A;  3A6V A;  4NFX A;  1Q33 A;  3J7Y e;  3A6T A;  5FSM A;  2RRK A;  3FSP A;  4KYX A;  5GHM A;  2J8Q A;  2GT2 A;  3SMD A;  3ZR1 A;  3Q2S A;  2JVB A;  5BON A;  2G74 A;  2YVN A;  5HZX A;  2VNQ A;  3GZ8 A;  1GA7 A;  3DUP A;  3H95 A;  2A8S A;  2DUK A;  4YPH A;  1V8V A;  3A6S A;  3MDI A;  4JZS A;  1KTG A;  1V8S A;  2A8T A;  3EF5 A;  5ANU A;  1R67 A;  4NFW A;  3G0Q A;  2YVM A;  3MGM A;  5FSK A;  1NFZ A;  4J7H A;  3P5T A;  1XSC A;  2QJO A;  3HHJ A;  1U20 A;  2PQV A;  4V14 A;  4KG4 A;  3X0Q A;  2A8R A;  1OW2 A;  1K26 A;  1K2E A;  1V8M A;  1X84 A;  5GHJ A;  1KHZ A;  3X0S A;  5GHQ A;  3X0I A;  2O5F A;  2G73 A;  1V8N A;  3RH7 A;  3BM4 A;  4YOQ A;  1SJY A;  2W4E A;  2DSD A;  2DSB A;  4S2V A;  4N1T A;  1VRL A;  1VC8 A;  1VIU A;  1XSA A;  1MUT A;  2R5W A;  3OGA A;  4MPO A;  3HYQ A;  5I8U A;  5C8L A;  4C9W A;  2O5W A;  3O69 A;  3BAP A;  4JZV A;  4DYW A;  2XSQ A;  1V8R A;  3ZR0 A;  5FSO A;  1G9Q A;  2DHO A;  3GWY A;  5ANT A;  1SOI A;  5BS6 A;  4S2X A;  1PPW A;  1NQY A;  4YPR A;  2B0V A;  2QKM B;  2YVO A;  2A8Q A;  3E57 A;  3EEU A;  4ICK A;  4KG3 A;  5GHN A;  3GRN A;  4N1U A;  2FVV A;  5FSL A;  3BHO A;  5ANW A;  1X83 A;  3O8S A;  1MQW A;  5C7Q A;  3X0P A;  3FK9 A;  5DD4 A;  3I9X A;  5GHO A;  3KVH A;  1NQZ A;  1V8U A;  3X0N A;  1PVF A;  3ACA A;  5ISY A;  1V8L A;  1VIQ A;  2PNY A;  3L85 A;  4IJX A;  3F13 A;  3GG6 A;  3O61 A;  1HZT A;  1PPV A;  5CFJ A;  3X0M A;  1VC9 A;  5FSN A;  1JKN A;  2I6K A;  1KT9 A;  3X0L A;  5ANV A;  1TUM A;  2O1C A;  5GHI A;  5DPK A;  2DSC A;  3GZ5 A;  1PUS A;  3FJY A;  4S2W A;  3MDG A;  5C7T A;  1I9A A;  1MK1 A;  3Q4I A;  4JZT A;  4KTB A;  3ID9 A;  3X0J A;  1MQE A;  3CNG A;  3FFU A;  1IRY A;  1VHZ A;  1RRQ A;  1V8I A;  2B06 A;  1X51 A; 
#chains in the Genus database with same CATH homology
 4ZG0 A;  2GT4 A;  2ICJ A;  2KDV A;  3DKU A;  5ANS A;  2KDW A;  3Q91 A;  3O6Z A;  3QSJ A;  3Q2T A;  1RYA A;  4S2Y A;  3EXQ A;  2Q9P A;  2I8T A;  4JZU A;  1RRS A;  1F3Y A;  2YVP A;  3A6U A;  1Q54 A;  3Q93 A;  1Q27 A;  2AZW A;  5CFI A;  1VCD A;  1SZ3 A;  2ICK A;  3N77 A;  1MR2 A;  1VK6 A;  3R03 A;  2YYH A;  3O52 A;  1PUN A;  3WHW A;  1HX3 A;  3COU A;  5IW4 A;  3N9U A;  4ILQ A;  1G0S A;  1NFS A;  3AC9 A;  2CL3 A;  4HFQ A;  5DEQ A;  5DDG A;  1MP2 A;  1VHG A;  5LPG A;  2QJT A;  3GZ6 A;  3EES A;  5FSI A;  3SHD A;  2FKB A;  3I7U A;  3X0R A;  4HVY A;  1V8W A;  1SU2 A;  5GHP A;  2FML A;  2B2K A;  3X0K A;  2GB5 A;  3U53 A;  2CZR A;  4J7G A;  2I8U A;  1JRK A;  2VNP A;  3X0O A;  3MCF A;  1V8Y A;  2A6T A;  4K6E A;  1V8T A;  5IW5 A;  3P6Y A;  3FCM A;  1PPX A;  1XSB A;  3SON A;  1QVJ A;  3I7V A;  1PUQ A;  4C9X A;  3F6A A;  3Q1P A;  2A8P A;  3A6V A;  4NFX A;  1Q33 A;  3J7Y e;  3A6T A;  5FSM A;  2RRK A;  3FSP A;  4KYX A;  5GHM A;  2J8Q A;  2GT2 A;  3SMD A;  3ZR1 A;  3Q2S A;  2JVB A;  5BON A;  2G74 A;  2YVN A;  5HZX A;  2VNQ A;  3GZ8 A;  1GA7 A;  3DUP A;  3H95 A;  2A8S A;  2DUK A;  4YPH A;  1V8V A;  3A6S A;  3MDI A;  4JZS A;  1KTG A;  1V8S A;  2A8T A;  3EF5 A;  5ANU A;  1R67 A;  4NFW A;  3G0Q A;  2YVM A;  3MGM A;  5FSK A;  1NFZ A;  4J7H A;  3P5T A;  1XSC A;  2QJO A;  3HHJ A;  1U20 A;  2PQV A;  4V14 A;  4KG4 A;  3X0Q A;  2A8R A;  1OW2 A;  1K26 A;  1K2E A;  1V8M A;  1X84 A;  5GHJ A;  1KHZ A;  3X0S A;  5GHQ A;  3X0I A;  2O5F A;  2G73 A;  1V8N A;  3RH7 A;  3BM4 A;  4YOQ A;  1SJY A;  2W4E A;  2DSD A;  2DSB A;  4S2V A;  4N1T A;  1VRL A;  1VC8 A;  1VIU A;  1XSA A;  1MUT A;  2R5W A;  3OGA A;  4MPO A;  3HYQ A;  5I8U A;  5C8L A;  4C9W A;  2O5W A;  3O69 A;  3BAP A;  4JZV A;  4DYW A;  2XSQ A;  1V8R A;  3ZR0 A;  5FSO A;  1G9Q A;  2DHO A;  3GWY A;  5ANT A;  1SOI A;  5BS6 A;  4S2X A;  1PPW A;  1NQY A;  4YPR A;  2B0V A;  2QKM B;  2YVO A;  2A8Q A;  3E57 A;  3EEU A;  4ICK A;  4KG3 A;  5GHN A;  3GRN A;  4N1U A;  2FVV A;  5FSL A;  3BHO A;  5ANW A;  1X83 A;  3O8S A;  1MQW A;  5C7Q A;  3X0P A;  3FK9 A;  5DD4 A;  3I9X A;  5GHO A;  3KVH A;  1NQZ A;  1V8U A;  3X0N A;  1PVF A;  3ACA A;  5ISY A;  1V8L A;  1VIQ A;  2PNY A;  3L85 A;  4IJX A;  3F13 A;  3GG6 A;  3O61 A;  1HZT A;  1PPV A;  5CFJ A;  3X0M A;  1VC9 A;  5FSN A;  1JKN A;  2I6K A;  1KT9 A;  3X0L A;  5ANV A;  1TUM A;  2O1C A;  5GHI A;  5DPK A;  2DSC A;  3GZ5 A;  1PUS A;  3FJY A;  4S2W A;  3MDG A;  5C7T A;  1I9A A;  1MK1 A;  3Q4I A;  4JZT A;  4KTB A;  3ID9 A;  3X0J A;  1MQE A;  3CNG A;  3FFU A;  1IRY A;  1VHZ A;  1RRQ A;  1V8I A;  2B06 A;  1X51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...