2DI0A

Solution structure of the cue domain in the human activating signal cointegrator 1 complex subunit 2 (ascc2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
GSSGSSGMCGVELDSLISQVKDLLPDLGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRNLDREMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activating signal cointegrator 1 complex subunit 2
publication title Solution Structure of the CUE Domain in the Human Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2di0A01
2JNHA 2EKFA 2CWBA 1Q02A 2L4FA 2JY6B 1V92A 2OOAA 4HEOA 1Y8GA 4R71A 4F1IA 2WZJA 1BVSA 3E46A 2KNAA 1AIPC 1KYIA 1OKSA 1UFZA 2L4EA 2B3TA 2ZTDA 2KHHA 1OTRA 2R0IA 4GEWA 1XB2B 1R4GA 1HT1E 3GLGE 3K9PA 3FRIA 2JY7A 3LCUA 3T6PA 1XXHE 1WHCA 1WGLA 1TTEA 1JR3E 3LCVB 2G3QA 2MROB 1PGYA 2LBCA 5DFLA 2ZTCA 1GO5A 1E94E 2HWJA 1VQ1A 2DZLA 2JP7A 3GLIE 2BWEA 2EKKA 5JI2E 4F2LA 2OO9A 2RRUA 2CP8A 1OAIA 1QZEA 3E21A 1A5TA 1NV8A 1OQYA 2QNJA 1F4IA 2K0BX 1G41A 2DNAA 2DENA 1DO0A 4WP2A 1WGNA 1T6OA 2JUJA 2LVNC 2JZ1A 3GLHE 1HT2E 2O25A 1DV0A 2K9DA 1HJPA 3FRHA 2H5XA 1VDLA 1T43A 1G3IA 3GLFE 1ZV1A 1WR1B 2DI0A 2MJ5B 1G4AE 2JY8A 1SG9A 2QSFX 1IFYA 1IM2A 3H4JA 3IHPA 2DAMA 1ZMWA 3B89A 2DHYA 4G3OA 1WJ7A 2KNZA 1IXSA 2LTUA 3F92A 2LVAA 4UN2B 2QHOB 1WIVA 1VEKA 1VEJA 1NV9A 1MN3A 1HQYE 1ZMVA 2JY5A 3IECA 2LVOC 2HAKA 3FE3A 3BBZA 1YLAA 2LVPC 2BWBA 3MMPA 4DBGB 2JZ0A 1C7YA 3K9OA 2OOBA 2L2DA 1VG5A 2DKLA 2LVQD 2EJSA 1EFUB 1DO2A 1ZMUA 1TR8A 2DAEA 1CUKA 2DAIA 2DAGA 1VEGA 2MGWA 1P3QQ 2MR9A 2DAKA 2KNVA 4Q7JA
chains in the Genus database with same CATH superfamily
2LNHC 4LF4M 2VIIA 2CWBA 3U61B 4M0WA 4NSOB 3GPUA 2L4FA 1L1ZA 1J7KA 4LJ6A 1Z6TA 3GRUA 4KLNA 1E9SA 5EP2A 1XMQM 5GKNA 1XXHB 1L2BA 3J7BA 4ANRA 4LF6M 2ERCA 2G8LA 3AOGA 1XNQM 4MM3B 3AJIB 3E46A 2KNAA 1KYIA 3ILKA 2DHRA 1WXQA 4LJ5A 4NC6A 1XNRM 2ZTDA 4GIPA 1TF0B 2R0IA 4AG6A 3SAVA 2DZNB 1SXJC 3TPZA 4X65M 1UM8A 1HT1E 3AOEC 3K9PA 4XBOA 3GLGE 1NNJA 2VQEM 4JI4M 1SXJD 4IBFA 3T6PA 1XXHE 1IY1A 2XH9A 1OFIA 3PXGA 1IN7A 1QAOA 1TTEA 3CTWB 3DFZA 4QNRA 1DGHA 3T38A 4MGZE 3VDPA 3K92A 5EXXA 2MROB 5EXPA 3JR4A 3T15A 2KXEA 3GLHA 3B7NA 3H4MA 1E94E 2YQZA 4Z8XA 2CUZA 4DUYM 1IQPA 4G6ZA 2C96A 2JP7A 4AW4A 3GLIE 2BWEA 3B7QA 4II7A 2EKKA 4BB9A 4LRTA 1QZEA 4JI1M 4B7FA 4DV7M 5ITTA 1A5TA 2F5SA 1F4IA 1NO1A 1QZMA 4CGYB 1IY2A 2K0BX 3BXWA 3UGJA 4DR1M 1PJJA 1K3WA 4G4RA 3U6OA 3SARA 2DENA 2FS1A 2QP9X 1EIJA 2YNMD 1WGNA 2YFQA 5ITUA 3M7GA 2Y0QA 2R4EA 3OTOM 3R8FA 2F5PA 1NHGC 1NJFA 2HL7A 4D81A 4JI2M 3SYKA 1G3IA 2NQ8C 4Z6YA 1ZV1A 4HL4A 2DI0A 3HGIA 3KDSE 3PNVA 5FTMA 7CATA 5FTNA 1DGHB 3FYDA 4Y28F 1SG9A 1V34A 1IFYA 4DR2M 5LMNM 4IBKA 4AKHA 1G59A 3GRYA 3VDUA 5ITRA 4AG5A 3ZH9B 2D7GA 1PJIA 2QZ4A 3C3DA 3B89A 4B7HA 1LV7A 2Y21A 2BJWA 4I5SA 3UMMA 3IG5A 4IBBA 4LG2A 3RFWA 1WIVA 4M9XA 4JI6M 1VEJA 4LF7M 4EIWA 1R7RA 2ZAOA 4IBGA 5H37D 1NV9A 4IJEA 4QNMA 2FOIC 4DR5M 3T1HM 2Z4SA 4I81A 1LTMA 4A3VB 1HR0M 3FE3A 1NY5A 2QCUA 2JXNA 1JR3A 4LF8M 1QAMA 4B3MM 2FNAA 3MMPA 4DBGB 1IBMM 1C7YA 1IN5A 3K9OA 3RGSA 3FUXA 2CHVA 3J80S 5F3WA 2R44A 2DKLA 4CISA 3ZCBB 3Q8GA 3VK8A 4LZJA 4D80A 4IJFA 2F5QA 4LJ7A 1TR8A 2RGHA 3SC3A 1CUKA 1R2YA 2QBYA 2UXCM 1FNNA 2APLA 3GQ5A 1GABA 2FH0A 2MR9A 8CATA 4X62M 3GLGA 3PFIA 1N36M 4QOZC 4GKJM 3QYBA 3HX3A 2EKFA 3SBJA 1MX0A 2Q2EB 1TH3A 2JY6B 4LY6A 2LXEA 1V92A 1QUSA 4PCZA 1GJSA 4R71A 3C58A 4GH9A 2ZANA 3HU1A 3LQQA 5BPVA 4MGIE 1E32A 4RKUF 3GLIA 4DV6M 1JR3D 3KOWE 4CHTB 1OTRA 3RE8A 4OX9M 1XB2B 4M9ZA 4BLCA 2ZBKB 2XSZA 5JI3E 3HZJA 4W5WA 4QOSA 4FVMA 4LFAM 5KPZA 4AZFA 1Z5BA 1QAQA 4I8OA 1T3TA 2QBYB 3QAUA 1JR3E 2G3QA 5C1BA 1PGYA 4DV3M 3GPYA 3SMPA 5ITYA 3GLGB 1GO5A 1IN8A 4NRWA 2JWSA 2WSEF 2F5OA 3C3EA 2R62A 3HHYA 4L15A 2I7PA 1W5SA 2Y0TA 4G4OA 1XHBA 2C5RA 4LJ4A 1R2ZA 4FWGA 4M9SA 4KO8A 3GLIB 2CEAA 1OFHA 2GQFA 3SATA 4GKKM 5KQ8A 4K0KM 2VF8A 4NXNM 5FTLA 4KHPM 3FUUA 3HY5A 2R45A 4QHTA 2E5LM 4L8RC 1OIZA 2H5XA 2KRKA 2N35A 2XSZD 3L26A 3T1YM 3KOYE 4LGYA 1K82A 3R9XB 4B7GA 1WR1B 3TWMA 3W67A 2DVWB 2QQ8A 2RGOA 2BNKA 1G4AE 2JY8A 2V6ZM 3AFHA 4IBIA 3HJQA 4YHHM 3W0FA 2EUCA 2XZUA 3HWSA 2DAMA 3VFDA 2DWMA 3GRVA 4MGHA 4G3OA 1IBKM 2KNZA 3GPXA 1IXSA 2CFOA 3F92A 3I4VA 1L2CA 2L7HA 4NSRA 1FJGM 4PDGA 1NHWC 2C9CA 1VEKA 3K1JA 4P16A 5KQDA 1TH2A 2EA0A 2Y20A 1MN3A 2GNOA 3IECA 1J5EM 4RNAA 3MK6A 4KODA 2LVOC 3M6AA 4PT5A 3UZUA 2W82A 2KEBA 4YY3M 2Z8YM 1H6UA 1NJGA 1NVMA 2J7OA 2VQFM 1YUBA 2RKOA 2WSFF 2CRUA 5DNYA 1DGGA 4DV4M 4JI5M 4LZZA 2BWBA 2UUCM 3HU3A 1C1KA 3PNYA 2J5YA 2X4AA 2OOBA 3KSJA 3SMSA 3HJ8A 1N34M 2L2DA 4CJ6A 1VG5A 3IG8A 3SAUA 4GHLA 4PD2A 1NY6A 1Q3CA 3W68A 3KSXA 1EFUB 1MJGM 4NL4H 5EQTA 5EXSA 3TL4X 1ZMUA 2QENA 1PRBA 4DV2M 4AKGA 2ZAMA 3FTDA 1VEGA 1GL6A 1K3XA 1IXZA 1IXSB 1IN4A 1P3QQ 4RF1A 2DWNA 2UUAM 1ORYB 3U6PA 1D2NA 2R6FA 2DAKA 3U6LA 2YR0A 3LVVA 2Z4RA 3DOAA 4IBEA 4NRVA 4NXMM 3VLFB 3GRRA 4LFCM 5KO3A 2C99A 2OOAA 3GLFA 4IBJA 3FKEA 4G4NA 4F1IA 2XGNA 1J09A 2P5TA 3KS4A 1BVSA 1L1TA 2MH8A 1AIPC 5E26A 1OKSA 4Q7JA 5FTKA 3L25A 2XFTA 1KFVA 2B3TA 3LMMA 3KS8A 3RGPA 2DZOB 4JI0M 3B74A 1R4GA 4FCVA 3VK7A 3I4YA 4OVZA 2KZSA 5IWAM 4DR3M 3L2AA 1QANA 1GVNA 1OIPA 2JY7A 3A45A 4NOOB 4HLQA 3EIHA 4JV5M 3AV0A 5LMUM 2CV0A 3LCVB 3V76A 5L8RF 3L28A 5FLXS 2G5GX 3NBXX 3LVWA 2L09A 4GC5A 3U6SA 3DA1A 5E6JA 4QHSA 2UUBM 2UXDM 1DGFA 5ITQA 3M0EA 2DZLA 3UK6A 5A2QS 3WHKA 5JI2E 1R6BX 1DGBA 2OO9A 4F2LA 3FTFA 4MH0E 5FSWA 3GLFB 1TGUA 3TE6A 4B3RM 2Z7JA 3B9PA 4KT0F 1G8PA 3VKHA 3SAWA 3HKPA 1YSYA 1GLNA 3B7ZA 1DO0A 4AKIA 4WP2A 3J27B 4L78A 3K8ZA 1TH4A 3J2PB 1MU5A 3KOXE 1HNWM 4JI7M 2OQ4A 1QQWA 1VDDA 2LVNC 2JZ1A 4JXJA 2V1CA 2Z3XA 1HT2E 4OVZB 2O25A 3NBIA 2K9DA 4JYAM 3ZC7B 1DV0A 4FWHA 1HJPA 3JR5A 1N32M 3KOZE 2CHGA 1T43A 4WURA 3GLFE 2MJ5B 3J7AS 3C9PA 2D7HA 3I51A 2C98A 3HHZA 2XEPA 4LJAA 1IM2A 3D8LA 4BBAA 2D7EA 3H4JA 3IHPA 1N78A 4I4LA 2R4JA 3AOEA 3J81S 4AQYM 1ZMWA 2DWLA 1L2DA 2M5ZA 1R5LA 1WJ7A 2CV1A 4FD2A 2LTUA 4UN2B 2LVAA 4REZA 1PJSA 3FUTA 2J7NA 3GPPA 5FTJA 1TDZA 1KSFX 1W5TA 2JA2A 2UU9M 2JY5A 3JAMS 2KRUA 4WW0A 4G4QA 2K6BA 2X8AA 4LF5M 2CE7A 2FE8A 2X49A 4RF0A 4IBCA 2HAKA 3KVWA 3TWKA 4L4UA 3HJSA 3CF6E 2O5RA 4GRIA 2DXIA 3TQSA 4DV0M 1Q3BA 4GMQA 1YLAA 2LVPC 3CGWA 2L6OA 1HQCA 3FUWA 1GJTA 3GQ4A 1HNXM 1RU3A 3AL0C 2JZ0A 3CF2A 3QWLA 1IY0A 3LQRA 2A5YB 3K2LA 4LJ9A 2LH0A 2LVQD 2EJSA 2R46A 4D82A 1S3SA 2HHHM 1SXJB 1Z59A 2I7NA 1I94M 1PJQA 2DAEA 1NSFA 2DAGA 2K47A 2M60A 2XFSA 4LJ8A 4FWDA 3GQ3A 2KNVA 2JNHA 3LW5F 1V33A 4LRSA 2LHGA 3UJNA 1Q02A 4L16A 3HHWA 2OPFA 4LCBA 5KPTA 4HEOA 4M0DA 1Y8GA 1SXJE 2DWZB 2HCBA 3SASA 4L6V6 4MGKE 3FD9A 2WZJA 4DV5M 2LHCA 4DR6M 3GO8A 1UFZA 2L4EA 5C18A 5ITXE 1IN6A 2KHHA 3ZQJA 1QUTA 3MJ5A 4GEWA 4B3SM 1OAOC 1EE8A 4JN6A 3U5ZA 3KFUG 3FRIA 2H1RA 3TWLA 3MHVC 3LCUA 3QYEA 1I4WA 1WHCA 4JI8M 2CHQA 2ZM6M 1WGLA 1QYRA 3E9SA 4LFBM 2LWXA 3U60A 1QVRA 2WSCF 2R18A 5BR8M 2XZFA 2LBCA 4LF9M 4DR7M 5DFLA 1GL7A 2ZTCA 4IIWA 2HWJA 1PM5A 3KW6A 3AKZA 1VQ1A 4PDIA 3GLHB 5EP3A 5IT9S 2FFJA 1AUAA 3SHFA 1XC8A 2RRUA 2CP8A 1OAIA 4R3DA 1D0MA 3HU2A 3E21A 2O01F 3W0LB 3Q8XA 1NV8A 2F4VM 1OQYA 2QNJA 5IREB 4X66M 1G41A 2V1UA 1GKIA 2XLJA 2DNAA 3FUVA 3I04M 3FTEA 3FTCA 5DYGA 3D8BA 4S12A 3GP1A 1T6OA 4AI6A 2C9OA 4OU7A 1D0KA 2JUJA 1X37A 3PVSA 3GLHE 5DYIA 4B08A 1G71A 3U6QA 2QPAA 1N75A 2KW0A 3U5ZB 5KPRA 3FRHA 1VDLA 1IXRC 3FYCA 4XGIA 4P17A 3EIEA 4XK8F 1E9RA 4MB7A 3U60B 2QSFX 2HKJA 4MGYE 1ZQ9A 3WHLA 3SYLA 3BOSA 4GHAA 2AHMA 2CV2A 3HHXA 3KP1E 1TDHA 1N33M 2EO2A 1NNUC 2DHYA 4OW0A 3CF0A 3U6MA 3VKGA 2QHOB 4IBDA 4FCWA 5EP4A 1PJTA 4FCTA 3U6EA 5IZ7D 3L27A 3L29A 4FW9A 1ZMVA 1Z5AA 3I01M 4ZPXA 1JB0F 4DV1M 3U61A 2F5NA 2KDLA 1XXHA 3A42A 5EP1A 4CIZA 1XMOM 1XWIA 1OJLA 1D0LA 4R7GA 4GITA 4JI3M 4DUZM 3BBZA 1ZAEA 3SFZA 3KXEC 1HNZM 3E4RA 1N77A 3SHGB 2KA6B 3U6DA 4TUWA 1JQJC 3THGA 1Q39A 4ITQA 1L8QA 3A98B 4B3TM 1SXJA 3DZDA 4X64M 3KP0E 2VF7A 4GC9A 5EJCA 2L7IA 3U6CA 2KZUA 3NWLA 1DO2A 5ITXA 2XF3A 5EXTA 1QDTA 1IBLM 2DAIA 2VDBB 1YE9A 4LGMA 2R65A 2MGWA 3A46A 4DR4M 1QDRA 1Z5CA 1HQYE 2UXBM 2BJVA
chains in the Genus database with same CATH topology
2JNHA 2EKFA 2CWBA 1Q02A 2L4FA 2JY6B 1V92A 2OOAA 4HEOA 1Y8GA 4R71A 4F1IA 2WZJA 1BVSA 3E46A 2KNAA 1AIPC 1KYIA 1OKSA 1UFZA 2L4EA 2B3TA 2ZTDA 2KHHA 1OTRA 2R0IA 4GEWA 1XB2B 1R4GA 1HT1E 3GLGE 3K9PA 3FRIA 2JY7A 3LCUA 3T6PA 1XXHE 1WHCA 1WGLA 1TTEA 1JR3E 3LCVB 2G3QA 2MROB 1PGYA 2LBCA 5DFLA 2ZTCA 1GO5A 1E94E 2HWJA 1VQ1A 2DZLA 2JP7A 3GLIE 2BWEA 2EKKA 5JI2E 4F2LA 2OO9A 2RRUA 2CP8A 1OAIA 1QZEA 3E21A 1A5TA 1NV8A 1OQYA 2QNJA 1F4IA 2K0BX 1G41A 2DNAA 2DENA 1DO0A 4WP2A 1WGNA 1T6OA 2JUJA 2LVNC 2JZ1A 3GLHE 1HT2E 2O25A 1DV0A 2K9DA 1HJPA 3FRHA 2H5XA 1VDLA 1T43A 1G3IA 3GLFE 1ZV1A 1WR1B 2DI0A 2MJ5B 1G4AE 2JY8A 1SG9A 2QSFX 1IFYA 1IM2A 3H4JA 3IHPA 2DAMA 1ZMWA 3B89A 2DHYA 4G3OA 1WJ7A 2KNZA 1IXSA 2LTUA 3F92A 2LVAA 4UN2B 2QHOB 1WIVA 1VEKA 1VEJA 1NV9A 1MN3A 1HQYE 1ZMVA 2JY5A 3IECA 2LVOC 2HAKA 3FE3A 3BBZA 1YLAA 2LVPC 2BWBA 3MMPA 4DBGB 2JZ0A 1C7YA 3K9OA 2OOBA 2L2DA 1VG5A 2DKLA 2LVQD 2EJSA 1EFUB 1DO2A 1ZMUA 1TR8A 2DAEA 1CUKA 2DAIA 2DAGA 1VEGA 2MGWA 1P3QQ 2MR9A 2DAKA 2KNVA 4Q7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNH A;  2EKF A;  2CWB A;  1Q02 A;  2L4F A;  2JY6 B;  1V92 A;  2OOA A;  4HEO A;  1Y8G A;  4R71 A;  4F1I A;  2WZJ A;  1BVS A;  3E46 A;  2KNA A;  1AIP C;  1KYI A;  1OKS A;  1UFZ A;  2L4E A;  2B3T A;  2ZTD A;  2KHH A;  1OTR A;  2R0I A;  4GEW A;  1XB2 B;  1R4G A;  1HT1 E;  3GLG E;  3K9P A;  3FRI A;  2JY7 A;  3LCU A;  3T6P A;  1XXH E;  1WHC A;  1WGL A;  1TTE A;  1JR3 E;  3LCV B;  2G3Q A;  2MRO B;  1PGY A;  2LBC A;  5DFL A;  2ZTC A;  1GO5 A;  1E94 E;  2HWJ A;  1VQ1 A;  2DZL A;  2JP7 A;  3GLI E;  2BWE A;  2EKK A;  5JI2 E;  4F2L A;  2OO9 A;  2RRU A;  2CP8 A;  1OAI A;  1QZE A;  3E21 A;  1A5T A;  1NV8 A;  1OQY A;  2QNJ A;  1F4I A;  2K0B X;  1G41 A;  2DNA A;  2DEN A;  1DO0 A;  4WP2 A;  1WGN A;  1T6O A;  2JUJ A;  2LVN C;  2JZ1 A;  3GLH E;  1HT2 E;  2O25 A;  1DV0 A;  2K9D A;  1HJP A;  3FRH A;  2H5X A;  1VDL A;  1T43 A;  1G3I A;  3GLF E;  1ZV1 A;  1WR1 B;  2DI0 A;  2MJ5 B;  1G4A E;  2JY8 A;  1SG9 A;  2QSF X;  1IFY A;  1IM2 A;  3H4J A;  3IHP A;  2DAM A;  1ZMW A;  3B89 A;  2DHY A;  4G3O A;  1WJ7 A;  2KNZ A;  1IXS A;  2LTU A;  3F92 A;  2LVA A;  4UN2 B;  2QHO B;  1WIV A;  1VEK A;  1VEJ A;  1NV9 A;  1MN3 A;  1HQY E;  1ZMV A;  2JY5 A;  3IEC A;  2LVO C;  2HAK A;  3FE3 A;  3BBZ A;  1YLA A;  2LVP C;  2BWB A;  3MMP A;  4DBG B;  2JZ0 A;  1C7Y A;  3K9O A;  2OOB A;  2L2D A;  1VG5 A;  2DKL A;  2LVQ D;  2EJS A;  1EFU B;  1DO2 A;  1ZMU A;  1TR8 A;  2DAE A;  1CUK A;  2DAI A;  2DAG A;  1VEG A;  2MGW A;  1P3Q Q;  2MR9 A;  2DAK A;  2KNV A;  4Q7J A; 
#chains in the Genus database with same CATH topology
 2LNH C;  4LF4 M;  2VII A;  2CWB A;  3U61 B;  4M0W A;  4NSO B;  3GPU A;  2L4F A;  1L1Z A;  1J7K A;  4LJ6 A;  1Z6T A;  3GRU A;  4KLN A;  1E9S A;  5EP2 A;  1XMQ M;  5GKN A;  1XXH B;  1L2B A;  3J7B A;  4ANR A;  4LF6 M;  2ERC A;  2G8L A;  3AOG A;  1XNQ M;  4MM3 B;  3AJI B;  3E46 A;  2KNA A;  1KYI A;  3ILK A;  2DHR A;  1WXQ A;  4LJ5 A;  4NC6 A;  1XNR M;  2ZTD A;  4GIP A;  1TF0 B;  2R0I A;  4AG6 A;  3SAV A;  2DZN B;  1SXJ C;  3TPZ A;  4X65 M;  1UM8 A;  1HT1 E;  3AOE C;  3K9P A;  4XBO A;  3GLG E;  1NNJ A;  2VQE M;  4JI4 M;  1SXJ D;  4IBF A;  3T6P A;  1XXH E;  1IY1 A;  2XH9 A;  1OFI A;  3PXG A;  1IN7 A;  1QAO A;  1TTE A;  3CTW B;  3DFZ A;  4QNR A;  1DGH A;  3T38 A;  4MGZ E;  3VDP A;  3K92 A;  5EXX A;  2MRO B;  5EXP A;  3JR4 A;  3T15 A;  2KXE A;  3GLH A;  3B7N A;  3H4M A;  1E94 E;  2YQZ A;  4Z8X A;  2CUZ A;  4DUY M;  1IQP A;  4G6Z A;  2C96 A;  2JP7 A;  4AW4 A;  3GLI E;  2BWE A;  3B7Q A;  4II7 A;  2EKK A;  4BB9 A;  4LRT A;  1QZE A;  4JI1 M;  4B7F A;  4DV7 M;  5ITT A;  1A5T A;  2F5S A;  1F4I A;  1NO1 A;  1QZM A;  4CGY B;  1IY2 A;  2K0B X;  3BXW A;  3UGJ A;  4DR1 M;  1PJJ A;  1K3W A;  4G4R A;  3U6O A;  3SAR A;  2DEN A;  2FS1 A;  2QP9 X;  1EIJ A;  2YNM D;  1WGN A;  2YFQ A;  5ITU A;  3M7G A;  2Y0Q A;  2R4E A;  3OTO M;  3R8F A;  2F5P A;  1NHG C;  1NJF A;  2HL7 A;  4D81 A;  4JI2 M;  3SYK A;  1G3I A;  2NQ8 C;  4Z6Y A;  1ZV1 A;  4HL4 A;  2DI0 A;  3HGI A;  3KDS E;  3PNV A;  5FTM A;  7CAT A;  5FTN A;  1DGH B;  3FYD A;  4Y28 F;  1SG9 A;  1V34 A;  1IFY A;  4DR2 M;  5LMN M;  4IBK A;  4AKH A;  1G59 A;  3GRY A;  3VDU A;  5ITR A;  4AG5 A;  3ZH9 B;  2D7G A;  1PJI A;  2QZ4 A;  3C3D A;  3B89 A;  4B7H A;  1LV7 A;  2Y21 A;  2BJW A;  4I5S A;  3UMM A;  3IG5 A;  4IBB A;  4LG2 A;  3RFW A;  1WIV A;  4M9X A;  4JI6 M;  1VEJ A;  4LF7 M;  4EIW A;  1R7R A;  2ZAO A;  4IBG A;  5H37 D;  1NV9 A;  4IJE A;  4QNM A;  2FOI C;  4DR5 M;  3T1H M;  2Z4S A;  4I81 A;  1LTM A;  4A3V B;  1HR0 M;  3FE3 A;  1NY5 A;  2QCU A;  2JXN A;  1JR3 A;  4LF8 M;  1QAM A;  4B3M M;  2FNA A;  3MMP A;  4DBG B;  1IBM M;  1C7Y A;  1IN5 A;  3K9O A;  3RGS A;  3FUX A;  2CHV A;  3J80 S;  5F3W A;  2R44 A;  2DKL A;  4CIS A;  3ZCB B;  3Q8G A;  3VK8 A;  4LZJ A;  4D80 A;  4IJF A;  2F5Q A;  4LJ7 A;  1TR8 A;  2RGH A;  3SC3 A;  1CUK A;  1R2Y A;  2QBY A;  2UXC M;  1FNN A;  2APL A;  3GQ5 A;  1GAB A;  2FH0 A;  2MR9 A;  8CAT A;  4X62 M;  3GLG A;  3PFI A;  1N36 M;  4QOZ C;  4GKJ M;  3QYB A;  3HX3 A;  2EKF A;  3SBJ A;  1MX0 A;  2Q2E B;  1TH3 A;  2JY6 B;  4LY6 A;  2LXE A;  1V92 A;  1QUS A;  4PCZ A;  1GJS A;  4R71 A;  3C58 A;  4GH9 A;  2ZAN A;  3HU1 A;  3LQQ A;  5BPV A;  4MGI E;  1E32 A;  4RKU F;  3GLI A;  4DV6 M;  1JR3 D;  3KOW E;  4CHT B;  1OTR A;  3RE8 A;  4OX9 M;  1XB2 B;  4M9Z A;  4BLC A;  2ZBK B;  2XSZ A;  5JI3 E;  3HZJ A;  4W5W A;  4QOS A;  4FVM A;  4LFA M;  5KPZ A;  4AZF A;  1Z5B A;  1QAQ A;  4I8O A;  1T3T A;  2QBY B;  3QAU A;  1JR3 E;  2G3Q A;  5C1B A;  1PGY A;  4DV3 M;  3GPY A;  3SMP A;  5ITY A;  3GLG B;  1GO5 A;  1IN8 A;  4NRW A;  2JWS A;  2WSE F;  2F5O A;  3C3E A;  2R62 A;  3HHY A;  4L15 A;  2I7P A;  1W5S A;  2Y0T A;  4G4O A;  1XHB A;  2C5R A;  4LJ4 A;  1R2Z A;  4FWG A;  4M9S A;  4KO8 A;  3GLI B;  2CEA A;  1OFH A;  2GQF A;  3SAT A;  4GKK M;  5KQ8 A;  4K0K M;  2VF8 A;  4NXN M;  5FTL A;  4KHP M;  3FUU A;  3HY5 A;  2R45 A;  4QHT A;  2E5L M;  4L8R C;  1OIZ A;  2H5X A;  2KRK A;  2N35 A;  2XSZ D;  3L26 A;  3T1Y M;  3KOY E;  4LGY A;  1K82 A;  3R9X B;  4B7G A;  1WR1 B;  3TWM A;  3W67 A;  2DVW B;  2QQ8 A;  2RGO A;  2BNK A;  1G4A E;  2JY8 A;  2V6Z M;  3AFH A;  4IBI A;  3HJQ A;  4YHH M;  3W0F A;  2EUC A;  2XZU A;  3HWS A;  2DAM A;  3VFD A;  2DWM A;  3GRV A;  4MGH A;  4G3O A;  1IBK M;  2KNZ A;  3GPX A;  1IXS A;  2CFO A;  3F92 A;  3I4V A;  1L2C A;  2L7H A;  4NSR A;  1FJG M;  4PDG A;  1NHW C;  2C9C A;  1VEK A;  3K1J A;  4P16 A;  5KQD A;  1TH2 A;  2EA0 A;  2Y20 A;  1MN3 A;  2GNO A;  3IEC A;  1J5E M;  4RNA A;  3MK6 A;  4KOD A;  2LVO C;  3M6A A;  4PT5 A;  3UZU A;  2W82 A;  2KEB A;  4YY3 M;  2Z8Y M;  1H6U A;  1NJG A;  1NVM A;  2J7O A;  2VQF M;  1YUB A;  2RKO A;  2WSF F;  2CRU A;  5DNY A;  1DGG A;  4DV4 M;  4JI5 M;  4LZZ A;  2BWB A;  2UUC M;  3HU3 A;  1C1K A;  3PNY A;  2J5Y A;  2X4A A;  2OOB A;  3KSJ A;  3SMS A;  3HJ8 A;  1N34 M;  2L2D A;  4CJ6 A;  1VG5 A;  3IG8 A;  3SAU A;  4GHL A;  4PD2 A;  1NY6 A;  1Q3C A;  3W68 A;  3KSX A;  1EFU B;  1MJG M;  4NL4 H;  5EQT A;  5EXS A;  3TL4 X;  1ZMU A;  2QEN A;  1PRB A;  4DV2 M;  4AKG A;  2ZAM A;  3FTD A;  1VEG A;  1GL6 A;  1K3X A;  1IXZ A;  1IXS B;  1IN4 A;  1P3Q Q;  4RF1 A;  2DWN A;  2UUA M;  1ORY B;  3U6P A;  1D2N A;  2R6F A;  2DAK A;  3U6L A;  2YR0 A;  3LVV A;  2Z4R A;  3DOA A;  4IBE A;  4NRV A;  4NXM M;  3VLF B;  3GRR A;  4LFC M;  5KO3 A;  2C99 A;  2OOA A;  3GLF A;  4IBJ A;  3FKE A;  4G4N A;  4F1I A;  2XGN A;  1J09 A;  2P5T A;  3KS4 A;  1BVS A;  1L1T A;  2MH8 A;  1AIP C;  5E26 A;  1OKS A;  4Q7J A;  5FTK A;  3L25 A;  2XFT A;  1KFV A;  2B3T A;  3LMM A;  3KS8 A;  3RGP A;  2DZO B;  4JI0 M;  3B74 A;  1R4G A;  4FCV A;  3VK7 A;  3I4Y A;  4OVZ A;  2KZS A;  5IWA M;  4DR3 M;  3L2A A;  1QAN A;  1GVN A;  1OIP A;  2JY7 A;  3A45 A;  4NOO B;  4HLQ A;  3EIH A;  4JV5 M;  3AV0 A;  5LMU M;  2CV0 A;  3LCV B;  3V76 A;  5L8R F;  3L28 A;  5FLX S;  2G5G X;  3NBX X;  3LVW A;  2L09 A;  4GC5 A;  3U6S A;  3DA1 A;  5E6J A;  4QHS A;  2UUB M;  2UXD M;  1DGF A;  5ITQ A;  3M0E A;  2DZL A;  3UK6 A;  5A2Q S;  3WHK A;  5JI2 E;  1R6B X;  1DGB A;  2OO9 A;  4F2L A;  3FTF A;  4MH0 E;  5FSW A;  3GLF B;  1TGU A;  3TE6 A;  4B3R M;  2Z7J A;  3B9P A;  4KT0 F;  1G8P A;  3VKH A;  3SAW A;  3HKP A;  1YSY A;  1GLN A;  3B7Z A;  1DO0 A;  4AKI A;  4WP2 A;  3J27 B;  4L78 A;  3K8Z A;  1TH4 A;  3J2P B;  1MU5 A;  3KOX E;  1HNW M;  4JI7 M;  2OQ4 A;  1QQW A;  1VDD A;  2LVN C;  2JZ1 A;  4JXJ A;  2V1C A;  2Z3X A;  1HT2 E;  4OVZ B;  2O25 A;  3NBI A;  2K9D A;  4JYA M;  3ZC7 B;  1DV0 A;  4FWH A;  1HJP A;  3JR5 A;  1N32 M;  3KOZ E;  2CHG A;  1T43 A;  4WUR A;  3GLF E;  2MJ5 B;  3J7A S;  3C9P A;  2D7H A;  3I51 A;  2C98 A;  3HHZ A;  2XEP A;  4LJA A;  1IM2 A;  3D8L A;  4BBA A;  2D7E A;  3H4J A;  3IHP A;  1N78 A;  4I4L A;  2R4J A;  3AOE A;  3J81 S;  4AQY M;  1ZMW A;  2DWL A;  1L2D A;  2M5Z A;  1R5L A;  1WJ7 A;  2CV1 A;  4FD2 A;  2LTU A;  4UN2 B;  2LVA A;  4REZ A;  1PJS A;  3FUT A;  2J7N A;  3GPP A;  5FTJ A;  1TDZ A;  1KSF X;  1W5T A;  2JA2 A;  2UU9 M;  2JY5 A;  3JAM S;  2KRU A;  4WW0 A;  4G4Q A;  2K6B A;  2X8A A;  4LF5 M;  2CE7 A;  2FE8 A;  2X49 A;  4RF0 A;  4IBC A;  2HAK A;  3KVW A;  3TWK A;  4L4U A;  3HJS A;  3CF6 E;  2O5R A;  4GRI A;  2DXI A;  3TQS A;  4DV0 M;  1Q3B A;  4GMQ A;  1YLA A;  2LVP C;  3CGW A;  2L6O A;  1HQC A;  3FUW A;  1GJT A;  3GQ4 A;  1HNX M;  1RU3 A;  3AL0 C;  2JZ0 A;  3CF2 A;  3QWL A;  1IY0 A;  3LQR A;  2A5Y B;  3K2L A;  4LJ9 A;  2LH0 A;  2LVQ D;  2EJS A;  2R46 A;  4D82 A;  1S3S A;  2HHH M;  1SXJ B;  1Z59 A;  2I7N A;  1I94 M;  1PJQ A;  2DAE A;  1NSF A;  2DAG A;  2K47 A;  2M60 A;  2XFS A;  4LJ8 A;  4FWD A;  3GQ3 A;  2KNV A;  2JNH A;  3LW5 F;  1V33 A;  4LRS A;  2LHG A;  3UJN A;  1Q02 A;  4L16 A;  3HHW A;  2OPF A;  4LCB A;  5KPT A;  4HEO A;  4M0D A;  1Y8G A;  1SXJ E;  2DWZ B;  2HCB A;  3SAS A;  4L6V 6;  4MGK E;  3FD9 A;  2WZJ A;  4DV5 M;  2LHC A;  4DR6 M;  3GO8 A;  1UFZ A;  2L4E A;  5C18 A;  5ITX E;  1IN6 A;  2KHH A;  3ZQJ A;  1QUT A;  3MJ5 A;  4GEW A;  4B3S M;  1OAO C;  1EE8 A;  4JN6 A;  3U5Z A;  3KFU G;  3FRI A;  2H1R A;  3TWL A;  3MHV C;  3LCU A;  3QYE A;  1I4W A;  1WHC A;  4JI8 M;  2CHQ A;  2ZM6 M;  1WGL A;  1QYR A;  3E9S A;  4LFB M;  2LWX A;  3U60 A;  1QVR A;  2WSC F;  2R18 A;  5BR8 M;  2XZF A;  2LBC A;  4LF9 M;  4DR7 M;  5DFL A;  1GL7 A;  2ZTC A;  4IIW A;  2HWJ A;  1PM5 A;  3KW6 A;  3AKZ A;  1VQ1 A;  4PDI A;  3GLH B;  5EP3 A;  5IT9 S;  2FFJ A;  1AUA A;  3SHF A;  1XC8 A;  2RRU A;  2CP8 A;  1OAI A;  4R3D A;  1D0M A;  3HU2 A;  3E21 A;  2O01 F;  3W0L B;  3Q8X A;  1NV8 A;  2F4V M;  1OQY A;  2QNJ A;  5IRE B;  4X66 M;  1G41 A;  2V1U A;  1GKI A;  2XLJ A;  2DNA A;  3FUV A;  3I04 M;  3FTE A;  3FTC A;  5DYG A;  3D8B A;  4S12 A;  3GP1 A;  1T6O A;  4AI6 A;  2C9O A;  4OU7 A;  1D0K A;  2JUJ A;  1X37 A;  3PVS A;  3GLH E;  5DYI A;  4B08 A;  1G71 A;  3U6Q A;  2QPA A;  1N75 A;  2KW0 A;  3U5Z B;  5KPR A;  3FRH A;  1VDL A;  1IXR C;  3FYC A;  4XGI A;  4P17 A;  3EIE A;  4XK8 F;  1E9R A;  4MB7 A;  3U60 B;  2QSF X;  2HKJ A;  4MGY E;  1ZQ9 A;  3WHL A;  3SYL A;  3BOS A;  4GHA A;  2AHM A;  2CV2 A;  3HHX A;  3KP1 E;  1TDH A;  1N33 M;  2EO2 A;  1NNU C;  2DHY A;  4OW0 A;  3CF0 A;  3U6M A;  3VKG A;  2QHO B;  4IBD A;  4FCW A;  5EP4 A;  1PJT A;  4FCT A;  3U6E A;  5IZ7 D;  3L27 A;  3L29 A;  4FW9 A;  1ZMV A;  1Z5A A;  3I01 M;  4ZPX A;  1JB0 F;  4DV1 M;  3U61 A;  2F5N A;  2KDL A;  1XXH A;  3A42 A;  5EP1 A;  4CIZ A;  1XMO M;  1XWI A;  1OJL A;  1D0L A;  4R7G A;  4GIT A;  4JI3 M;  4DUZ M;  3BBZ A;  1ZAE A;  3SFZ A;  3KXE C;  1HNZ M;  3E4R A;  1N77 A;  3SHG B;  2KA6 B;  3U6D A;  4TUW A;  1JQJ C;  3THG A;  1Q39 A;  4ITQ A;  1L8Q A;  3A98 B;  4B3T M;  1SXJ A;  3DZD A;  4X64 M;  3KP0 E;  2VF7 A;  4GC9 A;  5EJC A;  2L7I A;  3U6C A;  2KZU A;  3NWL A;  1DO2 A;  5ITX A;  2XF3 A;  5EXT A;  1QDT A;  1IBL M;  2DAI A;  2VDB B;  1YE9 A;  4LGM A;  2R65 A;  2MGW A;  3A46 A;  4DR4 M;  1QDR A;  1Z5C A;  1HQY E;  2UXB M;  2BJV A; 
#chains in the Genus database with same CATH homology
 2JNH A;  2EKF A;  2CWB A;  1Q02 A;  2L4F A;  2JY6 B;  1V92 A;  2OOA A;  4HEO A;  1Y8G A;  4R71 A;  4F1I A;  2WZJ A;  1BVS A;  3E46 A;  2KNA A;  1AIP C;  1KYI A;  1OKS A;  1UFZ A;  2L4E A;  2B3T A;  2ZTD A;  2KHH A;  1OTR A;  2R0I A;  4GEW A;  1XB2 B;  1R4G A;  1HT1 E;  3GLG E;  3K9P A;  3FRI A;  2JY7 A;  3LCU A;  3T6P A;  1XXH E;  1WHC A;  1WGL A;  1TTE A;  1JR3 E;  3LCV B;  2G3Q A;  2MRO B;  1PGY A;  2LBC A;  5DFL A;  2ZTC A;  1GO5 A;  1E94 E;  2HWJ A;  1VQ1 A;  2DZL A;  2JP7 A;  3GLI E;  2BWE A;  2EKK A;  5JI2 E;  4F2L A;  2OO9 A;  2RRU A;  2CP8 A;  1OAI A;  1QZE A;  3E21 A;  1A5T A;  1NV8 A;  1OQY A;  2QNJ A;  1F4I A;  2K0B X;  1G41 A;  2DNA A;  2DEN A;  1DO0 A;  4WP2 A;  1WGN A;  1T6O A;  2JUJ A;  2LVN C;  2JZ1 A;  3GLH E;  1HT2 E;  2O25 A;  1DV0 A;  2K9D A;  1HJP A;  3FRH A;  2H5X A;  1VDL A;  1T43 A;  1G3I A;  3GLF E;  1ZV1 A;  1WR1 B;  2DI0 A;  2MJ5 B;  1G4A E;  2JY8 A;  1SG9 A;  2QSF X;  1IFY A;  1IM2 A;  3H4J A;  3IHP A;  2DAM A;  1ZMW A;  3B89 A;  2DHY A;  4G3O A;  1WJ7 A;  2KNZ A;  1IXS A;  2LTU A;  3F92 A;  2LVA A;  4UN2 B;  2QHO B;  1WIV A;  1VEK A;  1VEJ A;  1NV9 A;  1MN3 A;  1HQY E;  1ZMV A;  2JY5 A;  3IEC A;  2LVO C;  2HAK A;  3FE3 A;  3BBZ A;  1YLA A;  2LVP C;  2BWB A;  3MMP A;  4DBG B;  2JZ0 A;  1C7Y A;  3K9O A;  2OOB A;  2L2D A;  1VG5 A;  2DKL A;  2LVQ D;  2EJS A;  1EFU B;  1DO2 A;  1ZMU A;  1TR8 A;  2DAE A;  1CUK A;  2DAI A;  2DAG A;  1VEG A;  2MGW A;  1P3Q Q;  2MR9 A;  2DAK A;  2KNV A;  4Q7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...