2DI0A

Solution structure of the cue domain in the human activating signal cointegrator 1 complex subunit 2 (ascc2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
GSSGSSGMCGVELDSLISQVKDLLPDLGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRNLDREMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activating signal cointegrator 1 complex subunit 2
publication title Solution Structure of the CUE Domain in the Human Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2di0A01
1DO0A 2QSFX 1G41A 3IECA 2JY6B 1E94E 3B89A 1HJPA 2DAEA 2OOBA 4F1IA 2DZLA 2WZJA 4GEWA 1R4GA 1VQ1A 2MJ5B 2MGWA 2L2DA 1OAIA 1T43A 5JI2E 1TTEA 1VEJA 2MR9A 1ZMVA 3K9OA 3GLIE 3GLFE 4HEOA 5DFLA 1XXHE 1P3QQ 1CUKA 1QZEA 2ZTCA 1OKSA 2JY7A 1C7YA 1G4AE 1XB2B 2O25A 4R71A 3FRHA 1KYIA 1ZV1A 4G3OA 2JY8A 1VG5A 2KNAA 1JR3E 2EKFA 1A5TA 1DO2A 2JUJA 3BBZA 1PGYA 2DAGA 3GLGE 2MROB 1NV9A 1OQYA 1HT2E 2CP8A 2DI0A 2JP7A 2LTUA 2CWBA 1WGLA 4UN2B 2LVOC 2LVQD 1DV0A 2ZTDA 3LCUA 2JY5A 3T6PA 1HQYE 2HWJA 1OTRA 2R0IA 1IM2A 2B3TA 3E21A 1TR8A 3GLHE 1WHCA 2DENA 2KNVA 1V92A 3FRIA 3K9PA 3H4JA 1SG9A 2EJSA 2KHHA 1IXSA 1WR1B 2LVAA 1GO5A 2LBCA 2K9DA 1WJ7A 1F4IA 2BWBA 1Q02A 1VEKA 2KNZA 1VDLA 1AIPC 2H5XA 1WGNA 1MN3A 2EKKA 3F92A 2G3QA 2DAMA 2DHYA 2QHOB 2OOAA 4Q7JA 3LCVB 2JZ0A 2OO9A 1HT1E 2DAKA 2DAIA 1T6OA 4F2LA 2DKLA 1BVSA 4DBGB 2HAKA 1Y8GA 2DNAA 2QNJA 2L4FA 1WIVA 3E46A 2LVNC 1UFZA 1EFUB 2BWEA 1YLAA 2JZ1A 3FE3A 1NV8A 2K0BX 1G3IA 1ZMUA 4WP2A 2L4EA 1ZMWA 2LVPC 2RRUA 1IFYA 3IHPA 3MMPA 1VEGA 2JNHA
chains in the Genus database with same CATH superfamily
2CRUA 3HY5A 5C18A 2LWXA 3GQ5A 1MU5A 4L16A 4LF4M 3U61A 4CISA 3GRRA 2GNOA 3GQ4A 2CHVA 5DYIA 1JR3A 4AW4A 1DGFA 1Q39A 3J81S 2FH0A 1PM5A 2KZUA 4KLNA 4A3VB 1IBMM 2DZLA 2ZAMA 4FWDA 3ZH9B 2QZ4A 4AZFA 3GLGA 3MK6A 4DV0M 1JR3D 2KRUA 4GMQA 4W5WA 4JI8M 1ORYB 5JI2E 1W5SA 1DGGA 2C98A 5DYGA 1NNJA 1L1ZA 4JYAM 1D0KA 3CGWA 1N36M 3I51A 1ZMVA 5IT9S 5EP2A 3V76A 4DR2M 2LXEA 3GLIE 3KOZE 4LRSA 4QNMA 4OW0A 5GKNA 3U6LA 1Z6TA 4HEOA 4G6ZA 4I8OA 4NSRA 5DFLA 4IIWA 5E6JA 3GPXA 3R9XB 4DV6M 3L27A 3M0EA 4LJ6A 3HHZA 1V33A 1QZEA 1G8PA 1OKSA 2BJVA 1C1KA 4WURA 5EP3A 4KODA 1XB2B 2O25A 3HX3A 4P17A 4R71A 4PDGA 2XLJA 4LF5M 1TF0B 4FD2A 5ITTA 4X64M 3UK6A 1HNWM 2KNAA 4I81A 3U6QA 1IN8A 2C9CA 4RKUF 1PGYA 3VK7A 4MGIE 4DV2M 3L25A 1Z5AA 4IBDA 3QYEA 1QVRA 4GH9A 1NY5A 1XXHB 1HQCA 4QNRA 3A42A 4XGIA 3U5ZA 2Y20A 1N78A 3SMPA 3LMMA 4LZJA 5FSWA 3GPYA 2FE8A 1G71A 1JQJC 4DR1M 4DR3M 3I4VA 4QHTA 5KO3A 2QPAA 3I01M 2XZFA 4LJ7A 3LW5F 2R0IA 1IM2A 2B3TA 1XMOM 3GLHE 2DENA 2CHGA 1NHGC 2M60A 2V1UA 2CEAA 4OX9M 1PJIA 2QCUA 1TH4A 3H4JA 2EJSA 1L8QA 1DGHB 1IN7A 1N75A 2LBCA 2R46A 4IBKA 5IWAM 4LGYA 2QBYB 3VDUA 2KNZA 4OVZB 1VDLA 1JB0F 1AIPC 2H5XA 2ZAOA 3VLFB 1R2ZA 1GL6A 1LTMA 1VDDA 1MN3A 2RGHA 1IN5A 2QHOB 4Q7JA 2DHYA 1OAOC 3HHWA 1XC8A 1QDRA 3LCVB 5LMNM 5EP4A 4DV5M 1XWIA 1Z5BA 2DVWB 3SAUA 2NQ8C 3K8ZA 4ZPXA 1IBLM 2XFSA 2Y0TA 3FUUA 4B08A 3J7AS 2HAKA 1N32M 4JI4M 1Y8GA 2P5TA 3FTDA 3U6SA 2L4FA 1TDHA 2FS1A 4M9XA 4B7FA 3GLIA 2I7NA 2Z4SA 4FWGA 1WIVA 3E46A 2LVNC 3DFZA 4MGYE 5F3WA 3FE3A 1LV7A 1IQPA 1NV8A 2K0BX 3SFZA 1QYRA 2L4EA 2LVPC 2LHGA 3A46A 4GITA 1FJGM 3IHPA 4JI3M 3SARA 3HGIA 2D7HA 3CF0A 3A45A 3GRYA 1DO0A 2QSFX 1E94E 2XZUA 4WW0A 3FYDA 4AKHA 2DZOB 1C7YA 4MGHA 3Q8GA 4M0WA 2WZJA 4CGYB 1FNNA 4GEWA 1QUTA 1IY2A 1UM8A 3QYBA 4IBBA 4X65M 2WSEF 1VQ1A 3NBXX 3TWKA 2Z4RA 3VKHA 3C3DA 2L2DA 3KP0E 4FCVA 4D81A 2R65A 3GO8A 3SATA 1HNZM 2KEBA 3SYLA 4B3TM 3KDSE 4LRTA 2Y21A 4M9SA 2UUBM 2A5YB 2QENA 2UU9M 3TL4X 2XGNA 4G4NA 1K3XA 4RF1A 4XK8F 2CV1A 5ITQA 1RU3A 1P3QQ 4IBJA 2N35A 1QAQA 5ITRA 3K2LA 2ZTCA 1SXJC 2Z8YM 2ERCA 2JY7A 4NL4H 3GQ3A 1E9SA 4QOZC 1MX0A 3ZC7B 2APLA 4B3SM 3GRUA 4JI1M 2J7NA 5BR8M 3L26A 2O01F 1VG5A 3AOGA 4M0DA 4GRIA 5FTKA 1H6UA 3SHGB 3EIHA 3DZDA 3W67A 2UUCM 2JUJA 2KDLA 3BXWA 1XHBA 2JA2A 2AHMA 3GLFB 2MROB 1NV9A 2ZBKB 3NBIA 4LJ8A 3RFWA 5A2QS 1IY1A 3AJIB 1GJTA 2CP8A 3B7QA 3TWLA 3PVSA 2JP7A 5KQ8A 2DXIA 4YHHM 4UN2B 4BLCA 2LVOC 2LVQD 3ZQJA 2KRKA 2R4EA 3U6CA 3GRVA 4DV3M 3IG5A 3T6PA 2R4JA 2F5SA 2D7GA 3A98B 2GQFA 2XSZA 4M9ZA 3PXGA 1QDTA 1SXJB 4GKKM 5EXSA 2VQEM 2G8LA 1V92A 2XSZD 3FRIA 4ANRA 4I5SA 1OFIA 1J5EM 3J80S 4GC5A 2K9DA 1WJ7A 3TE6A 2L6OA 3TWMA 3U60B 5ITXE 4GKJM 5JI3E 3HJQA 4IBIA 3SYKA 2KXEA 4MGZE 1GLNA 2R6FA 2FNAA 2DZNB 2EKKA 1QAOA 4JXJA 2CUZA 4YY3M 2JWSA 2JZ0A 2OQ4A 2DAIA 4AI6A 3C3EA 2DWMA 4LF6M 4NXMM 3TQSA 4F2LA 2Z7JA 4IJEA 1BVSA 2F4VM 2Y0QA 3HJ8A 1DGHA 3MJ5A 1MJGM 1Q3CA 2YQZA 4REZA 1QZMA 4B3RM 4I4LA 2JZ1A 2QBYA 3R8FA 4OVZA 2BNKA 3J7BA 3U6PA 3DOAA 3HHXA 3KS4A 1ZMWA 1IFYA 2F5OA 3L29A 2VDBB 2VIIA 3FTFA 2UXDM 1OFHA 2R62A 3AOEA 3U6DA 3U5ZB 1TH2A 3DA1A 3HU3A 2JY6B 3KOXE 5FTLA 4Z6YA 4GHLA 1WXQA 2UXCM 4Y28F 2R44A 2DWNA 2K47A 2OOBA 2HL7A 5KPZA 3JAMS 1TDZA 5EXTA 3AFHA 4B3MM 1R4GA 4L6V6 3VFDA 3CF6E 4XBOA 2MGWA 4AG6A 1Q3BA 3W68A 1IBKM 1OAIA 5E26A 2LHCA 1T43A 4NC6A 1VEJA 1E32A 1DGBA 2K6BA 2MR9A 3HU2A 1I94M 3QWLA 4ITQA 3SMSA 3RE8A 3LQQA 1QUSA 2RKOA 4RF0A 3WHLA 3CF2A 4B7HA 3AL0C 3D8LA 1W5TA 3LVVA 1PJQA 4RNAA 1XXHE 3NWLA 1Z5CA 2EA0A 1OIZA 3Q8XA 1GKIA 4LFBM 4G4OA 3W0FA 1G4AE 3KOWE 2HCBA 1IN6A 1ZV1A 1L2DA 4HL4A 5LMUM 4GIPA 4FVMA 1IXRC 3SBJA 4AG5A 4L78A 2EO2A 5ITXA 3I04M 2EKFA 2C96A 1DO2A 5FTMA 4OU7A 3BBZA 4DV4M 2JXNA 1V34A 4LF7M 4NRWA 1GJSA 3W0LB 1YUBA 2DAGA 3T38A 1IXSB 1IXZA 3FUTA 1HT2E 3MHVC 1XNQM 1Z59A 3KSJA 4BB9A 4S12A 2WSFF 1EIJA 1R5LA 1T3TA 2J5YA 2L09A 4LJ5A 3UGJA 2DI0A 2CWBA 1WGLA 2R18A 3U6EA 5L8RF 4JI6M 2ZTDA 4P16A 4IJFA 3SC3A 1PRBA 2L7HA 3AKZA 1HQYE 3QAUA 2VQFM 1N77A 3GPPA 4JI7M 3E9SA 2X8AA 2LNHC 3ZCBB 3FUVA 4G4QA 3VKGA 3H4MA 4R7GA 2KNVA 4DUZM 1AUAA 3PFIA 1SG9A 2KZSA 3JR5A 4GHAA 2LVAA 4IBEA 4IBCA 4D80A 1S3SA 1K82A 5IREB 1GO5A 4DR6M 4LGMA 2I7PA 4KO8A 1GABA 3GP1A 2WSCF 1Q02A 2RGOA 2X49A 4MM3B 4EIWA 3J2PB 3SASA 1J09A 2VF8A 3TPZA 4CIZA 2EUCA 5IZ7D 2J7OA 3HHYA 4MB7A 4KT0F 2DAMA 2OOAA 1PJSA 3KOYE 4JN6A 4CJ6A 3GLHB 4DR4M 2OO9A 3FTEA 2D7EA 1OIPA 2QP9X 1OJLA 4BBAA 5H37D 1SXJA 3HKPA 1R7RA 1T6OA 4QOSA 4Z8XA 3U61B 1XMQM 2G5GX 1YE9A 4FCTA 5EJCA 1NHWC 1XNRM 2VF7A 4DBGB 1KSFX 7CATA 2DNAA 1SXJD 2QNJA 3GLGB 1QAMA 4LF9M 1I4WA 1X37A 4NRVA 3U60A 2HHHM 1EFUB 2BWEA 3D8BA 3FTCA 3BOSA 1XXHA 2CE7A 3OTOM 3FKEA 1EE8A 3IG8A 4L15A 1G3IA 4PT5A 4WP2A 3UZUA 2CV2A 1E9RA 2RRUA 2XEPA 4HLQA 4IBFA 4PDIA 1VEGA 3SHFA 2F5QA 2JNHA 2MH8A 3I4YA 3K92A 4QHSA 2C5RA 2KA6B 3WHKA 3LVWA 1K3WA 1G41A 2KW0A 3IECA 4LCBA 1R2YA 1D2NA 3B89A 1HJPA 1D0LA 2DAEA 5EXXA 2Z3XA 4F1IA 2F5NA 4FWHA 5KPTA 4LF8M 4DR5M 2MJ5B 4LFCM 2O5RA 1PJJA 4TUWA 4MGKE 1YSYA 4X62M 1R6BX 4II7A 1TTEA 2FFJA 2Q2EB 2X4AA 3SAVA 2XFTA 3KP1E 4GC9A 5EXPA 3K9OA 4KHPM 3EIEA 3E4RA 2XF3A 4MH0E 3GLFE 3C58A 1NSFA 3AOEC 2XH9A 4IBGA 5KQDA 3UMMA 4AKGA 1IY0A 3KVWA 4R3DA 2CHQA 4LJ4A 4NSOB 1CUKA 2L7IA 1QANA 2R45A 1KFVA 1NVMA 1IN4A 3HU1A 3FRHA 3PNYA 1KYIA 4G3OA 2F5PA 1ZQ9A 2JY8A 3VK8A 1NNUC 4LJAA 3B7ZA 4DV1M 3PNVA 1JR3E 3L2AA 1A5TA 3FUXA 4LFAM 1SXJE 2OPFA 4B7GA 1NO1A 4DR7M 2LH0A 3GLGE 1D0MA 1OQYA 3B9PA 3UJNA 4LJ9A 2DHRA 2H1RA 3M6AA 2BJWA 2CFOA 3FD9A 4L4UA 1GVNA 2LTUA 3M7GA 1DV0A 5C1BA 2W82A 5EP1A 3LCUA 1PJTA 2JY5A 3VDPA 4JI5M 5ITYA 3ILKA 1TH3A 3AV0A 3LQRA 2HWJA 5EQTA 4PD2A 2C9OA 3KXEC 2E5LM 1GL7A 1OTRA 1L2CA 8CATA 1HR0M 3E21A 2ZANA 2DWLA 1TR8A 3KFUG 1N33M 1WHCA 1HNXM 1NY6A 2DWZB 1N34M 1G59A 2CV0A 3K9PA 2YFQA 3U6OA 4L8RC 2KHHA 3KSXA 3FUWA 1IXSA 4NOOB 1WR1B 5FLXS 3L28A 1F4IA 3THGA 3GLIB 3KW6A 3FYCA 2ZM6M 5FTJA 4PCZA 3RGPA 2BWBA 1J7KA 3JR4A 4FW9A 3B7NA 3J27B 1VEKA 3C9PA 3CTWB 3GPUA 5BPVA 3T1HM 1WGNA 3B74A 3F92A 1L2BA 4AKIA 2G3QA 3KS8A 2HKJA 4JV5M 2YNMD 2UXBM 2UUAM 4CHTB 1HT1E 2DAKA 3HJSA 4LZZA 1NJFA 2C99A 1NJGA 3U6MA 4K0KM 2QQ8A 2DKLA 1ZAEA 4DV7M 2V6ZM 4NXNM 4G4RA 3RGSA 4AQYM 3SAWA 3T1YM 3GLFA 2V1CA 4JI0M 3T15A 4LG2A 1UFZA 4FCWA 1YLAA 5FTNA 5ITUA 1TGUA 2YR0A 3HZJA 5KPRA 1L1TA 1ZMUA 2M5ZA 3HWSA 3K1JA 5DNYA 3MMPA 4LY6A 4DUYM 4JI2M 2FOIC 1QQWA 4D82A 3GLHA 4X66M
chains in the Genus database with same CATH topology
1DO0A 2QSFX 1G41A 3IECA 2JY6B 1E94E 3B89A 1HJPA 2DAEA 2OOBA 4F1IA 2DZLA 2WZJA 4GEWA 1R4GA 1VQ1A 2MJ5B 2MGWA 2L2DA 1OAIA 1T43A 5JI2E 1TTEA 1VEJA 2MR9A 1ZMVA 3K9OA 3GLIE 3GLFE 4HEOA 5DFLA 1XXHE 1P3QQ 1CUKA 1QZEA 2ZTCA 1OKSA 2JY7A 1C7YA 1G4AE 1XB2B 2O25A 4R71A 3FRHA 1KYIA 1ZV1A 4G3OA 2JY8A 1VG5A 2KNAA 1JR3E 2EKFA 1A5TA 1DO2A 2JUJA 3BBZA 1PGYA 2DAGA 3GLGE 2MROB 1NV9A 1OQYA 1HT2E 2CP8A 2DI0A 2JP7A 2LTUA 2CWBA 1WGLA 4UN2B 2LVOC 2LVQD 1DV0A 2ZTDA 3LCUA 2JY5A 3T6PA 1HQYE 2HWJA 1OTRA 2R0IA 1IM2A 2B3TA 3E21A 1TR8A 3GLHE 1WHCA 2DENA 2KNVA 1V92A 3FRIA 3K9PA 3H4JA 1SG9A 2EJSA 2KHHA 1IXSA 1WR1B 2LVAA 1GO5A 2LBCA 2K9DA 1WJ7A 1F4IA 2BWBA 1Q02A 1VEKA 2KNZA 1VDLA 1AIPC 2H5XA 1WGNA 1MN3A 2EKKA 3F92A 2G3QA 2DAMA 2DHYA 2QHOB 2OOAA 4Q7JA 3LCVB 2JZ0A 2OO9A 1HT1E 2DAKA 2DAIA 1T6OA 4F2LA 2DKLA 1BVSA 4DBGB 2HAKA 1Y8GA 2DNAA 2QNJA 2L4FA 1WIVA 3E46A 2LVNC 1UFZA 1EFUB 2BWEA 1YLAA 2JZ1A 3FE3A 1NV8A 2K0BX 1G3IA 1ZMUA 4WP2A 2L4EA 1ZMWA 2LVPC 2RRUA 1IFYA 3IHPA 3MMPA 1VEGA 2JNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DO0 A;  2QSF X;  1G41 A;  3IEC A;  2JY6 B;  1E94 E;  3B89 A;  1HJP A;  2DAE A;  2OOB A;  4F1I A;  2DZL A;  2WZJ A;  4GEW A;  1R4G A;  1VQ1 A;  2MJ5 B;  2MGW A;  2L2D A;  1OAI A;  1T43 A;  5JI2 E;  1TTE A;  1VEJ A;  2MR9 A;  1ZMV A;  3K9O A;  3GLI E;  3GLF E;  4HEO A;  5DFL A;  1XXH E;  1P3Q Q;  1CUK A;  1QZE A;  2ZTC A;  1OKS A;  2JY7 A;  1C7Y A;  1G4A E;  1XB2 B;  2O25 A;  4R71 A;  3FRH A;  1KYI A;  1ZV1 A;  4G3O A;  2JY8 A;  1VG5 A;  2KNA A;  1JR3 E;  2EKF A;  1A5T A;  1DO2 A;  2JUJ A;  3BBZ A;  1PGY A;  2DAG A;  3GLG E;  2MRO B;  1NV9 A;  1OQY A;  1HT2 E;  2CP8 A;  2DI0 A;  2JP7 A;  2LTU A;  2CWB A;  1WGL A;  4UN2 B;  2LVO C;  2LVQ D;  1DV0 A;  2ZTD A;  3LCU A;  2JY5 A;  3T6P A;  1HQY E;  2HWJ A;  1OTR A;  2R0I A;  1IM2 A;  2B3T A;  3E21 A;  1TR8 A;  3GLH E;  1WHC A;  2DEN A;  2KNV A;  1V92 A;  3FRI A;  3K9P A;  3H4J A;  1SG9 A;  2EJS A;  2KHH A;  1IXS A;  1WR1 B;  2LVA A;  1GO5 A;  2LBC A;  2K9D A;  1WJ7 A;  1F4I A;  2BWB A;  1Q02 A;  1VEK A;  2KNZ A;  1VDL A;  1AIP C;  2H5X A;  1WGN A;  1MN3 A;  2EKK A;  3F92 A;  2G3Q A;  2DAM A;  2DHY A;  2QHO B;  2OOA A;  4Q7J A;  3LCV B;  2JZ0 A;  2OO9 A;  1HT1 E;  2DAK A;  2DAI A;  1T6O A;  4F2L A;  2DKL A;  1BVS A;  4DBG B;  2HAK A;  1Y8G A;  2DNA A;  2QNJ A;  2L4F A;  1WIV A;  3E46 A;  2LVN C;  1UFZ A;  1EFU B;  2BWE A;  1YLA A;  2JZ1 A;  3FE3 A;  1NV8 A;  2K0B X;  1G3I A;  1ZMU A;  4WP2 A;  2L4E A;  1ZMW A;  2LVP C;  2RRU A;  1IFY A;  3IHP A;  3MMP A;  1VEG A;  2JNH A; 
#chains in the Genus database with same CATH topology
 2CRU A;  3HY5 A;  5C18 A;  2LWX A;  3GQ5 A;  1MU5 A;  4L16 A;  4LF4 M;  3U61 A;  4CIS A;  3GRR A;  2GNO A;  3GQ4 A;  2CHV A;  5DYI A;  1JR3 A;  4AW4 A;  1DGF A;  1Q39 A;  3J81 S;  2FH0 A;  1PM5 A;  2KZU A;  4KLN A;  4A3V B;  1IBM M;  2DZL A;  2ZAM A;  4FWD A;  3ZH9 B;  2QZ4 A;  4AZF A;  3GLG A;  3MK6 A;  4DV0 M;  1JR3 D;  2KRU A;  4GMQ A;  4W5W A;  4JI8 M;  1ORY B;  5JI2 E;  1W5S A;  1DGG A;  2C98 A;  5DYG A;  1NNJ A;  1L1Z A;  4JYA M;  1D0K A;  3CGW A;  1N36 M;  3I51 A;  1ZMV A;  5IT9 S;  5EP2 A;  3V76 A;  4DR2 M;  2LXE A;  3GLI E;  3KOZ E;  4LRS A;  4QNM A;  4OW0 A;  5GKN A;  3U6L A;  1Z6T A;  4HEO A;  4G6Z A;  4I8O A;  4NSR A;  5DFL A;  4IIW A;  5E6J A;  3GPX A;  3R9X B;  4DV6 M;  3L27 A;  3M0E A;  4LJ6 A;  3HHZ A;  1V33 A;  1QZE A;  1G8P A;  1OKS A;  2BJV A;  1C1K A;  4WUR A;  5EP3 A;  4KOD A;  1XB2 B;  2O25 A;  3HX3 A;  4P17 A;  4R71 A;  4PDG A;  2XLJ A;  4LF5 M;  1TF0 B;  4FD2 A;  5ITT A;  4X64 M;  3UK6 A;  1HNW M;  2KNA A;  4I81 A;  3U6Q A;  1IN8 A;  2C9C A;  4RKU F;  1PGY A;  3VK7 A;  4MGI E;  4DV2 M;  3L25 A;  1Z5A A;  4IBD A;  3QYE A;  1QVR A;  4GH9 A;  1NY5 A;  1XXH B;  1HQC A;  4QNR A;  3A42 A;  4XGI A;  3U5Z A;  2Y20 A;  1N78 A;  3SMP A;  3LMM A;  4LZJ A;  5FSW A;  3GPY A;  2FE8 A;  1G71 A;  1JQJ C;  4DR1 M;  4DR3 M;  3I4V A;  4QHT A;  5KO3 A;  2QPA A;  3I01 M;  2XZF A;  4LJ7 A;  3LW5 F;  2R0I A;  1IM2 A;  2B3T A;  1XMO M;  3GLH E;  2DEN A;  2CHG A;  1NHG C;  2M60 A;  2V1U A;  2CEA A;  4OX9 M;  1PJI A;  2QCU A;  1TH4 A;  3H4J A;  2EJS A;  1L8Q A;  1DGH B;  1IN7 A;  1N75 A;  2LBC A;  2R46 A;  4IBK A;  5IWA M;  4LGY A;  2QBY B;  3VDU A;  2KNZ A;  4OVZ B;  1VDL A;  1JB0 F;  1AIP C;  2H5X A;  2ZAO A;  3VLF B;  1R2Z A;  1GL6 A;  1LTM A;  1VDD A;  1MN3 A;  2RGH A;  1IN5 A;  2QHO B;  4Q7J A;  2DHY A;  1OAO C;  3HHW A;  1XC8 A;  1QDR A;  3LCV B;  5LMN M;  5EP4 A;  4DV5 M;  1XWI A;  1Z5B A;  2DVW B;  3SAU A;  2NQ8 C;  3K8Z A;  4ZPX A;  1IBL M;  2XFS A;  2Y0T A;  3FUU A;  4B08 A;  3J7A S;  2HAK A;  1N32 M;  4JI4 M;  1Y8G A;  2P5T A;  3FTD A;  3U6S A;  2L4F A;  1TDH A;  2FS1 A;  4M9X A;  4B7F A;  3GLI A;  2I7N A;  2Z4S A;  4FWG A;  1WIV A;  3E46 A;  2LVN C;  3DFZ A;  4MGY E;  5F3W A;  3FE3 A;  1LV7 A;  1IQP A;  1NV8 A;  2K0B X;  3SFZ A;  1QYR A;  2L4E A;  2LVP C;  2LHG A;  3A46 A;  4GIT A;  1FJG M;  3IHP A;  4JI3 M;  3SAR A;  3HGI A;  2D7H A;  3CF0 A;  3A45 A;  3GRY A;  1DO0 A;  2QSF X;  1E94 E;  2XZU A;  4WW0 A;  3FYD A;  4AKH A;  2DZO B;  1C7Y A;  4MGH A;  3Q8G A;  4M0W A;  2WZJ A;  4CGY B;  1FNN A;  4GEW A;  1QUT A;  1IY2 A;  1UM8 A;  3QYB A;  4IBB A;  4X65 M;  2WSE F;  1VQ1 A;  3NBX X;  3TWK A;  2Z4R A;  3VKH A;  3C3D A;  2L2D A;  3KP0 E;  4FCV A;  4D81 A;  2R65 A;  3GO8 A;  3SAT A;  1HNZ M;  2KEB A;  3SYL A;  4B3T M;  3KDS E;  4LRT A;  2Y21 A;  4M9S A;  2UUB M;  2A5Y B;  2QEN A;  2UU9 M;  3TL4 X;  2XGN A;  4G4N A;  1K3X A;  4RF1 A;  4XK8 F;  2CV1 A;  5ITQ A;  1RU3 A;  1P3Q Q;  4IBJ A;  2N35 A;  1QAQ A;  5ITR A;  3K2L A;  2ZTC A;  1SXJ C;  2Z8Y M;  2ERC A;  2JY7 A;  4NL4 H;  3GQ3 A;  1E9S A;  4QOZ C;  1MX0 A;  3ZC7 B;  2APL A;  4B3S M;  3GRU A;  4JI1 M;  2J7N A;  5BR8 M;  3L26 A;  2O01 F;  1VG5 A;  3AOG A;  4M0D A;  4GRI A;  5FTK A;  1H6U A;  3SHG B;  3EIH A;  3DZD A;  3W67 A;  2UUC M;  2JUJ A;  2KDL A;  3BXW A;  1XHB A;  2JA2 A;  2AHM A;  3GLF B;  2MRO B;  1NV9 A;  2ZBK B;  3NBI A;  4LJ8 A;  3RFW A;  5A2Q S;  1IY1 A;  3AJI B;  1GJT A;  2CP8 A;  3B7Q A;  3TWL A;  3PVS A;  2JP7 A;  5KQ8 A;  2DXI A;  4YHH M;  4UN2 B;  4BLC A;  2LVO C;  2LVQ D;  3ZQJ A;  2KRK A;  2R4E A;  3U6C A;  3GRV A;  4DV3 M;  3IG5 A;  3T6P A;  2R4J A;  2F5S A;  2D7G A;  3A98 B;  2GQF A;  2XSZ A;  4M9Z A;  3PXG A;  1QDT A;  1SXJ B;  4GKK M;  5EXS A;  2VQE M;  2G8L A;  1V92 A;  2XSZ D;  3FRI A;  4ANR A;  4I5S A;  1OFI A;  1J5E M;  3J80 S;  4GC5 A;  2K9D A;  1WJ7 A;  3TE6 A;  2L6O A;  3TWM A;  3U60 B;  5ITX E;  4GKJ M;  5JI3 E;  3HJQ A;  4IBI A;  3SYK A;  2KXE A;  4MGZ E;  1GLN A;  2R6F A;  2FNA A;  2DZN B;  2EKK A;  1QAO A;  4JXJ A;  2CUZ A;  4YY3 M;  2JWS A;  2JZ0 A;  2OQ4 A;  2DAI A;  4AI6 A;  3C3E A;  2DWM A;  4LF6 M;  4NXM M;  3TQS A;  4F2L A;  2Z7J A;  4IJE A;  1BVS A;  2F4V M;  2Y0Q A;  3HJ8 A;  1DGH A;  3MJ5 A;  1MJG M;  1Q3C A;  2YQZ A;  4REZ A;  1QZM A;  4B3R M;  4I4L A;  2JZ1 A;  2QBY A;  3R8F A;  4OVZ A;  2BNK A;  3J7B A;  3U6P A;  3DOA A;  3HHX A;  3KS4 A;  1ZMW A;  1IFY A;  2F5O A;  3L29 A;  2VDB B;  2VII A;  3FTF A;  2UXD M;  1OFH A;  2R62 A;  3AOE A;  3U6D A;  3U5Z B;  1TH2 A;  3DA1 A;  3HU3 A;  2JY6 B;  3KOX E;  5FTL A;  4Z6Y A;  4GHL A;  1WXQ A;  2UXC M;  4Y28 F;  2R44 A;  2DWN A;  2K47 A;  2OOB A;  2HL7 A;  5KPZ A;  3JAM S;  1TDZ A;  5EXT A;  3AFH A;  4B3M M;  1R4G A;  4L6V 6;  3VFD A;  3CF6 E;  4XBO A;  2MGW A;  4AG6 A;  1Q3B A;  3W68 A;  1IBK M;  1OAI A;  5E26 A;  2LHC A;  1T43 A;  4NC6 A;  1VEJ A;  1E32 A;  1DGB A;  2K6B A;  2MR9 A;  3HU2 A;  1I94 M;  3QWL A;  4ITQ A;  3SMS A;  3RE8 A;  3LQQ A;  1QUS A;  2RKO A;  4RF0 A;  3WHL A;  3CF2 A;  4B7H A;  3AL0 C;  3D8L A;  1W5T A;  3LVV A;  1PJQ A;  4RNA A;  1XXH E;  3NWL A;  1Z5C A;  2EA0 A;  1OIZ A;  3Q8X A;  1GKI A;  4LFB M;  4G4O A;  3W0F A;  1G4A E;  3KOW E;  2HCB A;  1IN6 A;  1ZV1 A;  1L2D A;  4HL4 A;  5LMU M;  4GIP A;  4FVM A;  1IXR C;  3SBJ A;  4AG5 A;  4L78 A;  2EO2 A;  5ITX A;  3I04 M;  2EKF A;  2C96 A;  1DO2 A;  5FTM A;  4OU7 A;  3BBZ A;  4DV4 M;  2JXN A;  1V34 A;  4LF7 M;  4NRW A;  1GJS A;  3W0L B;  1YUB A;  2DAG A;  3T38 A;  1IXS B;  1IXZ A;  3FUT A;  1HT2 E;  3MHV C;  1XNQ M;  1Z59 A;  3KSJ A;  4BB9 A;  4S12 A;  2WSF F;  1EIJ A;  1R5L A;  1T3T A;  2J5Y A;  2L09 A;  4LJ5 A;  3UGJ A;  2DI0 A;  2CWB A;  1WGL A;  2R18 A;  3U6E A;  5L8R F;  4JI6 M;  2ZTD A;  4P16 A;  4IJF A;  3SC3 A;  1PRB A;  2L7H A;  3AKZ A;  1HQY E;  3QAU A;  2VQF M;  1N77 A;  3GPP A;  4JI7 M;  3E9S A;  2X8A A;  2LNH C;  3ZCB B;  3FUV A;  4G4Q A;  3VKG A;  3H4M A;  4R7G A;  2KNV A;  4DUZ M;  1AUA A;  3PFI A;  1SG9 A;  2KZS A;  3JR5 A;  4GHA A;  2LVA A;  4IBE A;  4IBC A;  4D80 A;  1S3S A;  1K82 A;  5IRE B;  1GO5 A;  4DR6 M;  4LGM A;  2I7P A;  4KO8 A;  1GAB A;  3GP1 A;  2WSC F;  1Q02 A;  2RGO A;  2X49 A;  4MM3 B;  4EIW A;  3J2P B;  3SAS A;  1J09 A;  2VF8 A;  3TPZ A;  4CIZ A;  2EUC A;  5IZ7 D;  2J7O A;  3HHY A;  4MB7 A;  4KT0 F;  2DAM A;  2OOA A;  1PJS A;  3KOY E;  4JN6 A;  4CJ6 A;  3GLH B;  4DR4 M;  2OO9 A;  3FTE A;  2D7E A;  1OIP A;  2QP9 X;  1OJL A;  4BBA A;  5H37 D;  1SXJ A;  3HKP A;  1R7R A;  1T6O A;  4QOS A;  4Z8X A;  3U61 B;  1XMQ M;  2G5G X;  1YE9 A;  4FCT A;  5EJC A;  1NHW C;  1XNR M;  2VF7 A;  4DBG B;  1KSF X;  7CAT A;  2DNA A;  1SXJ D;  2QNJ A;  3GLG B;  1QAM A;  4LF9 M;  1I4W A;  1X37 A;  4NRV A;  3U60 A;  2HHH M;  1EFU B;  2BWE A;  3D8B A;  3FTC A;  3BOS A;  1XXH A;  2CE7 A;  3OTO M;  3FKE A;  1EE8 A;  3IG8 A;  4L15 A;  1G3I A;  4PT5 A;  4WP2 A;  3UZU A;  2CV2 A;  1E9R A;  2RRU A;  2XEP A;  4HLQ A;  4IBF A;  4PDI A;  1VEG A;  3SHF A;  2F5Q A;  2JNH A;  2MH8 A;  3I4Y A;  3K92 A;  4QHS A;  2C5R A;  2KA6 B;  3WHK A;  3LVW A;  1K3W A;  1G41 A;  2KW0 A;  3IEC A;  4LCB A;  1R2Y A;  1D2N A;  3B89 A;  1HJP A;  1D0L A;  2DAE A;  5EXX A;  2Z3X A;  4F1I A;  2F5N A;  4FWH A;  5KPT A;  4LF8 M;  4DR5 M;  2MJ5 B;  4LFC M;  2O5R A;  1PJJ A;  4TUW A;  4MGK E;  1YSY A;  4X62 M;  1R6B X;  4II7 A;  1TTE A;  2FFJ A;  2Q2E B;  2X4A A;  3SAV A;  2XFT A;  3KP1 E;  4GC9 A;  5EXP A;  3K9O A;  4KHP M;  3EIE A;  3E4R A;  2XF3 A;  4MH0 E;  3GLF E;  3C58 A;  1NSF A;  3AOE C;  2XH9 A;  4IBG A;  5KQD A;  3UMM A;  4AKG A;  1IY0 A;  3KVW A;  4R3D A;  2CHQ A;  4LJ4 A;  4NSO B;  1CUK A;  2L7I A;  1QAN A;  2R45 A;  1KFV A;  1NVM A;  1IN4 A;  3HU1 A;  3FRH A;  3PNY A;  1KYI A;  4G3O A;  2F5P A;  1ZQ9 A;  2JY8 A;  3VK8 A;  1NNU C;  4LJA A;  3B7Z A;  4DV1 M;  3PNV A;  1JR3 E;  3L2A A;  1A5T A;  3FUX A;  4LFA M;  1SXJ E;  2OPF A;  4B7G A;  1NO1 A;  4DR7 M;  2LH0 A;  3GLG E;  1D0M A;  1OQY A;  3B9P A;  3UJN A;  4LJ9 A;  2DHR A;  2H1R A;  3M6A A;  2BJW A;  2CFO A;  3FD9 A;  4L4U A;  1GVN A;  2LTU A;  3M7G A;  1DV0 A;  5C1B A;  2W82 A;  5EP1 A;  3LCU A;  1PJT A;  2JY5 A;  3VDP A;  4JI5 M;  5ITY A;  3ILK A;  1TH3 A;  3AV0 A;  3LQR A;  2HWJ A;  5EQT A;  4PD2 A;  2C9O A;  3KXE C;  2E5L M;  1GL7 A;  1OTR A;  1L2C A;  8CAT A;  1HR0 M;  3E21 A;  2ZAN A;  2DWL A;  1TR8 A;  3KFU G;  1N33 M;  1WHC A;  1HNX M;  1NY6 A;  2DWZ B;  1N34 M;  1G59 A;  2CV0 A;  3K9P A;  2YFQ A;  3U6O A;  4L8R C;  2KHH A;  3KSX A;  3FUW A;  1IXS A;  4NOO B;  1WR1 B;  5FLX S;  3L28 A;  1F4I A;  3THG A;  3GLI B;  3KW6 A;  3FYC A;  2ZM6 M;  5FTJ A;  4PCZ A;  3RGP A;  2BWB A;  1J7K A;  3JR4 A;  4FW9 A;  3B7N A;  3J27 B;  1VEK A;  3C9P A;  3CTW B;  3GPU A;  5BPV A;  3T1H M;  1WGN A;  3B74 A;  3F92 A;  1L2B A;  4AKI A;  2G3Q A;  3KS8 A;  2HKJ A;  4JV5 M;  2YNM D;  2UXB M;  2UUA M;  4CHT B;  1HT1 E;  2DAK A;  3HJS A;  4LZZ A;  1NJF A;  2C99 A;  1NJG A;  3U6M A;  4K0K M;  2QQ8 A;  2DKL A;  1ZAE A;  4DV7 M;  2V6Z M;  4NXN M;  4G4R A;  3RGS A;  4AQY M;  3SAW A;  3T1Y M;  3GLF A;  2V1C A;  4JI0 M;  3T15 A;  4LG2 A;  1UFZ A;  4FCW A;  1YLA A;  5FTN A;  5ITU A;  1TGU A;  2YR0 A;  3HZJ A;  5KPR A;  1L1T A;  1ZMU A;  2M5Z A;  3HWS A;  3K1J A;  5DNY A;  3MMP A;  4LY6 A;  4DUY M;  4JI2 M;  2FOI C;  1QQW A;  4D82 A;  3GLH A;  4X66 M; 
#chains in the Genus database with same CATH homology
 1DO0 A;  2QSF X;  1G41 A;  3IEC A;  2JY6 B;  1E94 E;  3B89 A;  1HJP A;  2DAE A;  2OOB A;  4F1I A;  2DZL A;  2WZJ A;  4GEW A;  1R4G A;  1VQ1 A;  2MJ5 B;  2MGW A;  2L2D A;  1OAI A;  1T43 A;  5JI2 E;  1TTE A;  1VEJ A;  2MR9 A;  1ZMV A;  3K9O A;  3GLI E;  3GLF E;  4HEO A;  5DFL A;  1XXH E;  1P3Q Q;  1CUK A;  1QZE A;  2ZTC A;  1OKS A;  2JY7 A;  1C7Y A;  1G4A E;  1XB2 B;  2O25 A;  4R71 A;  3FRH A;  1KYI A;  1ZV1 A;  4G3O A;  2JY8 A;  1VG5 A;  2KNA A;  1JR3 E;  2EKF A;  1A5T A;  1DO2 A;  2JUJ A;  3BBZ A;  1PGY A;  2DAG A;  3GLG E;  2MRO B;  1NV9 A;  1OQY A;  1HT2 E;  2CP8 A;  2DI0 A;  2JP7 A;  2LTU A;  2CWB A;  1WGL A;  4UN2 B;  2LVO C;  2LVQ D;  1DV0 A;  2ZTD A;  3LCU A;  2JY5 A;  3T6P A;  1HQY E;  2HWJ A;  1OTR A;  2R0I A;  1IM2 A;  2B3T A;  3E21 A;  1TR8 A;  3GLH E;  1WHC A;  2DEN A;  2KNV A;  1V92 A;  3FRI A;  3K9P A;  3H4J A;  1SG9 A;  2EJS A;  2KHH A;  1IXS A;  1WR1 B;  2LVA A;  1GO5 A;  2LBC A;  2K9D A;  1WJ7 A;  1F4I A;  2BWB A;  1Q02 A;  1VEK A;  2KNZ A;  1VDL A;  1AIP C;  2H5X A;  1WGN A;  1MN3 A;  2EKK A;  3F92 A;  2G3Q A;  2DAM A;  2DHY A;  2QHO B;  2OOA A;  4Q7J A;  3LCV B;  2JZ0 A;  2OO9 A;  1HT1 E;  2DAK A;  2DAI A;  1T6O A;  4F2L A;  2DKL A;  1BVS A;  4DBG B;  2HAK A;  1Y8G A;  2DNA A;  2QNJ A;  2L4F A;  1WIV A;  3E46 A;  2LVN C;  1UFZ A;  1EFU B;  2BWE A;  1YLA A;  2JZ1 A;  3FE3 A;  1NV8 A;  2K0B X;  1G3I A;  1ZMU A;  4WP2 A;  2L4E A;  1ZMW A;  2LVP C;  2RRU A;  1IFY A;  3IHP A;  3MMP A;  1VEG A;  2JNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...