2DI4A

Crystal structure of the ftsh protease domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
176
Chain Sequence
b'TISPKEKEKIAIHEAGHALMGLVSDDDDKVHKISIIKHIYDKKDLYNKILVLLGGRAAEEVFFGKDGITTGAENDLQRATDLAYRMVSMWGMSDKVGPIAIRRTAVDTSPDLLREIDEEVKRIITEQYEKAKAIVEEYKEPLKAVVKKLLEKETITCEEFVEVFKLYGIELKDKCK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division protein ftsH homolog
publication title Structure of the Whole Cytosolic Region of ATP-Dependent Protease FtsH
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 59
structure length 176
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2006-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01434 Peptidase_M41 Peptidase family M41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.760 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2di4A00
4EIWA 2CEAA 2CE7A 2DI4A 2DHRA 4WW0A 4Z8XA 3KDSE
chains in the Genus database with same CATH superfamily
2W2UA 3I9YA 3ZYMA 3HR0A 4TZ4C 1KF6A 2V7KA 3UT5E 1YXRA 3P7IA 5JR9A 4I43B 3AE6A 4DO0A 2CMRA 2XUEA 5LHIB 3W15B 4DUYT 5AQMB 1SUMB 1ZHCA 4DBQA 3SOLA 4IDPA 5TAOA 2XJ7A 2LSIA 2B1EA 5A1LA 1VCTA 3OVUA 3ZSSA 5BMVE 5F3JA 2XPKA 3C64A 3RIUC 4GK0E 2OA5A 5AQLB 3LFMA 3P4SA 3P8CD 2YN6A 4QH4A 5FKYA 4JI1T 4DBRA 1YKEB 3RRWA 3CPZA 5E0OA 1IBLT 4BJNA 4HKAA 2WS3A 3KV4A 2C5KT 4ISSA 4H9PC 1NWMX 3FZHB 1AJ3A 3O4XE 2WMOA 5J2TE 4JI6T 4E7SA 3UU3A 4LMKA 4O4LE 4U7YA 3WAKA 2V26A 5ABGA 2BG9A 1JNRA 2C5JA 3DTOA 4JYAT 4OYJA 2FJEA 1D0YA 2LSGA 3HKDE 2UXCT 1HF8A 2X0LB 3FHNA 4U2ZA 3ESLA 3ONJA 2WB5A 4PK5A 4GKKT 3HKCE 3N9PA 2VKHA 3UTKA 1D1BA 4HFIA 3MZKB 2XQ3A 3ZT6A 4JI3T 5AQUB 2Y8DA 2W00A 3L8RA 2CM0A 2E5LT 3AE8A 3RKOA 2H7OA 2I59A 2KINB 4HE8A 2W61A 4X20E 2WZHA 3K3NA 3JAFA 5KX5E 2LRLA 2M6IA 1D1AA 3K1SA 3BQIA 2D0TA 2MTQA 1HR0T 2CHOA 1XDPA 3V5SA 3RH3A 5CA0E 4L0RA 1U5PA 5HXSA 2I6HA 4JI8T 5LG3A 2QYWA 4AQGA 2PG8A 2XQ7A 1IZNB 1HCIA 1KNRA 2CHNA 4MBQA 3RYCE 3N9LA 3EUHA 4DV2T 1R8IA 2CXDA 4MALA 1FIOA 4FJOA 2YK0A 3TLSA 2FBWA 5LMUT 4TWHA 3PUGA 5JDGA 1MMDA 2CLYB 4H63V 3P4PA 3FZMB 2JQKA 4U3CA 4IE7A 2V8SV 3AECA 4ASKA 5L2LA 3AE3A 1HX8A 2LHRA 4M1PA 2DI4A 3C98B 2YDQA 3GA8A 3FZFB 4YSZA 4QXHB 4DV6T 4LF7T 3AAAB 2BKPA 1HNXT 1DU2A 2ZMAA 1HNZT 5L3CB 4UEMA 4QXBB 3Q2MA 1YQ3A 5EK4A 2R6GF 4ILBA 1MIWA 2A3DA 3ANWB 2JJ9A 2IC9A 4PAGA 2UUBT 3KV5A 2V7LA 2BDEA 3PUSA 3TKLB 2HH7A 5LNKA 2LKHA 3ZCJA 4I4TE 2IIUA 2AE9A 5DJQC 4BA9A 4X1IE 2Y48B 5FXVA 5FP3A 5FYMA 1ZKEA 3PJAA 3RYIE 3NRXA 3VHLA 4Q25A 1M7KA 2ZM8A 3G06A 1UURA 5HXRA 3ZYLA 5LG4A 3C4ZA 2KSRA 5H6QB 2UXDT 2LKGA 3I9WA 4HFVA 2E9XC 2DNXA 2BVMA 4CXYA 3SWHA 1MMAA 3D0TA 2H89A 4IE5A 3PUQA 3PUWF 4ANJA 3VR8A 4ZI2D 4OYKA 3AXJA 1XWMA 1S35A 3FZKB 1HNWT 1N36T 1H7CA 3F2EA 5CGMA 2X9YA 3J7Yq 3TLVA 3O9XA 2W4XA 4ILAA 4DR3T 3VRAA 2JIWA 4GYRA 5AQPB 3EVYA 4ZI7E 4ZXLA 4PNIA 4AKGA 3CIRA 3Q5WA 4O4JE 5EK2A 1HFAA 4NPPA 3BQKA 5DABA 4LFCT 4QX7B 4QXCB 4ZI3D 1MMNA 2VASA 3MKDA 5AQNB 3OJAA 2NP9A 5HXHA 3MACA 4OK0A 2E9XB 2NW9A 4JEUB 3N9OA 2BBHA 3LDQB 4ZZCA 2ACZA 3OPCA 4U72A 3ZYKA 3UUBA 2W0GA 4DUZT 4PFOA 3NRYA 1YKHB 2YINA 2WSSV 3KVAA 4UF0B 3QB5A 2WBLA 1ZOYA 2OLTA 3K3QC 4H9RC 2A72A 4MHCA 5J1GA 4UELA 2MAWA 3UU8A 1MMGA 3N2GE 5LGNB 1SE7A 3I0OA 2YEVC 5IUXA 3AE5A 3ZMZB 3P4WA 3B57A 2XSBA 1OXZA 4IDZA 5LGTB 3K8PC 5ABFB 3ZC1A 3KBUA 1Z0PA 4YHHT 5C8YE 3AAIA 2WMNA 2CCQA 2JMKA 4CN4A 4L5GA 5HXEA 2VURA 4YTPA 4AQFA 3EDUA 3AAEB 4NIQA 5LB7B 3T1YT 5JDLA 1US7B 3AE1A 4H9QC 3ETVA 5IYZE 3AEDA 1UX5A 5HWYA 2XM1A 3OTOT 1IAPA 2H3RA 5L4HA 3MJXA 3T1HT 4B3TT 3TLTA 5LJMA 2QA7A 4ZI2C 4G63A 1XNRT 2D5UA 3EAMA 2WM9A 3VKGA 2VKDA 4I55E 4JI5T 4X65T 3ZSTA 2Z6EA 2FJAA 4Z90A 4AISA 5HEGA 4UV9B 5CB4E 4HWCA 3RC8A 5JREA 3GN5B 2V1DB 2CEAA 4BJMA 4EB6E 1B7TA 2VQET 3MXZA 1W09A 4U7IA 2XQYA 2WDQA 1QLBA 2LOSA 4CN6A 2RP4A 2K3WA 4NXNT 2A2FX 4QH1A 5ABEA 3RIFA 3CX7B 3VRBA 3PUXF 3ZN0B 2RA1A 2W63A 2BS3A 2CE7A 3ZJ2A 2DWGA 4U31A 2WCAA 5FY7A 2V5DA 4F8HA 4HEAA 3UULA 2ZM0A 1OWAA 2WWVA 5JR9C 1MNEA 2XASB 3GMIA 4GOUA 3VU7H 4WZXA 2V7JA 4YY3T 3UFEA 1ZEEA 1BR4A 4G2AA 2V6YA 4UVAB 2WU2A 3LSVA 1SA0E 1WYBA 2K9AA 5FXXA 4DR2T 4X1YE 1YD8G 3VKHA 3ZT5A 4H9OC 4ZEYA 3AE4A 1CHUA 2BS2A 4PJMA 2XAQB 2WAUA 5AQTB 5JQGE 3H37A 3MK7C 5FVLA 3HKEE 4EOZB 4HWHA 2VVSA 4WBNE 2LM9A 3CX6B 2CLYC 5FY0A 4CI2B 2XQ5A 2W66A 4LMLA 5FVKA 4X64T 2NW8A 4H63H 2H88A 1T8BA 2K48A 1IJ5A 2KZ7B 4IE6A 5HEUA 3CKDA 1BR1A 2ES0A 2CWOA 2WQYA 2CRBA 5FXZA 4WBOA 4IE0A 2A9UA 4DR5T 1UCUA 4DR6T 5LA6E 1L0VA 2Q9QD 5AQFB 1MIVA 5JR9B 4QKNA 3ZMTB 2PJQA 3RIAA 3RQWA 4EAHA 2QGSA 3S4UA 2P9BA 3NZQA 4EYUA 5HEJA 5LHHB 4ISTA 5LMNT 1FMWA 2LM2A 1KEYA 3ZCIA 2DCFA 1J5ET 2K24A 1T7SA 5JVDE 4AIUA 4IREA 2VVNA 1N32T 5FNVE 3KFWX 4B6XA 4U33A 2F4VT 2WY2A 4IHJE 3C4WA 2V5CA 2BG9E 5EK3A 2DL1A 5HEOA 4HWIB 2BVLA 1FJGT 3RGLA 5AQGB 2WDVA 3CQCB 2LJLA 5DQVA 4QWNB 3RX6A 2XAGB 1SHZC 2VKJA 1O3XA 4AKRB 5H6RB 5L4EA 3EHZA 3VR9A 3QUJA 3FBLA 2GK9A 2BG9B 5HCJA 1YQ4A 3TLUA 5J2UE 3AVRA 3AEFA 1IJ6A 4O8SA 3C50A 4TV8E 2J4GA 4ERRA 4JLEA 4H9NC 1E1HB 2PFVA 2X9WA 3LK2B 3O1IA 5FL0A 2EHOD 3NBXX 1FEWA 3UQ7A 3ABVA 3X1DA 4PFPA 2DWKA 3LBXA 4X5TA 4IL4A 5KDMC 2D9DA 4O4HE 4CN1A 3AA7B 3AB3B 5LOVE 2XQAA 1ZP0A 2Q9QA 3IEEA 4GKJT 3AEAA 1W0BA 2YDSA 3RLFF 4KMCA 2CBJA 5FL1A 1OEDA 3E22E 4KP3C 1NAFA 3H3AA 4QH5A 4PJJA 3HI2A 3ZKRA 3LK3B 4LF8T 2HHHT 5JRCA 4OHFA 4YFSA 2JQHA 3FXDB 4Z8XA 4EYYR 3A7MA 3PE0A 1VRBA 4E7ZA 1XMQT 1M62A 2CXFA 4QHOA 2UXBT 1VOMA 4EV6A 5L3BB 3KV6A 3QC9A 4TN7B 4TX5A 3UQ4A 5JDHA 2UUAT 4H9SE 2LLYA 1WLXA 3AEEA 2XQ8A 3JC6D 4MLKA 3B13A 2XZEA 3JCFA 4U2YA 1LVKA 2BKOA 2IMLA 1JNZA 4B3ST 3WI3A 4I50E 2KWHA 1LVFA 1WRDA 3MA9A 1HS7A 4YSXA 3KDSE 2WP9A 1NENA 3PUZF 3L3PA 3LG7A 2M6BA 1UUSA 3AE9A 5LCYA 1HG5A 4CXXA 2IC6A 1EZ3A 2VL8A 3CK6A 3DJBA 2EHOA 4CI3B 1OEDE 3ZMUB 3UU6A 3RI5A 4P0BA 2CBIA 3OYZA 4P0AA 2HN1A 2K5BB 3ZEFB 2HPJA 4HTEA 4NUVA 2JMHA 1S94A 4KBMB 4F6RC 3SFEA 5LBMA 4TNVA 4LF4T 3F57A 3ZLIA 4DV4T 3M3ZB 2IDOB 4L9IA 5CA1E 1CUNA 3JADA 3OKQA 4DV7T 3HKBE 1N34T 4LFBT 2ZLYA 3GWHA 3LJCA 4NXMT 4UVBB 1LKXA 4UV8B 3A8YC 4EGWA 2ZM6T 5HYAA 2NR4A 3WAJA 2WDRA 3PTRB 5L3FB 3BK9A 2DHRA 3N2KE 5AQVB 3UFGA 1Z8UA 3RC3A 4C90A 2HPLA 4ZOLE 4EEDA 2JRKA 3CX8B 1ZV4X 4X62T 3UU4A 3UUXB 2CWYA 4YTMA 2V7IA 2L9QA 3AE7A 4V1Av 4AKLA 2LRKA 3R6NA 5AQHB 5AQRB 3AXJB 5FY1A 4QX8B 3IHRA 5LHGB 4PW8A 5DQWA 4AKHA 4Z91A 2PTFA 3P50A 3EABA 3K3OA 3AE2A 3OYXA 5AQQB 2J47A 2LSJA 2J62A 2V7MA 5IWAT 4JI0T 1W9RA 2VKOA 4WYVA 1D0ZA 1KNZA 1Y01A 2ACXA 4IDOA 5L47A 3P4QA 3KBTA 4DVDA 3U78A 2BKNA 2BBJA 4JEHB 3Q9DA 2NTXA 3C4XA 2E8IA 4CQIA 2X68A 2YU1A 3CMLA 1E2AA 2RPAA 4CI1B 4AQFC 4N78D 4EZ4A 1D0XA 2YDRA 4COFA 3Q5XA 3RIUA 4JI7T 2ZM2A 5JTGA 3ETUA 3E0ZA 4C91A 2XAJB 2KMFA 5JDQA 4UR9A 2X51A 2D2SA 5M4YA 3ZMSB 2LOPA 2E2AA 1VCSA 2XSAA 5LYJE 4JV5T 4ZI3C 5AQOB 4CZZB 3I0QA 3V5UA 2N1GA 3N9NA 3U3IA 1WYCA 4DNDA 5C2TA 2MBGA 5ETWA 3Q5DA 1BR2A 2KT9A 4A98A 2SPCA 4TV9E 5AQIB 2H7VC 4TNWA 2KXPB 5L3GB 3A5XA 3NZPA 3ZPOA 4YXDA 2LT3A 5KMGP 2LSYA 3QK6A 3RRCA 3KVBA 3OBVE 3ONXA 4A56A 5HCMA 2JQQA 2LSKA 4KX6A 3AA1B 2WZIA 1W0AA 2X66A 4DMWA 2UXNB 4HFEA 5AQKB 2KWIB 3IA3A 1WFDA 1XZYA 1UK5A 1QSDA 3PUVF 4XBFB 2W67A 3CQGB 4JBWF 2X0HA 3Q5EA 3CVRA 4IDQA 4HN9A 4ILCA 3M65A 3ANWA 3O1HA 2BZBA 4YJ2E 3R84B 2L3LA 5ABHA 2VQFT 2KLQA 4J2CA 4TWFA 2BG9C 4EXTA 5JDNA 4ZHQE 3EI0A 4AQYT 2MPKA 2VWAA 4ILUA 4LFAT 5LGUB 5AFUL 4KHZF 1T72A 1X79A 3DP7A 1MNDA 2E9XD 2ODUA 2KNDA 3NWIA 5L3DB 3QOFA 1J1JA 5JH7E 2LE8A 4DR7T 4K0KT 4FI5A 5IHYA 4LF5T 4CXWA 4BAYB 4HWDA 5HAXA 4KUMB 2WWUA 4IT4A 4U74A 4JI2T 4ZZBA 3FXEB 3KV9A 2X67A 3ZT7A 3RQUA 3NKZA 5LXTE 2PBIA 4O4IE 2UU9T 3J9X1 2V6YB 2I0MA 2XQ4A 1NEKA 3PU3A 2JQ9A 3HL6A 3RYFE 1IBKT 3N9QA 4IGUA 5FMNA 5KXJA 4LF9T 3RPUA 4YT0A 1YW0A 1BR0A 2UUCT 4OX9T 1WCRA 2XQ9A 2FJDA 4DV0T 2MOZA 3ZN1B 5HWXA 1UX4A 2IHR1 3RHWA 3ZJ1A 3P4RA 2FJBA 2NWBA 4EZHA 3PDYA 3PUAA 4B3RT 3IBPA 4EEBA 4P1NA 3QB5K 3O1JA 2AXDS 5AQJB 4EIWA 2NOXA 3F31A 2X0YA 3E08A 2X9XA 4IIJE 1HX1B 4I0UA 2E9XA 1I6ZA 1XMOT 3PUYF 2ODVA 3UUNA 2NTYA 3AEBA 3FZLB 4MFRA 4UF0A 3UUMA 2XAHB 2UXXB 4ZS3A 5EZYE 2XAFB 4UIGA 4DV5T 3PU8A 2Q9QC 2VK9A 4A97A 2VB6A 3AA6B 4HFHA 3AVSA 4KHPT 3TLWA 1OEDC 4IL9A 3N2OA 2X9HA 5BR8T 1XNQT 5J0ZA 2XY8B 5F8PA 4PJNA 3SS1A 4HFCA 5L3EB 5LJNA 3SFDA 2XQ6A 3RF1A 5HXCA 3C51A 2FUPA 4B3MT 5ABFA 2YU2A 4ADZA 1MIYA 5JDMA 4A5XA 2W62A 3ONLC 2M67A 3N9MA 3QNUA 3IF8B 3LK42 1LRZA 5GONE 1KNPA 4GK5E 4UVCB 4GIWA 2V6XA 4X66T 4DV1T 1G8XA 4ZS2A 1IBMT 2CXLA 2Y6XA 3I1AA 5FXWA 2VL0A 3LBXB 1GQEA 5CJ5A 3RYHE 1V9DA 3FB2A 4GYSA 1G73A 2Q9QB 3CQXC 4PK6A 3L09A 3SRZA 3ZMVB 3BQLA 1OEDB 2JPFA 3FBZA 4HGAA 2QRXA 2HN2A 4AI6A 4PK4A 3H3MA 4LF6T 5JRCB 4O2AE 4AXPA 4X1KE 5LBQB 2EHOC 4YSYA 3GN5A 2WU5A 4HFBA 2LEHA 1FMVA 2C0SA 2NW7A 5HEHA 2XTLA 2IUBA 4UXNB 4TUYE 1J5WA 1D1CA 1WR6A 4WW0A 1QUUA 2G0UA 2B76A 3NVOA 4TWDA 4JUYA 5ADXL 4PJLA 3AA0B 2YKSA 2DLRA 4OFZA 2XHEB 4HWFA 4K0UA 3PV0F 1UGOA 1HG2A 4YLHA 3ZC0A 3T8OA 4XAXB 3B5MA 2D0UA 1XDOA 2IAKA 2N9DA 1I94T 2CA5A 4DV3T 4YHJA 5CFBA 5F5WA 2QVAA 4JI4T 4WNKA 1U4QA 3HA4A 4IDNA 4DR1T 3PURA 4IE4A 2N2NA 4YJ3E 5AQSB 5C3JA 3JC6C 1E7PA 4AKIA 2L8KA 1T98A 3RKGA 1KFYA 1Y64B 2J1DG 3EDVA 4DIDB 1KK7A 2XM2A 3KINB 3JAEA 2EHOB 2LHNA 4P09A 4HFDA 2BS4A 2YOEA 1HTJF 3CWZB 1WR0A 1N33T 3L39A 2IW5B 4DMVA 4NUUA 2CPTA 2OV9A 4LMJA 4KI0F 2C5IT 3UU5A 3N5LA 5LP6E 1X9BA 2MYSA 4XZCA 3PJAJ 2E5VA 3AEGA 5JDFA 4DR4T 4YTNA 4O2BE
chains in the Genus database with same CATH topology
5LGUB 4KP3C 4OK0A 3I9YA 1NAFA 3H3AA 5AFUL 2E9XB 4PJJA 2NW9A 3ZYMA 3HI2A 3HR0A 4JEUB 3LK3B 1X79A 4TZ4C 2V7KA 3N9OA 3UT5E 5JRCA 4OHFA 4YFSA 3P7IA 3FXDB 5JR9A 3DP7A 4Z8XA 4EYYR 4U72A 3ZYKA 5J2TE 3PE0A 2W0GA 1VRBA 4I43B 4E7ZA 4PFOA 1MNDA 2CMRA 2E9XD 4DO0A 2XUEA 3NRYA 1YKHB 2YINA 2WSSV 3KVAA 5LHIB 4UF0B 2ODUA 3W15B 2CXFA 4QHOA 2WBLA 1VOMA 2KNDA 5L3BB 3KV6A 3QC9A 1ZHCA 4TN7B 4TX5A 4DBQA 3SOLA 5L3DB 5TAOA 3K3QC 5JDHA 2LSIA 2B1EA 5A1LA 5JH7E 2LE8A 4H9SE 5BMVE 5F3JA 4H9RC 2A72A 4MHCA 5J1GA 4FI5A 4UELA 3C64A 1WLXA 1MMGA 3N2GE 4GK0E 5LGNB 5IHYA 3JC6D 2OA5A 4BAYB 4CXWA 3I0OA 3LFMA 2YEVC 4MLKA 5HAXA 4KUMB 3P8CD 3B13A 2WWUA 4U74A 3ZMZB 4DBRA 3B57A 1YKEB 3FXEB 1OXZA 3KV9A 2X67A 4IDZA 3RRWA 5LGTB 3CPZA 1LVKA 5E0OA 3K8PC 5LXTE 4BJNA 4HKAA 3ZC1A 2PBIA 4O4IE 3KV4A 3J9X1 2C5KT 1Z0PA 3KBUA 4ISSA 4H9PC 1NWMX 3PU3A 4I50E 3WI3A 1AJ3A 2KWHA 5C8YE 3O4XE 1LVFA 2WMOA 1WRDA 2WMNA 2CCQA 3AAIA 3HL6A 2JMKA 3MA9A 4L5GA 4E7SA 5HXEA 1HS7A 3KDSE 3RYFE 3N9QA 4IGUA 4AQFA 5FMNA 3EDUA 3L3PA 3AAEB 4O4LE 3RPUA 3LG7A 3WAKA 2V26A 1YW0A 5LCYA 1BR0A 1HG5A 2C5JA 4CXXA 2IC6A 1US7B 3DTOA 5JDLA 4H9QC 1EZ3A 2MOZA 3ETVA 4OYJA 2VL8A 5IYZE 3ZN1B 3DJBA 1D0YA 2EHOA 2LSGA 5HWXA 1UX4A 1UX5A 4CI3B 5HWYA 3ZMUB 3HKDE 4P0BA 1HF8A 2X0LB 3FHNA 3OYZA 4P0AA 3ESLA 1IAPA 2H3RA 4PK5A 3MJXA 3HKCE 3N9PA 2VKHA 2K5BB 3UTKA 1D1BA 3MZKB 3ZJ1A 5LJMA 3ZEFB 2QA7A 4ZI2C 4G63A 2D5UA 2HPJA 2WM9A 3VKGA 2VKDA 4I55E 4HTEA 4NUVA 2Y8DA 2NWBA 2JMHA 4EZHA 2W00A 2CM0A 2Z6EA 3PDYA 3PUAA 3IBPA 3RKOA 2H7OA 1S94A 2I59A 4KBMB 4UV9B 2KINB 5CB4E 4HE8A 2W61A 4F6RC 3O1JA 4X20E 4EIWA 2NOXA 5LBMA 3K3NA 3F31A 3RC8A 3E08A 5KX5E 2X9XA 5JREA 4IIJE 3GN5B 1D1AA 2V1DB 2E9XA 2CEAA 4BJMA 4EB6E 3BQIA 1B7TA 2D0TA 2MTQA 3F57A 3MXZA 3ZLIA 2ODVA 3UUNA 2XQYA 4L9IA 2NTYA 2LOSA 5CA1E 1CUNA 2RP4A 3V5SA 3RH3A 5CA0E 4L0RA 2A2FX 1U5PA 4MFRA 5HXSA 3OKQA 4UF0A 3UUMA 2XAHB 3HKBE 4AQGA 3CX7B 2PG8A 2UXXB 4ZS3A 5EZYE 2ZLYA 2XAFB 4UIGA 3ZN0B 3GWHA 2RA1A 2W63A 3PU8A 2Q9QC 1IZNB 3LJCA 1HCIA 2VK9A 4UVBB 2CE7A 1LKXA 4MBQA 4UV8B 3AA6B 2VB6A 3RYCE 5HYAA 3ZJ2A 3AVSA 3N9LA 2DWGA 3PTRB 3WAJA 5L3FB 3EUHA 3BK9A 5FY7A 2CXDA 4MALA 2DHRA 3N2KE 3N2OA 1FIOA 2X9HA 4FJOA 4HEAA 3UULA 2ZM0A 2YK0A 3RC3A 5F8PA 4C90A 1OWAA 2HPLA 4PJNA 3SS1A 4ZOLE 5L3EB 3PUGA 2JRKA 1MMDA 5JDGA 2CLYB 1MNEA 4H63V 5JR9C 5LJNA 2XASB 3CX8B 3GMIA 4GOUA 1ZV4X 5HXCA 4IE7A 3C51A 3VU7H 2V7JA 3UUXB 2CWYA 3UFEA 1ZEEA 2V7IA 2L9QA 4ASKA 2YU2A 5L2LA 1BR4A 4V1Av 4AKLA 4G2AA 4ADZA 3R6NA 1MIYA 4UVAB 5JDMA 1HX8A 2LHRA 2W62A 5FY1A 1SA0E 1WYBA 2M67A 2K9AA 3N9MA 4M1PA 5FXXA 2DI4A 3IF8B 4X1YE 3C98B 1YD8G 3VKHA 3LK42 4QX8B 3IHRA 3GA8A 1LRZA 5LHGB 4H9OC 4PW8A 5DQWA 5GONE 4AKHA 3K3OA 4GK5E 4UVCB 4QXHB 4GIWA 4PJMA 3OYXA 2XAQB 3AAAB 2LSJA 2WAUA 5JQGE 3H37A 2V7MA 1G8XA 3MK7C 3HKEE 4EOZB 2VKOA 4WBNE 2LM9A 3CX6B 4ZS2A 2ZMAA 1D0ZA 2CLYC 2CXLA 5FY0A 5L3CB 4UEMA 1KNZA 2Y6XA 2ACXA 4CI2B 3I1AA 5FXWA 4QXBB 3Q2MA 3KBTA 5EK4A 4DVDA 1MIWA 3U78A 3LBXB 2NW8A 4H63H 2A3DA 3ANWB 2JJ9A 3RYHE 2IC9A 4JEHB 3Q9DA 2NTXA 3C4XA 4PAGA 1V9DA 2E8IA 1IJ5A 2K48A 2KZ7B 3FB2A 4IE6A 3KV5A 4CQIA 4GYSA 2X68A 1G73A 2Q9QB 2YU1A 3CMLA 3CQXC 3CKDA 1BR1A 2V7LA 4CI1B 4AQFC 2BDEA 4PK6A 3PUSA 3TKLB 2ES0A 3L09A 2CWOA 2HH7A 5LNKA 4N78D 4EZ4A 3SRZA 3ZMVB 3BQLA 5FXZA 3ZCJA 2JPFA 3FBZA 4WBOA 1D0XA 4HGAA 4IE0A 4I4TE 3Q5XA 4AI6A 1UCUA 5LA6E 4PK4A 2ZM2A 3ETUA 3E0ZA 2Q9QD 4C91A 2XAJB 2KMFA 5JRCB 5JDQA 1MIVA 4O2AE 5DJQC 4BA9A 4X1IE 5JR9B 4AXPA 4X1KE 2Y48B 4QKNA 2EHOC 5LBQB 3ZMTB 2PJQA 3GN5A 2X51A 2D2SA 5M4YA 5FXVA 2LEHA 5FP3A 1FMVA 2C0SA 3ZMSB 2NW7A 5FYMA 2QGSA 4EAHA 2LOPA 1ZKEA 2XTLA 3S4UA 2P9BA 3NZQA 5LYJE 4UXNB 4TUYE 4ZI3C 4EYUA 1D1CA 3RYIE 5LHHB 4CZZB 4ISTA 1WR6A 3I0QA 3NRXA 4WW0A 1QUUA 2G0UA 1FMWA 3V5UA 3ZCIA 2DCFA 4JUYA 3VHLA 2K24A 5ADXL 4PJLA 3AA0B 5JVDE 2ZM8A 2DLRA 2N1GA 3N9NA 4OFZA 3U3IA 2XHEB 5HXRA 1WYCA 3ZYLA 5LG4A 3C4ZA 4DNDA 5FNVE 2MBGA 3KFWX 5H6QB 4K0UA 4B6XA 5ETWA 1HG2A 4YLHA 3I9WA 1BR2A 4HFVA 2KT9A 3C4WA 4IHJE 3ZC0A 3T8OA 5EK3A 4XAXB 2SPCA 2E9XC 2DNXA 2D0UA 4TV9E 2BVMA 4CXYA 3SWHA 2H7VC 2BVLA 1MMAA 2IAKA 2N9DA 2KXPB 3D0TA 2CA5A 4IE5A 4YHJA 3PUQA 3CQCB 5L3GB 2LJLA 3A5XA 3NZPA 5DQVA 3ZPOA 4ANJA 2LT3A 4QWNB 4WNKA 5KMGP 2LSYA 1U4QA 3RX6A 2XAGB 1SHZC 2VKJA 3QK6A 1O3XA 3HA4A 5H6RB 3RRCA 4AKRB 3PURA 3KVBA 4IE4A 2N2NA 3OBVE 4YJ3E 3QUJA 4ZI2D 3ONXA 4A56A 2JQQA 4OYKA 2LSKA 3FBLA 3JC6C 1S35A 4AKIA 2GK9A 2L8KA 1H7CA 3F2EA 1T98A 1Y64B 5J2UE 2X9YA 3AA1B 3AVRA 3J7Yq 2J1DG 3EDVA 2X66A 3O9XA 4DMWA 1KK7A 3KINB 4GYRA 1IJ6A 2EHOB 2UXNB 2LHNA 4O8SA 2KWIB 3C50A 4P09A 4TV8E 4ERRA 1HTJF 3EVYA 4JLEA 3CWZB 4H9NC 1QSDA 1E1HB 4ZI7E 4PNIA 4AKGA 3Q5WA 4XBFB 4O4JE 2PFVA 2X9WA 1HFAA 5EK2A 3LK2B 2IW5B 3O1IA 2EHOD 3CQGB 1FEWA 3NBXX 4NUUA 4DMVA 4PFPA 3CVRA 3BQKA 5DABA 2DWKA 3LBXA 4HN9A 3M65A 5KDMC 2C5IT 3ANWA 4QX7B 3O1HA 4O4HE 2BZBA 4QXCB 3N5LA 3R84B 3AA7B 4YJ2E 5LP6E 3AB3B 4ZI3D 5LOVE 2MYSA 2L3LA 4XZCA 2KLQA 4J2CA 2Q9QA 3IEEA 1MMNA 4EXTA 5JDNA 2VASA 4ZHQE 3MKDA 4KMCA 3OJAA 2VWAA 5JDFA 4ILUA 2NP9A 4O2BE 5HXHA 3E22E 3MACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EIW A;  2CEA A;  2CE7 A;  2DI4 A;  2DHR A;  4WW0 A;  4Z8X A;  3KDS E; 
#chains in the Genus database with same CATH topology
 2W2U A;  3I9Y A;  3ZYM A;  3HR0 A;  4TZ4 C;  1KF6 A;  2V7K A;  3UT5 E;  1YXR A;  3P7I A;  5JR9 A;  4I43 B;  3AE6 A;  4DO0 A;  2CMR A;  2XUE A;  5LHI B;  3W15 B;  4DUY T;  5AQM B;  1SUM B;  1ZHC A;  4DBQ A;  3SOL A;  4IDP A;  5TAO A;  2XJ7 A;  2LSI A;  2B1E A;  5A1L A;  1VCT A;  3OVU A;  3ZSS A;  5BMV E;  5F3J A;  2XPK A;  3C64 A;  3RIU C;  4GK0 E;  2OA5 A;  5AQL B;  3LFM A;  3P4S A;  3P8C D;  2YN6 A;  4QH4 A;  5FKY A;  4JI1 T;  4DBR A;  1YKE B;  3RRW A;  3CPZ A;  5E0O A;  1IBL T;  4BJN A;  4HKA A;  2WS3 A;  3KV4 A;  2C5K T;  4ISS A;  4H9P C;  1NWM X;  3FZH B;  1AJ3 A;  3O4X E;  2WMO A;  5J2T E;  4JI6 T;  4E7S A;  3UU3 A;  4LMK A;  4O4L E;  4U7Y A;  3WAK A;  2V26 A;  5ABG A;  2BG9 A;  1JNR A;  2C5J A;  3DTO A;  4JYA T;  4OYJ A;  2FJE A;  1D0Y A;  2LSG A;  3HKD E;  2UXC T;  1HF8 A;  2X0L B;  3FHN A;  4U2Z A;  3ESL A;  3ONJ A;  2WB5 A;  4PK5 A;  4GKK T;  3HKC E;  3N9P A;  2VKH A;  3UTK A;  1D1B A;  4HFI A;  3MZK B;  2XQ3 A;  3ZT6 A;  4JI3 T;  5AQU B;  2Y8D A;  2W00 A;  3L8R A;  2CM0 A;  2E5L T;  3AE8 A;  3RKO A;  2H7O A;  2I59 A;  2KIN B;  4HE8 A;  2W61 A;  4X20 E;  2WZH A;  3K3N A;  3JAF A;  5KX5 E;  2LRL A;  2M6I A;  1D1A A;  3K1S A;  3BQI A;  2D0T A;  2MTQ A;  1HR0 T;  2CHO A;  1XDP A;  3V5S A;  3RH3 A;  5CA0 E;  4L0R A;  1U5P A;  5HXS A;  2I6H A;  4JI8 T;  5LG3 A;  2QYW A;  4AQG A;  2PG8 A;  2XQ7 A;  1IZN B;  1HCI A;  1KNR A;  2CHN A;  4MBQ A;  3RYC E;  3N9L A;  3EUH A;  4DV2 T;  1R8I A;  2CXD A;  4MAL A;  1FIO A;  4FJO A;  2YK0 A;  3TLS A;  2FBW A;  5LMU T;  4TWH A;  3PUG A;  5JDG A;  1MMD A;  2CLY B;  4H63 V;  3P4P A;  3FZM B;  2JQK A;  4U3C A;  4IE7 A;  2V8S V;  3AEC A;  4ASK A;  5L2L A;  3AE3 A;  1HX8 A;  2LHR A;  4M1P A;  2DI4 A;  3C98 B;  2YDQ A;  3GA8 A;  3FZF B;  4YSZ A;  4QXH B;  4DV6 T;  4LF7 T;  3AAA B;  2BKP A;  1HNX T;  1DU2 A;  2ZMA A;  1HNZ T;  5L3C B;  4UEM A;  4QXB B;  3Q2M A;  1YQ3 A;  5EK4 A;  2R6G F;  4ILB A;  1MIW A;  2A3D A;  3ANW B;  2JJ9 A;  2IC9 A;  4PAG A;  2UUB T;  3KV5 A;  2V7L A;  2BDE A;  3PUS A;  3TKL B;  2HH7 A;  5LNK A;  2LKH A;  3ZCJ A;  4I4T E;  2IIU A;  2AE9 A;  5DJQ C;  4BA9 A;  4X1I E;  2Y48 B;  5FXV A;  5FP3 A;  5FYM A;  1ZKE A;  3PJA A;  3RYI E;  3NRX A;  3VHL A;  4Q25 A;  1M7K A;  2ZM8 A;  3G06 A;  1UUR A;  5HXR A;  3ZYL A;  5LG4 A;  3C4Z A;  2KSR A;  5H6Q B;  2UXD T;  2LKG A;  3I9W A;  4HFV A;  2E9X C;  2DNX A;  2BVM A;  4CXY A;  3SWH A;  1MMA A;  3D0T A;  2H89 A;  4IE5 A;  3PUQ A;  3PUW F;  4ANJ A;  3VR8 A;  4ZI2 D;  4OYK A;  3AXJ A;  1XWM A;  1S35 A;  3FZK B;  1HNW T;  1N36 T;  1H7C A;  3F2E A;  5CGM A;  2X9Y A;  3J7Y q;  3TLV A;  3O9X A;  2W4X A;  4ILA A;  4DR3 T;  3VRA A;  2JIW A;  4GYR A;  5AQP B;  3EVY A;  4ZI7 E;  4ZXL A;  4PNI A;  4AKG A;  3CIR A;  3Q5W A;  4O4J E;  5EK2 A;  1HFA A;  4NPP A;  3BQK A;  5DAB A;  4LFC T;  4QX7 B;  4QXC B;  4ZI3 D;  1MMN A;  2VAS A;  3MKD A;  5AQN B;  3OJA A;  2NP9 A;  5HXH A;  3MAC A;  4OK0 A;  2E9X B;  2NW9 A;  4JEU B;  3N9O A;  2BBH A;  3LDQ B;  4ZZC A;  2ACZ A;  3OPC A;  4U72 A;  3ZYK A;  3UUB A;  2W0G A;  4DUZ T;  4PFO A;  3NRY A;  1YKH B;  2YIN A;  2WSS V;  3KVA A;  4UF0 B;  3QB5 A;  2WBL A;  1ZOY A;  2OLT A;  3K3Q C;  4H9R C;  2A72 A;  4MHC A;  5J1G A;  4UEL A;  2MAW A;  3UU8 A;  1MMG A;  3N2G E;  5LGN B;  1SE7 A;  3I0O A;  2YEV C;  5IUX A;  3AE5 A;  3ZMZ B;  3P4W A;  3B57 A;  2XSB A;  1OXZ A;  4IDZ A;  5LGT B;  3K8P C;  5ABF B;  3ZC1 A;  3KBU A;  1Z0P A;  4YHH T;  5C8Y E;  3AAI A;  2WMN A;  2CCQ A;  2JMK A;  4CN4 A;  4L5G A;  5HXE A;  2VUR A;  4YTP A;  4AQF A;  3EDU A;  3AAE B;  4NIQ A;  5LB7 B;  3T1Y T;  5JDL A;  1US7 B;  3AE1 A;  4H9Q C;  3ETV A;  5IYZ E;  3AED A;  1UX5 A;  5HWY A;  2XM1 A;  3OTO T;  1IAP A;  2H3R A;  5L4H A;  3MJX A;  3T1H T;  4B3T T;  3TLT A;  5LJM A;  2QA7 A;  4ZI2 C;  4G63 A;  1XNR T;  2D5U A;  3EAM A;  2WM9 A;  3VKG A;  2VKD A;  4I55 E;  4JI5 T;  4X65 T;  3ZST A;  2Z6E A;  2FJA A;  4Z90 A;  4AIS A;  5HEG A;  4UV9 B;  5CB4 E;  4HWC A;  3RC8 A;  5JRE A;  3GN5 B;  2V1D B;  2CEA A;  4BJM A;  4EB6 E;  1B7T A;  2VQE T;  3MXZ A;  1W09 A;  4U7I A;  2XQY A;  2WDQ A;  1QLB A;  2LOS A;  4CN6 A;  2RP4 A;  2K3W A;  4NXN T;  2A2F X;  4QH1 A;  5ABE A;  3RIF A;  3CX7 B;  3VRB A;  3PUX F;  3ZN0 B;  2RA1 A;  2W63 A;  2BS3 A;  2CE7 A;  3ZJ2 A;  2DWG A;  4U31 A;  2WCA A;  5FY7 A;  2V5D A;  4F8H A;  4HEA A;  3UUL A;  2ZM0 A;  1OWA A;  2WWV A;  5JR9 C;  1MNE A;  2XAS B;  3GMI A;  4GOU A;  3VU7 H;  4WZX A;  2V7J A;  4YY3 T;  3UFE A;  1ZEE A;  1BR4 A;  4G2A A;  2V6Y A;  4UVA B;  2WU2 A;  3LSV A;  1SA0 E;  1WYB A;  2K9A A;  5FXX A;  4DR2 T;  4X1Y E;  1YD8 G;  3VKH A;  3ZT5 A;  4H9O C;  4ZEY A;  3AE4 A;  1CHU A;  2BS2 A;  4PJM A;  2XAQ B;  2WAU A;  5AQT B;  5JQG E;  3H37 A;  3MK7 C;  5FVL A;  3HKE E;  4EOZ B;  4HWH A;  2VVS A;  4WBN E;  2LM9 A;  3CX6 B;  2CLY C;  5FY0 A;  4CI2 B;  2XQ5 A;  2W66 A;  4LML A;  5FVK A;  4X64 T;  2NW8 A;  4H63 H;  2H88 A;  1T8B A;  2K48 A;  1IJ5 A;  2KZ7 B;  4IE6 A;  5HEU A;  3CKD A;  1BR1 A;  2ES0 A;  2CWO A;  2WQY A;  2CRB A;  5FXZ A;  4WBO A;  4IE0 A;  2A9U A;  4DR5 T;  1UCU A;  4DR6 T;  5LA6 E;  1L0V A;  2Q9Q D;  5AQF B;  1MIV A;  5JR9 B;  4QKN A;  3ZMT B;  2PJQ A;  3RIA A;  3RQW A;  4EAH A;  2QGS A;  3S4U A;  2P9B A;  3NZQ A;  4EYU A;  5HEJ A;  5LHH B;  4IST A;  5LMN T;  1FMW A;  2LM2 A;  1KEY A;  3ZCI A;  2DCF A;  1J5E T;  2K24 A;  1T7S A;  5JVD E;  4AIU A;  4IRE A;  2VVN A;  1N32 T;  5FNV E;  3KFW X;  4B6X A;  4U33 A;  2F4V T;  2WY2 A;  4IHJ E;  3C4W A;  2V5C A;  2BG9 E;  5EK3 A;  2DL1 A;  5HEO A;  4HWI B;  2BVL A;  1FJG T;  3RGL A;  5AQG B;  2WDV A;  3CQC B;  2LJL A;  5DQV A;  4QWN B;  3RX6 A;  2XAG B;  1SHZ C;  2VKJ A;  1O3X A;  4AKR B;  5H6R B;  5L4E A;  3EHZ A;  3VR9 A;  3QUJ A;  3FBL A;  2GK9 A;  2BG9 B;  5HCJ A;  1YQ4 A;  3TLU A;  5J2U E;  3AVR A;  3AEF A;  1IJ6 A;  4O8S A;  3C50 A;  4TV8 E;  2J4G A;  4ERR A;  4JLE A;  4H9N C;  1E1H B;  2PFV A;  2X9W A;  3LK2 B;  3O1I A;  5FL0 A;  2EHO D;  3NBX X;  1FEW A;  3UQ7 A;  3ABV A;  3X1D A;  4PFP A;  2DWK A;  3LBX A;  4X5T A;  4IL4 A;  5KDM C;  2D9D A;  4O4H E;  4CN1 A;  3AA7 B;  3AB3 B;  5LOV E;  2XQA A;  1ZP0 A;  2Q9Q A;  3IEE A;  4GKJ T;  3AEA A;  1W0B A;  2YDS A;  3RLF F;  4KMC A;  2CBJ A;  5FL1 A;  1OED A;  3E22 E;  4KP3 C;  1NAF A;  3H3A A;  4QH5 A;  4PJJ A;  3HI2 A;  3ZKR A;  3LK3 B;  4LF8 T;  2HHH T;  5JRC A;  4OHF A;  4YFS A;  2JQH A;  3FXD B;  4Z8X A;  4EYY R;  3A7M A;  3PE0 A;  1VRB A;  4E7Z A;  1XMQ T;  1M62 A;  2CXF A;  4QHO A;  2UXB T;  1VOM A;  4EV6 A;  5L3B B;  3KV6 A;  3QC9 A;  4TN7 B;  4TX5 A;  3UQ4 A;  5JDH A;  2UUA T;  4H9S E;  2LLY A;  1WLX A;  3AEE A;  2XQ8 A;  3JC6 D;  4MLK A;  3B13 A;  2XZE A;  3JCF A;  4U2Y A;  1LVK A;  2BKO A;  2IML A;  1JNZ A;  4B3S T;  3WI3 A;  4I50 E;  2KWH A;  1LVF A;  1WRD A;  3MA9 A;  1HS7 A;  4YSX A;  3KDS E;  2WP9 A;  1NEN A;  3PUZ F;  3L3P A;  3LG7 A;  2M6B A;  1UUS A;  3AE9 A;  5LCY A;  1HG5 A;  4CXX A;  2IC6 A;  1EZ3 A;  2VL8 A;  3CK6 A;  3DJB A;  2EHO A;  4CI3 B;  1OED E;  3ZMU B;  3UU6 A;  3RI5 A;  4P0B A;  2CBI A;  3OYZ A;  4P0A A;  2HN1 A;  2K5B B;  3ZEF B;  2HPJ A;  4HTE A;  4NUV A;  2JMH A;  1S94 A;  4KBM B;  4F6R C;  3SFE A;  5LBM A;  4TNV A;  4LF4 T;  3F57 A;  3ZLI A;  4DV4 T;  3M3Z B;  2IDO B;  4L9I A;  5CA1 E;  1CUN A;  3JAD A;  3OKQ A;  4DV7 T;  3HKB E;  1N34 T;  4LFB T;  2ZLY A;  3GWH A;  3LJC A;  4NXM T;  4UVB B;  1LKX A;  4UV8 B;  3A8Y C;  4EGW A;  2ZM6 T;  5HYA A;  2NR4 A;  3WAJ A;  2WDR A;  3PTR B;  5L3F B;  3BK9 A;  2DHR A;  3N2K E;  5AQV B;  3UFG A;  1Z8U A;  3RC3 A;  4C90 A;  2HPL A;  4ZOL E;  4EED A;  2JRK A;  3CX8 B;  1ZV4 X;  4X62 T;  3UU4 A;  3UUX B;  2CWY A;  4YTM A;  2V7I A;  2L9Q A;  3AE7 A;  4V1A v;  4AKL A;  2LRK A;  3R6N A;  5AQH B;  5AQR B;  3AXJ B;  5FY1 A;  4QX8 B;  3IHR A;  5LHG B;  4PW8 A;  5DQW A;  4AKH A;  4Z91 A;  2PTF A;  3P50 A;  3EAB A;  3K3O A;  3AE2 A;  3OYX A;  5AQQ B;  2J47 A;  2LSJ A;  2J62 A;  2V7M A;  5IWA T;  4JI0 T;  1W9R A;  2VKO A;  4WYV A;  1D0Z A;  1KNZ A;  1Y01 A;  2ACX A;  4IDO A;  5L47 A;  3P4Q A;  3KBT A;  4DVD A;  3U78 A;  2BKN A;  2BBJ A;  4JEH B;  3Q9D A;  2NTX A;  3C4X A;  2E8I A;  4CQI A;  2X68 A;  2YU1 A;  3CML A;  1E2A A;  2RPA A;  4CI1 B;  4AQF C;  4N78 D;  4EZ4 A;  1D0X A;  2YDR A;  4COF A;  3Q5X A;  3RIU A;  4JI7 T;  2ZM2 A;  5JTG A;  3ETU A;  3E0Z A;  4C91 A;  2XAJ B;  2KMF A;  5JDQ A;  4UR9 A;  2X51 A;  2D2S A;  5M4Y A;  3ZMS B;  2LOP A;  2E2A A;  1VCS A;  2XSA A;  5LYJ E;  4JV5 T;  4ZI3 C;  5AQO B;  4CZZ B;  3I0Q A;  3V5U A;  2N1G A;  3N9N A;  3U3I A;  1WYC A;  4DND A;  5C2T A;  2MBG A;  5ETW A;  3Q5D A;  1BR2 A;  2KT9 A;  4A98 A;  2SPC A;  4TV9 E;  5AQI B;  2H7V C;  4TNW A;  2KXP B;  5L3G B;  3A5X A;  3NZP A;  3ZPO A;  4YXD A;  2LT3 A;  5KMG P;  2LSY A;  3QK6 A;  3RRC A;  3KVB A;  3OBV E;  3ONX A;  4A56 A;  5HCM A;  2JQQ A;  2LSK A;  4KX6 A;  3AA1 B;  2WZI A;  1W0A A;  2X66 A;  4DMW A;  2UXN B;  4HFE A;  5AQK B;  2KWI B;  3IA3 A;  1WFD A;  1XZY A;  1UK5 A;  1QSD A;  3PUV F;  4XBF B;  2W67 A;  3CQG B;  4JBW F;  2X0H A;  3Q5E A;  3CVR A;  4IDQ A;  4HN9 A;  4ILC A;  3M65 A;  3ANW A;  3O1H A;  2BZB A;  4YJ2 E;  3R84 B;  2L3L A;  5ABH A;  2VQF T;  2KLQ A;  4J2C A;  4TWF A;  2BG9 C;  4EXT A;  5JDN A;  4ZHQ E;  3EI0 A;  4AQY T;  2MPK A;  2VWA A;  4ILU A;  4LFA T;  5LGU B;  5AFU L;  4KHZ F;  1T72 A;  1X79 A;  3DP7 A;  1MND A;  2E9X D;  2ODU A;  2KND A;  3NWI A;  5L3D B;  3QOF A;  1J1J A;  5JH7 E;  2LE8 A;  4DR7 T;  4K0K T;  4FI5 A;  5IHY A;  4LF5 T;  4CXW A;  4BAY B;  4HWD A;  5HAX A;  4KUM B;  2WWU A;  4IT4 A;  4U74 A;  4JI2 T;  4ZZB A;  3FXE B;  3KV9 A;  2X67 A;  3ZT7 A;  3RQU A;  3NKZ A;  5LXT E;  2PBI A;  4O4I E;  2UU9 T;  3J9X 1;  2V6Y B;  2I0M A;  2XQ4 A;  1NEK A;  3PU3 A;  2JQ9 A;  3HL6 A;  3RYF E;  1IBK T;  3N9Q A;  4IGU A;  5FMN A;  5KXJ A;  4LF9 T;  3RPU A;  4YT0 A;  1YW0 A;  1BR0 A;  2UUC T;  4OX9 T;  1WCR A;  2XQ9 A;  2FJD A;  4DV0 T;  2MOZ A;  3ZN1 B;  5HWX A;  1UX4 A;  2IHR 1;  3RHW A;  3ZJ1 A;  3P4R A;  2FJB A;  2NWB A;  4EZH A;  3PDY A;  3PUA A;  4B3R T;  3IBP A;  4EEB A;  4P1N A;  3QB5 K;  3O1J A;  2AXD S;  5AQJ B;  4EIW A;  2NOX A;  3F31 A;  2X0Y A;  3E08 A;  2X9X A;  4IIJ E;  1HX1 B;  4I0U A;  2E9X A;  1I6Z A;  1XMO T;  3PUY F;  2ODV A;  3UUN A;  2NTY A;  3AEB A;  3FZL B;  4MFR A;  4UF0 A;  3UUM A;  2XAH B;  2UXX B;  4ZS3 A;  5EZY E;  2XAF B;  4UIG A;  4DV5 T;  3PU8 A;  2Q9Q C;  2VK9 A;  4A97 A;  2VB6 A;  3AA6 B;  4HFH A;  3AVS A;  4KHP T;  3TLW A;  1OED C;  4IL9 A;  3N2O A;  2X9H A;  5BR8 T;  1XNQ T;  5J0Z A;  2XY8 B;  5F8P A;  4PJN A;  3SS1 A;  4HFC A;  5L3E B;  5LJN A;  3SFD A;  2XQ6 A;  3RF1 A;  5HXC A;  3C51 A;  2FUP A;  4B3M T;  5ABF A;  2YU2 A;  4ADZ A;  1MIY A;  5JDM A;  4A5X A;  2W62 A;  3ONL C;  2M67 A;  3N9M A;  3QNU A;  3IF8 B;  3LK4 2;  1LRZ A;  5GON E;  1KNP A;  4GK5 E;  4UVC B;  4GIW A;  2V6X A;  4X66 T;  4DV1 T;  1G8X A;  4ZS2 A;  1IBM T;  2CXL A;  2Y6X A;  3I1A A;  5FXW A;  2VL0 A;  3LBX B;  1GQE A;  5CJ5 A;  3RYH E;  1V9D A;  3FB2 A;  4GYS A;  1G73 A;  2Q9Q B;  3CQX C;  4PK6 A;  3L09 A;  3SRZ A;  3ZMV B;  3BQL A;  1OED B;  2JPF A;  3FBZ A;  4HGA A;  2QRX A;  2HN2 A;  4AI6 A;  4PK4 A;  3H3M A;  4LF6 T;  5JRC B;  4O2A E;  4AXP A;  4X1K E;  5LBQ B;  2EHO C;  4YSY A;  3GN5 A;  2WU5 A;  4HFB A;  2LEH A;  1FMV A;  2C0S A;  2NW7 A;  5HEH A;  2XTL A;  2IUB A;  4UXN B;  4TUY E;  1J5W A;  1D1C A;  1WR6 A;  4WW0 A;  1QUU A;  2G0U A;  2B76 A;  3NVO A;  4TWD A;  4JUY A;  5ADX L;  4PJL A;  3AA0 B;  2YKS A;  2DLR A;  4OFZ A;  2XHE B;  4HWF A;  4K0U A;  3PV0 F;  1UGO A;  1HG2 A;  4YLH A;  3ZC0 A;  3T8O A;  4XAX B;  3B5M A;  2D0U A;  1XDO A;  2IAK A;  2N9D A;  1I94 T;  2CA5 A;  4DV3 T;  4YHJ A;  5CFB A;  5F5W A;  2QVA A;  4JI4 T;  4WNK A;  1U4Q A;  3HA4 A;  4IDN A;  4DR1 T;  3PUR A;  4IE4 A;  2N2N A;  4YJ3 E;  5AQS B;  5C3J A;  3JC6 C;  1E7P A;  4AKI A;  2L8K A;  1T98 A;  3RKG A;  1KFY A;  1Y64 B;  2J1D G;  3EDV A;  4DID B;  1KK7 A;  2XM2 A;  3KIN B;  3JAE A;  2EHO B;  2LHN A;  4P09 A;  4HFD A;  2BS4 A;  2YOE A;  1HTJ F;  3CWZ B;  1WR0 A;  1N33 T;  3L39 A;  2IW5 B;  4DMV A;  4NUU A;  2CPT A;  2OV9 A;  4LMJ A;  4KI0 F;  2C5I T;  3UU5 A;  3N5L A;  5LP6 E;  1X9B A;  2MYS A;  4XZC A;  3PJA J;  2E5V A;  3AEG A;  5JDF A;  4DR4 T;  4YTN A;  4O2B E; 
#chains in the Genus database with same CATH homology
 5LGU B;  4KP3 C;  4OK0 A;  3I9Y A;  1NAF A;  3H3A A;  5AFU L;  2E9X B;  4PJJ A;  2NW9 A;  3ZYM A;  3HI2 A;  3HR0 A;  4JEU B;  3LK3 B;  1X79 A;  4TZ4 C;  2V7K A;  3N9O A;  3UT5 E;  5JRC A;  4OHF A;  4YFS A;  3P7I A;  3FXD B;  5JR9 A;  3DP7 A;  4Z8X A;  4EYY R;  4U72 A;  3ZYK A;  5J2T E;  3PE0 A;  2W0G A;  1VRB A;  4I43 B;  4E7Z A;  4PFO A;  1MND A;  2CMR A;  2E9X D;  4DO0 A;  2XUE A;  3NRY A;  1YKH B;  2YIN A;  2WSS V;  3KVA A;  5LHI B;  4UF0 B;  2ODU A;  3W15 B;  2CXF A;  4QHO A;  2WBL A;  1VOM A;  2KND A;  5L3B B;  3KV6 A;  3QC9 A;  1ZHC A;  4TN7 B;  4TX5 A;  4DBQ A;  3SOL A;  5L3D B;  5TAO A;  3K3Q C;  5JDH A;  2LSI A;  2B1E A;  5A1L A;  5JH7 E;  2LE8 A;  4H9S E;  5BMV E;  5F3J A;  4H9R C;  2A72 A;  4MHC A;  5J1G A;  4FI5 A;  4UEL A;  3C64 A;  1WLX A;  1MMG A;  3N2G E;  4GK0 E;  5LGN B;  5IHY A;  3JC6 D;  2OA5 A;  4BAY B;  4CXW A;  3I0O A;  3LFM A;  2YEV C;  4MLK A;  5HAX A;  4KUM B;  3P8C D;  3B13 A;  2WWU A;  4U74 A;  3ZMZ B;  4DBR A;  3B57 A;  1YKE B;  3FXE B;  1OXZ A;  3KV9 A;  2X67 A;  4IDZ A;  3RRW A;  5LGT B;  3CPZ A;  1LVK A;  5E0O A;  3K8P C;  5LXT E;  4BJN A;  4HKA A;  3ZC1 A;  2PBI A;  4O4I E;  3KV4 A;  3J9X 1;  2C5K T;  1Z0P A;  3KBU A;  4ISS A;  4H9P C;  1NWM X;  3PU3 A;  4I50 E;  3WI3 A;  1AJ3 A;  2KWH A;  5C8Y E;  3O4X E;  1LVF A;  2WMO A;  1WRD A;  2WMN A;  2CCQ A;  3AAI A;  3HL6 A;  2JMK A;  3MA9 A;  4L5G A;  4E7S A;  5HXE A;  1HS7 A;  3KDS E;  3RYF E;  3N9Q A;  4IGU A;  4AQF A;  5FMN A;  3EDU A;  3L3P A;  3AAE B;  4O4L E;  3RPU A;  3LG7 A;  3WAK A;  2V26 A;  1YW0 A;  5LCY A;  1BR0 A;  1HG5 A;  2C5J A;  4CXX A;  2IC6 A;  1US7 B;  3DTO A;  5JDL A;  4H9Q C;  1EZ3 A;  2MOZ A;  3ETV A;  4OYJ A;  2VL8 A;  5IYZ E;  3ZN1 B;  3DJB A;  1D0Y A;  2EHO A;  2LSG A;  5HWX A;  1UX4 A;  1UX5 A;  4CI3 B;  5HWY A;  3ZMU B;  3HKD E;  4P0B A;  1HF8 A;  2X0L B;  3FHN A;  3OYZ A;  4P0A A;  3ESL A;  1IAP A;  2H3R A;  4PK5 A;  3MJX A;  3HKC E;  3N9P A;  2VKH A;  2K5B B;  3UTK A;  1D1B A;  3MZK B;  3ZJ1 A;  5LJM A;  3ZEF B;  2QA7 A;  4ZI2 C;  4G63 A;  2D5U A;  2HPJ A;  2WM9 A;  3VKG A;  2VKD A;  4I55 E;  4HTE A;  4NUV A;  2Y8D A;  2NWB A;  2JMH A;  4EZH A;  2W00 A;  2CM0 A;  2Z6E A;  3PDY A;  3PUA A;  3IBP A;  3RKO A;  2H7O A;  1S94 A;  2I59 A;  4KBM B;  4UV9 B;  2KIN B;  5CB4 E;  4HE8 A;  2W61 A;  4F6R C;  3O1J A;  4X20 E;  4EIW A;  2NOX A;  5LBM A;  3K3N A;  3F31 A;  3RC8 A;  3E08 A;  5KX5 E;  2X9X A;  5JRE A;  4IIJ E;  3GN5 B;  1D1A A;  2V1D B;  2E9X A;  2CEA A;  4BJM A;  4EB6 E;  3BQI A;  1B7T A;  2D0T A;  2MTQ A;  3F57 A;  3MXZ A;  3ZLI A;  2ODV A;  3UUN A;  2XQY A;  4L9I A;  2NTY A;  2LOS A;  5CA1 E;  1CUN A;  2RP4 A;  3V5S A;  3RH3 A;  5CA0 E;  4L0R A;  2A2F X;  1U5P A;  4MFR A;  5HXS A;  3OKQ A;  4UF0 A;  3UUM A;  2XAH B;  3HKB E;  4AQG A;  3CX7 B;  2PG8 A;  2UXX B;  4ZS3 A;  5EZY E;  2ZLY A;  2XAF B;  4UIG A;  3ZN0 B;  3GWH A;  2RA1 A;  2W63 A;  3PU8 A;  2Q9Q C;  1IZN B;  3LJC A;  1HCI A;  2VK9 A;  4UVB B;  2CE7 A;  1LKX A;  4MBQ A;  4UV8 B;  3AA6 B;  2VB6 A;  3RYC E;  5HYA A;  3ZJ2 A;  3AVS A;  3N9L A;  2DWG A;  3PTR B;  3WAJ A;  5L3F B;  3EUH A;  3BK9 A;  5FY7 A;  2CXD A;  4MAL A;  2DHR A;  3N2K E;  3N2O A;  1FIO A;  2X9H A;  4FJO A;  4HEA A;  3UUL A;  2ZM0 A;  2YK0 A;  3RC3 A;  5F8P A;  4C90 A;  1OWA A;  2HPL A;  4PJN A;  3SS1 A;  4ZOL E;  5L3E B;  3PUG A;  2JRK A;  1MMD A;  5JDG A;  2CLY B;  1MNE A;  4H63 V;  5JR9 C;  5LJN A;  2XAS B;  3CX8 B;  3GMI A;  4GOU A;  1ZV4 X;  5HXC A;  4IE7 A;  3C51 A;  3VU7 H;  2V7J A;  3UUX B;  2CWY A;  3UFE A;  1ZEE A;  2V7I A;  2L9Q A;  4ASK A;  2YU2 A;  5L2L A;  1BR4 A;  4V1A v;  4AKL A;  4G2A A;  4ADZ A;  3R6N A;  1MIY A;  4UVA B;  5JDM A;  1HX8 A;  2LHR A;  2W62 A;  5FY1 A;  1SA0 E;  1WYB A;  2M67 A;  2K9A A;  3N9M A;  4M1P A;  5FXX A;  2DI4 A;  3IF8 B;  4X1Y E;  3C98 B;  1YD8 G;  3VKH A;  3LK4 2;  4QX8 B;  3IHR A;  3GA8 A;  1LRZ A;  5LHG B;  4H9O C;  4PW8 A;  5DQW A;  5GON E;  4AKH A;  3K3O A;  4GK5 E;  4UVC B;  4QXH B;  4GIW A;  4PJM A;  3OYX A;  2XAQ B;  3AAA B;  2LSJ A;  2WAU A;  5JQG E;  3H37 A;  2V7M A;  1G8X A;  3MK7 C;  3HKE E;  4EOZ B;  2VKO A;  4WBN E;  2LM9 A;  3CX6 B;  4ZS2 A;  2ZMA A;  1D0Z A;  2CLY C;  2CXL A;  5FY0 A;  5L3C B;  4UEM A;  1KNZ A;  2Y6X A;  2ACX A;  4CI2 B;  3I1A A;  5FXW A;  4QXB B;  3Q2M A;  3KBT A;  5EK4 A;  4DVD A;  1MIW A;  3U78 A;  3LBX B;  2NW8 A;  4H63 H;  2A3D A;  3ANW B;  2JJ9 A;  3RYH E;  2IC9 A;  4JEH B;  3Q9D A;  2NTX A;  3C4X A;  4PAG A;  1V9D A;  2E8I A;  1IJ5 A;  2K48 A;  2KZ7 B;  3FB2 A;  4IE6 A;  3KV5 A;  4CQI A;  4GYS A;  2X68 A;  1G73 A;  2Q9Q B;  2YU1 A;  3CML A;  3CQX C;  3CKD A;  1BR1 A;  2V7L A;  4CI1 B;  4AQF C;  2BDE A;  4PK6 A;  3PUS A;  3TKL B;  2ES0 A;  3L09 A;  2CWO A;  2HH7 A;  5LNK A;  4N78 D;  4EZ4 A;  3SRZ A;  3ZMV B;  3BQL A;  5FXZ A;  3ZCJ A;  2JPF A;  3FBZ A;  4WBO A;  1D0X A;  4HGA A;  4IE0 A;  4I4T E;  3Q5X A;  4AI6 A;  1UCU A;  5LA6 E;  4PK4 A;  2ZM2 A;  3ETU A;  3E0Z A;  2Q9Q D;  4C91 A;  2XAJ B;  2KMF A;  5JRC B;  5JDQ A;  1MIV A;  4O2A E;  5DJQ C;  4BA9 A;  4X1I E;  5JR9 B;  4AXP A;  4X1K E;  2Y48 B;  4QKN A;  2EHO C;  5LBQ B;  3ZMT B;  2PJQ A;  3GN5 A;  2X51 A;  2D2S A;  5M4Y A;  5FXV A;  2LEH A;  5FP3 A;  1FMV A;  2C0S A;  3ZMS B;  2NW7 A;  5FYM A;  2QGS A;  4EAH A;  2LOP A;  1ZKE A;  2XTL A;  3S4U A;  2P9B A;  3NZQ A;  5LYJ E;  4UXN B;  4TUY E;  4ZI3 C;  4EYU A;  1D1C A;  3RYI E;  5LHH B;  4CZZ B;  4IST A;  1WR6 A;  3I0Q A;  3NRX A;  4WW0 A;  1QUU A;  2G0U A;  1FMW A;  3V5U A;  3ZCI A;  2DCF A;  4JUY A;  3VHL A;  2K24 A;  5ADX L;  4PJL A;  3AA0 B;  5JVD E;  2ZM8 A;  2DLR A;  2N1G A;  3N9N A;  4OFZ A;  3U3I A;  2XHE B;  5HXR A;  1WYC A;  3ZYL A;  5LG4 A;  3C4Z A;  4DND A;  5FNV E;  2MBG A;  3KFW X;  5H6Q B;  4K0U A;  4B6X A;  5ETW A;  1HG2 A;  4YLH A;  3I9W A;  1BR2 A;  4HFV A;  2KT9 A;  3C4W A;  4IHJ E;  3ZC0 A;  3T8O A;  5EK3 A;  4XAX B;  2SPC A;  2E9X C;  2DNX A;  2D0U A;  4TV9 E;  2BVM A;  4CXY A;  3SWH A;  2H7V C;  2BVL A;  1MMA A;  2IAK A;  2N9D A;  2KXP B;  3D0T A;  2CA5 A;  4IE5 A;  4YHJ A;  3PUQ A;  3CQC B;  5L3G B;  2LJL A;  3A5X A;  3NZP A;  5DQV A;  3ZPO A;  4ANJ A;  2LT3 A;  4QWN B;  4WNK A;  5KMG P;  2LSY A;  1U4Q A;  3RX6 A;  2XAG B;  1SHZ C;  2VKJ A;  3QK6 A;  1O3X A;  3HA4 A;  5H6R B;  3RRC A;  4AKR B;  3PUR A;  3KVB A;  4IE4 A;  2N2N A;  3OBV E;  4YJ3 E;  3QUJ A;  4ZI2 D;  3ONX A;  4A56 A;  2JQQ A;  4OYK A;  2LSK A;  3FBL A;  3JC6 C;  1S35 A;  4AKI A;  2GK9 A;  2L8K A;  1H7C A;  3F2E A;  1T98 A;  1Y64 B;  5J2U E;  2X9Y A;  3AA1 B;  3AVR A;  3J7Y q;  2J1D G;  3EDV A;  2X66 A;  3O9X A;  4DMW A;  1KK7 A;  3KIN B;  4GYR A;  1IJ6 A;  2EHO B;  2UXN B;  2LHN A;  4O8S A;  2KWI B;  3C50 A;  4P09 A;  4TV8 E;  4ERR A;  1HTJ F;  3EVY A;  4JLE A;  3CWZ B;  4H9N C;  1QSD A;  1E1H B;  4ZI7 E;  4PNI A;  4AKG A;  3Q5W A;  4XBF B;  4O4J E;  2PFV A;  2X9W A;  1HFA A;  5EK2 A;  3LK2 B;  2IW5 B;  3O1I A;  2EHO D;  3CQG B;  1FEW A;  3NBX X;  4NUU A;  4DMV A;  4PFP A;  3CVR A;  3BQK A;  5DAB A;  2DWK A;  3LBX A;  4HN9 A;  3M65 A;  5KDM C;  2C5I T;  3ANW A;  4QX7 B;  3O1H A;  4O4H E;  2BZB A;  4QXC B;  3N5L A;  3R84 B;  3AA7 B;  4YJ2 E;  5LP6 E;  3AB3 B;  4ZI3 D;  5LOV E;  2MYS A;  2L3L A;  4XZC A;  2KLQ A;  4J2C A;  2Q9Q A;  3IEE A;  1MMN A;  4EXT A;  5JDN A;  2VAS A;  4ZHQ E;  3MKD A;  4KMC A;  3OJA A;  2VWA A;  5JDF A;  4ILU A;  2NP9 A;  4O2B E;  5HXH A;  3E22 E;  3MAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...