2DI4A

Crystal structure of the ftsh protease domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
176
Chain Sequence
TISPKEKEKIAIHEAGHALMGLVSDDDDKVHKISIIKHIYDKKDLYNKILVLLGGRAAEEVFFGKDGITTGAENDLQRATDLAYRMVSMWGMSDKVGPIAIRRTAVDTSPDLLREIDEEVKRIITEQYEKAKAIVEEYKEPLKAVVKKLLEKETITCEEFVEVFKLYGIELKDKCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division protein ftsH homolog
publication title Structure of the Whole Cytosolic Region of ATP-Dependent Protease FtsH
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 59
structure length 176
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2006-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01434 Peptidase_M41 Peptidase family M41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.760 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2di4A00
4EIWA 2CEAA 2CE7A 2DI4A 2DHRA 4Z8XA 4WW0A 3KDSE
chains in the Genus database with same CATH superfamily
3SFEA 2QGSA 2VL8A 5LXTE 2XSAA 4MALA 5FNVE 5FL1A 4DMWA 1X79A 3KV6A 3N9QA 4UXNB 3AE4A 4CQIA 5JRCA 4ASKA 4PW8A 4AISA 4UV8B 4JI8T 2W66A 2V6YA 2J4GA 3NRYA 1IBLT 3HKEE 1LKXA 1IBMT 4DV1T 2VQET 5BR8T 2PG8A 3N9MA 3N2KE 2XAJB 5JDGA 2D0TA 1WRDA 2PJQA 5AFUL 4F8HA 1WYCA 1E1HB 1I94T 3PURA 5M4YA 5ABEA 5JR9B 5FY1A 1W0AA 4GIWA 2BG9E 4KMCA 3KFWX 3AEDA 4G2AA 2CXDA 3ZN1B 5LMNT 3NVOA 5LGNB 2V1DB 5AQJB 4TN7B 2VASA 3Q5EA 3F31A 3K8PC 2BBJA 4Q25A 4Z90A 2CRBA 2KINB 4LMKA 2IIUA 4H9RC 4TNWA 2ACZA 5JRCB 4AKGA 3GWHA 4ZI2C 2P9BA 4QX8B 4G63A 5LNKA 4IE7A 2ZMAA 4HN9A 2V6YB 1UUSA 3NWIA 3ETUA 4PJJA 2EHOD 4BAYB 4X20E 3VR9A 3SS1A 3AE2A 4DV2T 5CA1E 1LRZA 1OXZA 1LVFA 3PU3A 2IAKA 5L4HA 1HNXT 2WDRA 2LOPA 2JIWA 2WMOA 3SRZA 4A56A 1WR6A 4OX9T 4E7SA 2FBWA 2A9UA 2UXBT 5AQGB 1D1CA 4UR9A 4QX7B 3N5LA 4WNKA 4UIGA 2LRLA 3NZPA 3AEGA 4YTNA 3I0QA 3LK42 4L9IA 1XMOT 1HG2A 3KBUA 1IZNB 3H3MA 2MPKA 4CXYA 4HWIB 1XMQT 3NKZA 4KBMB 2WY2A 5LHGB 3AEBA 4I50E 3RYIE 1HNWT 2K24A 3KV4A 5H6RB 2NW9A 4DV7T 5L3CB 2SPCA 4UF0A 2NW7A 3KDSE 1MIWA 4BJMA 2OLTA 5ABFA 4JI3T 5LGUB 4U33A 2CWOA 4MLKA 3A8YC 3O1JA 3N9PA 3RYFE 4AKHA 3PU8A 3LK3B 1KEYA 4AQFC 2JJ9A 4CXXA 2D5UA 5HEOA 3H3AA 3BQKA 4IGUA 4EAHA 3CKDA 4TZ4C 2LE8A 4O4JE 4DUYT 3C4ZA 5AQOB 4IDQA 3PUYF 4WYVA 1OWAA 2XASB 4YSYA 2LSJA 4U2YA 2IUBA 3CQCB 4JI6T 1G73A 5FY7A 3ZYLA 5F3JA 4UVAB 5L3EB 3C98B 4TUYE 5IHYA 2X68A 5J2UE 2IMLA 2X0LB 2KWIB 4H63H 4GOUA 5HXRA 3UUMA 3ZMUB 4C90A 2XQ4A 1US7B 3EDVA 2LKHA 5AQVB 2XQ9A 5HYAA 2BVMA 4ANJA 5J2TE 5AQIB 1UK5A 2K48A 2NTYA 4I55E 3BQLA 2E5LT 2MOZA 2X9WA 2JQQA 4ZOLE 3MACA 2FJDA 3CK6A 2VWAA 3EI0A 2LSYA 4EOZB 4A98A 4F6RC 2KNDA 2HN1A 4DBRA 3E0ZA 2XAGB 3C4WA 2CEAA 5JDNA 3C50A 3KINB 3LK2B 1ZKEA 2NOXA 3FHNA 1YD8G 5CB4E 1XNQT 2FJEA 3R84B 4YSZA 1HNZT 1FEWA 4EXTA 2W4XA 3AXJA 5AQTB 4H9NC 3AE7A 1MNEA 4U74A 3UUNA 2LSIA 4ZI7E 2D2SA 1U5PA 1MMGA 3AEEA 2Y6XA 4IIJE 2X67A 3P4RA 3L8RA 5ABGA 4IDPA 2C5IT 2VKDA 3N9NA 4P0BA 3RIUC 5C2TA 2WU5A 3EVYA 2CHOA 5LMUT 1IAPA 3N9LA 5LJMA 2ES0A 4NUVA 5JR9C 2X9XA 4GK5E 4H9QC 1KNZA 3O1IA 3PTRB 3ONXA 3CWZB 4QWNB 3RIAA 4LMLA 2RA1A 3QOFA 1NWMX 4YJ3E 4JI5T 2XQAA 1UX5A 5IWAT 4X1KE 3PJAJ 2G0UA 2BG9A 3SWHA 2CM0A 3MA9A 4CXWA 4U2ZA 4L0RA 5HEGA 4KI0F 1FIOA 4HGAA 1IBKT 2CHNA 5EK2A 4HWHA 2JQHA 2FJAA 2UUBT 2BZBA 4HFBA 5LG3A 4YT0A 4HTEA 3RHWA 5IUXA 2HN2A 2ODVA 4DR5T 2BKNA 3AA1B 4JI4T 2UXDT 2JMKA 3U3IA 5JDHA 4U7IA 4YXDA 3ZN0B 2ZM6T 5L3BB 1UX4A 4QH1A 3DTOA 4U31A 2HPJA 4EZ4A 4NPPA 2CMRA 4B3MT 2H89A 2VVSA 1BR2A 4DMVA 1KNPA 5C3JA 3AE1A 2IC9A 3AB3B 2BG9B 2XPKA 4YHHT 2V7LA 1ZV4X 4DUZT 5CA0E 3OYXA 4ISTA 3FZKB 4DVDA 4X5TA 3ZLIA 2JRKA 3C4XA 4AKRB 4DNDA 4NUUA 1H7CA 4IE0A 4KHPT 2E9XD 2ZLYA 3RI5A 4A5XA 2XQYA 4DR4T 3A5XA 1N34T 3P8CD 1I6ZA 1YQ3A 4PJLA 1QLBA 2X9HA 4OYJA 1N33T 4IL9A 3DJBA 3ZMTB 1D0ZA 4YLHA 4KP3C 3UU5A 3VRAA 5FVKA 2CLYB 3AECA 2XQ6A 3UUBA 5LJNA 4CN6A 4XAXB 3B5MA 5HCMA 3UT5E 3QK6A 2AXDS 2EHOA 4WBOA 5HXEA 3I1AA 5E0OA 2JMHA 2CBJA 2QRXA 3OBVE 4UELA 2BS3A 3RYCE 2CBIA 3CMLA 4IE4A 3KBTA 3K3QC 4HFIA 4IDNA 3JC6D 4FJOA 4PJNA 1FMWA 2N9DA 1G8XA 3KV9A 4EYUA 1ZHCA 2MAWA 1IJ5A 4B3TT 3O1HA 4AXPA 4EIWA 3LG7A 4O8SA 1HFAA 2I0MA 4IDZA 2XUEA 5JTGA 4HKAA 1QSDA 3ONLC 3WAKA 2BBHA 2KMFA 2UXXB 3HKBE 5DJQC 4ZZBA 3OTOT 3RF1A 2HPLA 3EUHA 4QXHB 4GYRA 2EHOB 3PDYA 4N78D 1NENA 2Y48B 2XAHB 2W2UA 3HL6A 5FL0A 3ZSSA 3AVSA 3ZYMA 3UTKA 3P4WA 5L2LA 5KXJA 4PFPA 3AE5A 3ZJ2A 2BKPA 2CXLA 2DI4A 1Z0PA 3CIRA 3VRBA 3PUSA 5ADXL 5FXWA 3RQUA 2YN6A 3P4PA 2H7OA 2XY8B 2DWKA 4B3RT 2K5BB 3UFEA 1OEDA 4YSXA 4HFEA 4JI7T 2L8KA 2N1GA 4DV3T 3ZC0A 3PE0A 5HXSA 1T7SA 3SOLA 3RPUA 2BS4A 5GONE 4PAGA 3AA7B 2KSRA 2CWYA 2X0HA 2LSKA 2W61A 1J5ET 1KK7A 3UQ4A 3CX8B 2L9QA 3W15B 2YOEA 2JQKA 2X51A 2ZM2A 2X66A 4ISSA 3PUZF 3KV5A 4BA9A 4TV8E 4PK5A 2CXFA 3X1DA 4IL4A 1HCIA 3M3ZB 2F4VT 1X9BA 2LJLA 1YW0A 4KHZF 4LFBT 2C5KT 5HAXA 5L4EA 3Q9DA 1MMDA 2IDOB 2Q9QA 2WS3A 3TLTA 1S35A 3N2OA 2RPAA 2XSBA 5LBQB 3AVRA 4ZEYA 2E5VA 2LM2A 3D0TA 3P4QA 3LBXA 1SUMB 2XQ5A 1IJ6A 2WZIA 5HEJA 1Z8UA 2XQ7A 1MMAA 3BK9A 3RX6A 3ZCIA 4ZS3A 4EEBA 4UF0B 2YK0A 4H9PC 5ABFB 3RC8A 4CI1B 3DP7A 4QXBB 1WYBA 4QXCB 4OK0A 2V6XA 2V8SV 4JI2T 3VHLA 4DV5T 4J2CA 2HH7A 1HX8A 3FBZA 3EAMA 2V7IA 1D1BA 3KVBA 5JQGE 2BG9C 1J5WA 1BR1A 4XBFB 3QB5A 4DV4T 5F5WA 4EZHA 4ZI2D 1XDPA 1KF6A 2B76A 2Q9QD 2KZ7B 2V7KA 2Q9QB 3PV0F 5LB7B 3HKCE 3R6NA 3VU7H 4DIDB 5BMVE 3LBXB 4K0KT 3UFGA 5JDLA 1OEDE 4DV0T 3I9YA 5FXZA 4BJNA 2WAUA 3J9X1 4LF9T 5EZYE 3UUXB 4JI1T 5ABHA 5LCYA 5AQKB 4LF5T 2CLYC 3NZQA 4IREA 3ESLA 4UEMA 2VK9A 1W09A 1ZP0A 3AE3A 3ZT5A 2YDQA 3O9XA 3HA4A 4P09A 4C91A 2A2FX 4O2AE 2DHRA 5KMGP 2A3DA 3K3NA 2HHHT 4B6XA 2J1DG 3Q5WA 4IE5A 4AIUA 4IE6A 5AQFB 3QUJA 1UURA 2QA7A 4KUMB 2IC6A 3JC6C 4YY3T 4ZXLA 3MZKB 4CZZB 3G06A 4CN1A 1WCRA 3LJCA 2YKSA 4X64T 5FMNA 3LFMA 3V5SA 1YQ4A 2V26A 3PJAA 4CI3B 2BKOA 3AEAA 3AXJB 2FJBA 4ZZCA 2LT3A 1BR0A 3ANWA 2E9XA 5HEUA 4L5GA 1MNDA 1D0YA 1VCSA 3Q2MA 3CX6B 1QUUA 4Z8XA 5JDFA 5FVLA 4JV5T 2IHR1 2PTFA 5KDMC 5JH7E 2EHOC 4JEHB 2WDQA 1UCUA 2WP9A 1W9RA 5FKYA 2H3RA 1WR0A 3K3OA 2WU2A 1D1AA 1Y64B 3ZPOA 2K3WA 5JREA 3OKQA 5AQLB 5F8PA 3ZT7A 2YINA 5AQUB 2XQ3A 1M7KA 3T1HT 2CA5A 4UVCB 2BVLA 3E22E 5FP3A 4NXNT 2W63A 3RIFA 4ERRA 3RC3A 4O2BE 1GQEA 2M6BA 3UU8A 4GKJT 4GK0E 2VKOA 2VURA 2I6HA 4AKLA 3P50A 1NAFA 1R8IA 4P1NA 4HE8A 3RRWA 2NR4A 1W0BA 3ABVA 4JBWF 5H6QB 1LVKA 2XAFB 2KWHA 3QNUA 4HWDA 3ZJ1A 2Y8DA 3ANWB 2E9XB 2WBLA 3T1YT 3I0OA 2VKJA 3NRXA 4IDOA 4EV6A 2CPTA 2LOSA 2MTQA 1XZYA 5LYJE 4FI5A 1FJGT 3ZT6A 3QC9A 3ZYKA 4JI0T 4U3CA 3TKLB 1SE7A 1B7TA 4DR7T 3LDQB 2DLRA 3AAEB 3RKOA 5DQWA 3CX7B 3FZLB 5LBMA 2UXCT 2J62A 3JAEA 2Z6EA 4O4IE 1S94A 3TLUA 1UGOA 3P7IA 3P4SA 2ZM0A 2B1EA 3ONJA 3GA8A 5CFBA 3OVUA 4U72A 2WSSV 5L3DB 3RGLA 1JNZA 1E7PA 3PUAA 3ZC1A 1OEDC 2MYSA 1VCTA 5L3GB 2LSGA 3IA3A 4V1Av 1HX1B 4LFAT 3C51A 5FXVA 3UULA 3HKDE 4WZXA 2M67A 5AQQB 2GK9A 2UU9T 3HR0A 5ETWA 5AQSB 3JAFA 2YDRA 4ZS2A 3AE8A 3IBPA 3LSVA 1YKEB 3RQWA 1HTJF 1O3XA 2XM1A 1ZOYA 2VQFT 4LFCT 4JYAT 3ZCJA 3AE6A 4YFSA 4K0UA 4HFHA 3CQXC 3GMIA 3Q5XA 4PJMA 5C8YE 4O4HE 3M65A 3OJAA 2UUCT 3F57A 4X65T 1V9DA 2W67A 4PK6A 1CHUA 3B13A 4ILBA 2Q9QC 2IW5B 2QYWA 4ILCA 1DU2A 1MMNA 3VR8A 3SFDA 3MK7C 3VKHA 5FY0A 5AQMB 3AAIA 2M6IA 3TLWA 4I43B 5IYZE 3B57A 3BQIA 1E2AA 2C5JA 3N2GE 2LHNA 3F2EA 3FZMB 4OHFA 1YXRA 1VOMA 2X9YA 2H7VC 4DO0A 4A97A 4ZI3D 4LMJA 2CE7A 4AKIA 1L0VA 2XZEA 3Q5DA 3UU6A 4YJ2E 3VKGA 4LF7T 1BR4A 2NW8A 3PUXF 4IHJE 5CGMA 3FB2A 4QH4A 3NBXX 3PUWF 1HS7A 2V5DA 4TV9E 4DR2T 2D9DA 2XM2A 2WWVA 2BS2A 1EZ3A 1WFDA 4JEUB 2PBIA 5L47A 2NP9A 4EEDA 4Z91A 4QHOA 5EK3A 2NTXA 2V7JA 3WAJA 5LGTB 5HEHA 2AE9A 4LF8T 2WM9A 4JLEA 4ILAA 2JPFA 4GYSA 3KVAA 2KLQA 2YU1A 3GN5A 2DCFA 4OYKA 4M1PA 1KFYA 2WZHA 2WMNA 3EABA 1J1JA 3AA0B 5LOVE 4I4TE 4YTPA 3ZKRA 2DL1A 1MIYA 1OEDB 2UUAT 4WBNE 4H9SE 3CQGB 2WQYA 4HFVA 4X1YE 4COFA 2R6GF 3CVRA 2L3LA 4B3ST 2ZM8A 5JDMA 3AAAB 2J47A 3EHZA 3TLSA 2WB5A 4GKKT 1HF8A 3H37A 4AI6A 4WW0A 2LM9A 2N2NA 3QB5K 3PUGA 4E7ZA 3UQ7A 3E08A 5JVDE 3MJXA 2XTLA 2YU2A 3ZMSB 3RKGA 3UU3A 3OYZA 3PUQA 3RH3A 5JDQA 4UVBB 4MBQA 1CUNA 4NXMT 5HWYA 4LF4T 1M62A 4H63V 4MFRA 2LHRA 3I9WA 3O4XE 2XAQB 3C64A 2OA5A 2PFVA 3GN5B 2NWBA 3ZSTA 2W00A 3EDUA 1Y01A 2K9AA 2E9XC 4CN4A 4DR6T 3N9OA 3ZMZB 4P0AA 2OV9A 3TLVA 4AQYT 3L3PA 2YEVC 2XHEB 5LHHB 2E8IA 4JUYA 2KXPB 2QVAA 4I0UA 4TWDA 3JADA 4AQFA 2ACXA 2V7MA 4ADZA 4TNVA 2UXNB 5FXXA 2H88A 4X62T 5AQHB 2XQ8A 3RLFF 3UU4A 3S4UA 5KX5E 1MIVA 1ZEEA 1AJ3A 3FZHB 2DNXA 4ILUA 4LF6T 3IF8B 2FUPA 2ODUA 4HWFA 2KT9A 3L39A 5HXHA 3OPCA 3J7Yq 2E2AA 4U7YA 1U4QA 3JCFA 2BDEA 4XZCA 4QKNA 1VRBA 4EYYR 4HEAA 3L09A 5DQVA 5AQNB 4TWFA 4CI2B 4QH5A 3AE9A 2V5CA 2WCAA 2I59A 2X0YA 4H9OC 4EB6E 3AEFA 1HR0T 3ETVA 2LEHA 1XWMA 4KX6A 3MKDA 4NIQA 2C0SA 3FBLA 2VB6A 3V5UA 1YKHB 4PNIA 3CPZA 2VKHA 3RYHE 5EK4A 3FZFB 4UV9B 3IHRA 3RRCA 2VVNA 1N32T 4YHJA 5AQRB 4HWCA 1SA0E 5L3FB 1N36T 1T8BA 4O4LE 2WWUA 2D0UA 5FYMA 2VL0A 1WLXA 5HCJA 4PFOA 2LRKA 3ZMVB 3MXZA 3HI2A 2LLYA 3WI3A 3T8OA 1T98A 4TWHA 5J1GA 3FXEB 4IT4A 3FXDB 3IEEA 1JNRA 1D0XA 4EGWA 4X66T 3PUVF 2W0GA 1XDOA 2WDVA 4OFZA 1XNRT 4ZHQE 3U78A 2LKGA 4X1IE 1NEKA 2CCQA 2MBGA 5LP6E 2YDSA 2JQ9A 2RP4A 4DV6T 2XJ7A 3RIUA 4ZI3C 5HWXA 1T72A 5J0ZA 4PK4A 3A7MA 4DR3T 5JR9A 3AA6B 2DWGA 4TX5A 3ZEFB 4MHCA 1FMVA 5DABA 3K1SA 1KNRA 2A72A 2W62A 1HG5A 4HFDA 5AQPB 4YTMA 4HFCA 4AQGA 5A1LA 5LG4A 5TAOA 5LHIB 1SHZC 4DR1T 5CJ5A 5HXCA 4DBQA 5LA6E
chains in the Genus database with same CATH topology
3MK7C 3VKHA 2QGSA 2VL8A 5FY0A 4YJ3E 5LXTE 4MALA 3ZCIA 5FNVE 4ZS3A 3AAIA 1UX5A 4DMWA 1X79A 4I43B 4X1KE 5IYZE 3KV6A 4UF0B 2YK0A 3N9QA 3B57A 4H9PC 4UXNB 2G0UA 4CQIA 5JRCA 3RC8A 3BQIA 4ASKA 4CI1B 3DP7A 2C5JA 3N2GE 4QXBB 1WYBA 2LHNA 4PW8A 3F2EA 4QXCB 4OHFA 3SWHA 2CM0A 3MA9A 1VOMA 2X9YA 2H7VC 4OK0A 4UV8B 4DO0A 4CXWA 3VHLA 4L0RA 4ZI3D 4J2CA 2CE7A 2HH7A 3NRYA 1HX8A 4AKIA 3FBZA 3HKEE 1LKXA 1FIOA 4YJ2E 3VKGA 4HGAA 1BR4A 2NW8A 4IHJE 2V7IA 1D1BA 3KVBA 5JQGE 5EK2A 3FB2A 1BR1A 4XBFB 2PG8A 3NBXX 3N9MA 3N2KE 2XAJB 4EZHA 1HS7A 2BZBA 5JDGA 4ZI2D 2D0TA 1WRDA 2PJQA 4TV9E 2Q9QD 4HTEA 2KZ7B 2V7KA 5AFUL 1WYCA 1E1HB 2Q9QB 3PURA 5M4YA 3HKCE 5JR9B 3R6NA 5FY1A 3VU7H 4GIWA 2ODVA 1EZ3A 5BMVE 4JEUB 2PBIA 4KMCA 3KFWX 3AA1B 3LBXB 2NP9A 4G2AA 2CXDA 3ZN1B 4QHOA 2JMKA 3U3IA 5JDHA 5JDLA 5LGNB 5EK3A 2NTXA 2V7JA 2V1DB 3WAJA 5LGTB 3ZN0B 3I9YA 4TN7B 5FXZA 4BJNA 2WAUA 5L3BB 1UX4A 3DTOA 3J9X1 2HPJA 2WM9A 5EZYE 2VASA 4JLEA 3UUXB 4EZ4A 2JPFA 3F31A 4GYSA 3K8PC 5LCYA 2CMRA 2CLYC 3KVAA 2KLQA 3NZQA 3ESLA 1BR2A 2YU1A 4UEMA 2KINB 2VK9A 4DMVA 3GN5A 2DCFA 4OYKA 4M1PA 2WMNA 2IC9A 4H9RC 3O9XA 3HA4A 5JRCB 4AKGA 3AB3B 3GWHA 4P09A 4C91A 3AA0B 5LOVE 4ZI2C 2P9BA 4QX8B 4I4TE 4G63A 5LNKA 2A2FX 2V7LA 4O2AE 1ZV4X 2DHRA 4IE7A 2ZMAA 5KMGP 4HN9A 1MIYA 5CA0E 4WBNE 3OYXA 4ISTA 2A3DA 3K3NA 4DVDA 4H9SE 3CQGB 4HFVA 4X1YE 3ZLIA 4B6XA 2J1DG 2JRKA 3C4XA 3CVRA 3ETUA 3Q5WA 4IE5A 2L3LA 4AKRB 4DNDA 4IE6A 1H7CA 2EHOD 3QUJA 4NUUA 4PJJA 4BAYB 4IE0A 2ZM8A 4X20E 5JDMA 2QA7A 3SS1A 2E9XD 2ZLYA 3AAAB 5CA1E 1LRZA 1OXZA 1LVFA 3PU3A 4KUMB 2IAKA 2XQYA 2IC6A 3A5XA 3JC6C 3P8CD 3MZKB 2LOPA 4CZZB 1HF8A 3H37A 2WMOA 3SRZA 4PJLA 4AI6A 4WW0A 4A56A 1WR6A 3LJCA 2LM9A 2N2NA 2X9HA 3PUGA 4E7ZA 4E7SA 4OYJA 3E08A 5JVDE 3DJBA 3MJXA 3ZMTB 2XTLA 2YU2A 5FMNA 3LFMA 3V5SA 1D0ZA 3ZMSB 2V26A 1D1CA 4YLHA 4KP3C 4QX7B 3N5LA 3OYZA 4WNKA 3PUQA 2CLYB 4UIGA 3RH3A 5JDQA 4UVBB 4CI3B 4MBQA 1CUNA 3NZPA 5HWYA 5LJNA 3I0QA 3LK42 4H63V 4L9IA 4MFRA 2LHRA 3I9WA 3O4XE 4XAXB 1HG2A 3KBUA 1IZNB 3UT5E 3QK6A 2XAQB 2EHOA 2LT3A 4CXYA 3C64A 2OA5A 4WBOA 1BR0A 5HXEA 3ANWA 2E9XA 3I1AA 5E0OA 2PFVA 1MNDA 4L5GA 1D0YA 2JMHA 3Q2MA 3CX6B 1QUUA 2NWBA 3GN5B 4KBMB 4Z8XA 3OBVE 5JDFA 2W00A 3EDUA 4UELA 5KDMC 5LHGB 4I50E 3RYIE 5JH7E 2EHOC 2K9AA 2K24A 4JEHB 1UCUA 2E9XC 3RYCE 3KV4A 3N9OA 3ZMZB 4P0AA 3CMLA 5H6RB 4IE4A 3KBTA 2NW9A 3K3QC 3L3PA 2H3RA 5L3CB 2YEVC 2SPCA 2XHEB 5LHHB 3JC6D 4FJOA 2E8IA 2NW7A 4PJNA 3KDSE 4UF0A 4JUYA 2KXPB 1MIWA 3K3OA 4BJMA 1D1AA 1Y64B 1FMWA 3ZPOA 5LGUB 4AQFA 2ACXA 2CWOA 2N9DA 5JREA 1G8XA 3KV9A 4EYUA 3OKQA 4MLKA 5F8PA 1ZHCA 2V7MA 2YINA 1IJ5A 4ADZA 3O1JA 2UXNB 3N9PA 3RYFE 2CA5A 5FXXA 4AKHA 3O1HA 4UVCB 4AXPA 4EIWA 3PU8A 3S4UA 2BVLA 3E22E 3LG7A 3LK3B 4O8SA 1MIVA 1ZEEA 5KX5E 1AJ3A 4AQFC 5FP3A 2JJ9A 2DNXA 4ILUA 1HFAA 2W63A 3IF8B 4IDZA 2XUEA 2ODUA 4CXXA 4HKAA 1QSDA 4ERRA 2D5UA 3RC3A 2KT9A 4O2BE 5HXHA 3H3AA 3J7Yq 4GK0E 3WAKA 3BQKA 2KMFA 2UXXB 4IGUA 4EAHA 3HKBE 2VKOA 1U4QA 3CKDA 4TZ4C 4AKLA 5DJQC 1NAFA 4HE8A 2LE8A 4O4JE 2BDEA 3RRWA 3C4ZA 4XZCA 4QKNA 2HPLA 5H6QB 1LVKA 5LA6E 1VRBA 3EUHA 2XAFB 4EYYR 4HEAA 4QXHB 3L09A 4GYRA 5DQVA 2KWHA 4CI2B 1OWAA 2EHOB 2XASB 3ZJ1A 2LSJA 2Y8DA 3ANWB 2E9XB 2WBLA 3PDYA 3CQCB 2I59A 4N78D 1G73A 5FY7A 3I0OA 2VKJA 2Y48B 3NRXA 4H9OC 4EB6E 2LOSA 2MTQA 2XAHB 3HL6A 3ZYLA 3ETVA 5LYJE 4FI5A 2LEHA 3QC9A 3ZYKA 3AVSA 3MKDA 3ZYMA 5F3JA 4UVAB 3UTKA 5L3EB 2C0SA 3C98B 4TUYE 5IHYA 3TKLB 5L2LA 1B7TA 2VB6A 2X68A 3FBLA 3V5UA 5J2UE 1YKHB 4PFPA 3ZJ2A 2DLRA 2CXLA 2DI4A 3AAEB 1Z0PA 3CPZA 4PNIA 3RKOA 2X0LB 2VKHA 5DQWA 2KWIB 3PUSA 4H63H 4GOUA 5ADXL 5HXRA 3RYHE 3CX7B 5EK4A 5LBMA 3UUMA 5FXWA 3ZMUB 4C90A 2Z6EA 4UV9B 4O4IE 3IHRA 1S94A 1US7B 3RRCA 2H7OA 3P7IA 2DWKA 3EDVA 4YHJA 2K5BB 2ZM0A 2B1EA 3UFEA 1SA0E 5HYAA 2BVMA 4ANJA 5J2TE 2K48A 5L3FB 2NTYA 3GA8A 4I55E 3BQLA 2MOZA 2X9WA 2JQQA 4ZOLE 3MACA 4O4LE 2L8KA 2N1GA 2WWUA 2D0UA 5FYMA 4U72A 2VWAA 2WSSV 3PE0A 3ZC0A 5HXSA 1WLXA 3SOLA 3RPUA 2LSYA 4EOZB 5L3DB 4PFOA 4F6RC 3PUAA 3ZMVB 2KNDA 4DBRA 3ZC1A 2MYSA 5GONE 4PAGA 5L3GB 3AA7B 2LSGA 3MXZA 2CWYA 4V1Av 3HI2A 3E0ZA 3WI3A 2XAGB 3C4WA 2LSKA 2CEAA 2W61A 3T8OA 3C50A 5JDNA 3C51A 3KINB 1KK7A 5FXVA 3LK2B 3UULA 3CX8B 1T98A 1ZKEA 2NOXA 2L9QA 3FHNA 3HKDE 3W15B 5J1GA 1YD8G 3FXEB 2M67A 2X51A 3FXDB 5CB4E 2GK9A 2ZM2A 3IEEA 2X66A 3HR0A 5ETWA 3R84B 4ISSA 1D0XA 2W0GA 3KV5A 4ZS2A 1FEWA 3IBPA 4BA9A 4TV8E 4OFZA 2CXFA 4PK5A 4EXTA 1YKEB 1HCIA 4ZHQE 3U78A 2LJLA 1HTJF 4X1IE 2CCQA 4H9NC 2MBGA 1YW0A 5LP6E 1O3XA 1MNEA 4U74A 3UUNA 2RP4A 2C5KT 2LSIA 4ZI7E 2D2SA 4ZI3C 5HAXA 1U5PA 3ZCJA 1MMGA 3Q9DA 5HWXA 4YFSA 1MMDA 4K0UA 3CQXC 3GMIA 4PK4A 2Q9QA 2Y6XA 3Q5XA 1S35A 4PJMA 4IIJE 3N2OA 5C8YE 4O4HE 5JR9A 3AA6B 2X67A 2DWGA 3M65A 3OJAA 3F57A 5LBQB 4TX5A 3AVRA 3ZEFB 1V9DA 2C5IT 2VKDA 3D0TA 3N9NA 4MHCA 1FMVA 4P0BA 5DABA 3LBXA 4PK6A 3EVYA 3B13A 1IAPA 2A72A 2Q9QC 2IW5B 2W62A 1HG5A 1IJ6A 3N9LA 4AQGA 5LJMA 2ES0A 4NUVA 5A1LA 5JR9C 2X9XA 5LG4A 5TAOA 4GK5E 5LHIB 4H9QC 1SHZC 1MMAA 1KNZA 3O1IA 3PTRB 3ONXA 3CWZB 4QWNB 5HXCA 3BK9A 1MMNA 4DBQA 3RX6A 2RA1A 1NWMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EIW A;  2CEA A;  2CE7 A;  2DI4 A;  2DHR A;  4Z8X A;  4WW0 A;  3KDS E; 
#chains in the Genus database with same CATH topology
 3SFE A;  2QGS A;  2VL8 A;  5LXT E;  2XSA A;  4MAL A;  5FNV E;  5FL1 A;  4DMW A;  1X79 A;  3KV6 A;  3N9Q A;  4UXN B;  3AE4 A;  4CQI A;  5JRC A;  4ASK A;  4PW8 A;  4AIS A;  4UV8 B;  4JI8 T;  2W66 A;  2V6Y A;  2J4G A;  3NRY A;  1IBL T;  3HKE E;  1LKX A;  1IBM T;  4DV1 T;  2VQE T;  5BR8 T;  2PG8 A;  3N9M A;  3N2K E;  2XAJ B;  5JDG A;  2D0T A;  1WRD A;  2PJQ A;  5AFU L;  4F8H A;  1WYC A;  1E1H B;  1I94 T;  3PUR A;  5M4Y A;  5ABE A;  5JR9 B;  5FY1 A;  1W0A A;  4GIW A;  2BG9 E;  4KMC A;  3KFW X;  3AED A;  4G2A A;  2CXD A;  3ZN1 B;  5LMN T;  3NVO A;  5LGN B;  2V1D B;  5AQJ B;  4TN7 B;  2VAS A;  3Q5E A;  3F31 A;  3K8P C;  2BBJ A;  4Q25 A;  4Z90 A;  2CRB A;  2KIN B;  4LMK A;  2IIU A;  4H9R C;  4TNW A;  2ACZ A;  5JRC B;  4AKG A;  3GWH A;  4ZI2 C;  2P9B A;  4QX8 B;  4G63 A;  5LNK A;  4IE7 A;  2ZMA A;  4HN9 A;  2V6Y B;  1UUS A;  3NWI A;  3ETU A;  4PJJ A;  2EHO D;  4BAY B;  4X20 E;  3VR9 A;  3SS1 A;  3AE2 A;  4DV2 T;  5CA1 E;  1LRZ A;  1OXZ A;  1LVF A;  3PU3 A;  2IAK A;  5L4H A;  1HNX T;  2WDR A;  2LOP A;  2JIW A;  2WMO A;  3SRZ A;  4A56 A;  1WR6 A;  4OX9 T;  4E7S A;  2FBW A;  2A9U A;  2UXB T;  5AQG B;  1D1C A;  4UR9 A;  4QX7 B;  3N5L A;  4WNK A;  4UIG A;  2LRL A;  3NZP A;  3AEG A;  4YTN A;  3I0Q A;  3LK4 2;  4L9I A;  1XMO T;  1HG2 A;  3KBU A;  1IZN B;  3H3M A;  2MPK A;  4CXY A;  4HWI B;  1XMQ T;  3NKZ A;  4KBM B;  2WY2 A;  5LHG B;  3AEB A;  4I50 E;  3RYI E;  1HNW T;  2K24 A;  3KV4 A;  5H6R B;  2NW9 A;  4DV7 T;  5L3C B;  2SPC A;  4UF0 A;  2NW7 A;  3KDS E;  1MIW A;  4BJM A;  2OLT A;  5ABF A;  4JI3 T;  5LGU B;  4U33 A;  2CWO A;  4MLK A;  3A8Y C;  3O1J A;  3N9P A;  3RYF E;  4AKH A;  3PU8 A;  3LK3 B;  1KEY A;  4AQF C;  2JJ9 A;  4CXX A;  2D5U A;  5HEO A;  3H3A A;  3BQK A;  4IGU A;  4EAH A;  3CKD A;  4TZ4 C;  2LE8 A;  4O4J E;  4DUY T;  3C4Z A;  5AQO B;  4IDQ A;  3PUY F;  4WYV A;  1OWA A;  2XAS B;  4YSY A;  2LSJ A;  4U2Y A;  2IUB A;  3CQC B;  4JI6 T;  1G73 A;  5FY7 A;  3ZYL A;  5F3J A;  4UVA B;  5L3E B;  3C98 B;  4TUY E;  5IHY A;  2X68 A;  5J2U E;  2IML A;  2X0L B;  2KWI B;  4H63 H;  4GOU A;  5HXR A;  3UUM A;  3ZMU B;  4C90 A;  2XQ4 A;  1US7 B;  3EDV A;  2LKH A;  5AQV B;  2XQ9 A;  5HYA A;  2BVM A;  4ANJ A;  5J2T E;  5AQI B;  1UK5 A;  2K48 A;  2NTY A;  4I55 E;  3BQL A;  2E5L T;  2MOZ A;  2X9W A;  2JQQ A;  4ZOL E;  3MAC A;  2FJD A;  3CK6 A;  2VWA A;  3EI0 A;  2LSY A;  4EOZ B;  4A98 A;  4F6R C;  2KND A;  2HN1 A;  4DBR A;  3E0Z A;  2XAG B;  3C4W A;  2CEA A;  5JDN A;  3C50 A;  3KIN B;  3LK2 B;  1ZKE A;  2NOX A;  3FHN A;  1YD8 G;  5CB4 E;  1XNQ T;  2FJE A;  3R84 B;  4YSZ A;  1HNZ T;  1FEW A;  4EXT A;  2W4X A;  3AXJ A;  5AQT B;  4H9N C;  3AE7 A;  1MNE A;  4U74 A;  3UUN A;  2LSI A;  4ZI7 E;  2D2S A;  1U5P A;  1MMG A;  3AEE A;  2Y6X A;  4IIJ E;  2X67 A;  3P4R A;  3L8R A;  5ABG A;  4IDP A;  2C5I T;  2VKD A;  3N9N A;  4P0B A;  3RIU C;  5C2T A;  2WU5 A;  3EVY A;  2CHO A;  5LMU T;  1IAP A;  3N9L A;  5LJM A;  2ES0 A;  4NUV A;  5JR9 C;  2X9X A;  4GK5 E;  4H9Q C;  1KNZ A;  3O1I A;  3PTR B;  3ONX A;  3CWZ B;  4QWN B;  3RIA A;  4LML A;  2RA1 A;  3QOF A;  1NWM X;  4YJ3 E;  4JI5 T;  2XQA A;  1UX5 A;  5IWA T;  4X1K E;  3PJA J;  2G0U A;  2BG9 A;  3SWH A;  2CM0 A;  3MA9 A;  4CXW A;  4U2Z A;  4L0R A;  5HEG A;  4KI0 F;  1FIO A;  4HGA A;  1IBK T;  2CHN A;  5EK2 A;  4HWH A;  2JQH A;  2FJA A;  2UUB T;  2BZB A;  4HFB A;  5LG3 A;  4YT0 A;  4HTE A;  3RHW A;  5IUX A;  2HN2 A;  2ODV A;  4DR5 T;  2BKN A;  3AA1 B;  4JI4 T;  2UXD T;  2JMK A;  3U3I A;  5JDH A;  4U7I A;  4YXD A;  3ZN0 B;  2ZM6 T;  5L3B B;  1UX4 A;  4QH1 A;  3DTO A;  4U31 A;  2HPJ A;  4EZ4 A;  4NPP A;  2CMR A;  4B3M T;  2H89 A;  2VVS A;  1BR2 A;  4DMV A;  1KNP A;  5C3J A;  3AE1 A;  2IC9 A;  3AB3 B;  2BG9 B;  2XPK A;  4YHH T;  2V7L A;  1ZV4 X;  4DUZ T;  5CA0 E;  3OYX A;  4IST A;  3FZK B;  4DVD A;  4X5T A;  3ZLI A;  2JRK A;  3C4X A;  4AKR B;  4DND A;  4NUU A;  1H7C A;  4IE0 A;  4KHP T;  2E9X D;  2ZLY A;  3RI5 A;  4A5X A;  2XQY A;  4DR4 T;  3A5X A;  1N34 T;  3P8C D;  1I6Z A;  1YQ3 A;  4PJL A;  1QLB A;  2X9H A;  4OYJ A;  1N33 T;  4IL9 A;  3DJB A;  3ZMT B;  1D0Z A;  4YLH A;  4KP3 C;  3UU5 A;  3VRA A;  5FVK A;  2CLY B;  3AEC A;  2XQ6 A;  3UUB A;  5LJN A;  4CN6 A;  4XAX B;  3B5M A;  5HCM A;  3UT5 E;  3QK6 A;  2AXD S;  2EHO A;  4WBO A;  5HXE A;  3I1A A;  5E0O A;  2JMH A;  2CBJ A;  2QRX A;  3OBV E;  4UEL A;  2BS3 A;  3RYC E;  2CBI A;  3CML A;  4IE4 A;  3KBT A;  3K3Q C;  4HFI A;  4IDN A;  3JC6 D;  4FJO A;  4PJN A;  1FMW A;  2N9D A;  1G8X A;  3KV9 A;  4EYU A;  1ZHC A;  2MAW A;  1IJ5 A;  4B3T T;  3O1H A;  4AXP A;  4EIW A;  3LG7 A;  4O8S A;  1HFA A;  2I0M A;  4IDZ A;  2XUE A;  5JTG A;  4HKA A;  1QSD A;  3ONL C;  3WAK A;  2BBH A;  2KMF A;  2UXX B;  3HKB E;  5DJQ C;  4ZZB A;  3OTO T;  3RF1 A;  2HPL A;  3EUH A;  4QXH B;  4GYR A;  2EHO B;  3PDY A;  4N78 D;  1NEN A;  2Y48 B;  2XAH B;  2W2U A;  3HL6 A;  5FL0 A;  3ZSS A;  3AVS A;  3ZYM A;  3UTK A;  3P4W A;  5L2L A;  5KXJ A;  4PFP A;  3AE5 A;  3ZJ2 A;  2BKP A;  2CXL A;  2DI4 A;  1Z0P A;  3CIR A;  3VRB A;  3PUS A;  5ADX L;  5FXW A;  3RQU A;  2YN6 A;  3P4P A;  2H7O A;  2XY8 B;  2DWK A;  4B3R T;  2K5B B;  3UFE A;  1OED A;  4YSX A;  4HFE A;  4JI7 T;  2L8K A;  2N1G A;  4DV3 T;  3ZC0 A;  3PE0 A;  5HXS A;  1T7S A;  3SOL A;  3RPU A;  2BS4 A;  5GON E;  4PAG A;  3AA7 B;  2KSR A;  2CWY A;  2X0H A;  2LSK A;  2W61 A;  1J5E T;  1KK7 A;  3UQ4 A;  3CX8 B;  2L9Q A;  3W15 B;  2YOE A;  2JQK A;  2X51 A;  2ZM2 A;  2X66 A;  4ISS A;  3PUZ F;  3KV5 A;  4BA9 A;  4TV8 E;  4PK5 A;  2CXF A;  3X1D A;  4IL4 A;  1HCI A;  3M3Z B;  2F4V T;  1X9B A;  2LJL A;  1YW0 A;  4KHZ F;  4LFB T;  2C5K T;  5HAX A;  5L4E A;  3Q9D A;  1MMD A;  2IDO B;  2Q9Q A;  2WS3 A;  3TLT A;  1S35 A;  3N2O A;  2RPA A;  2XSB A;  5LBQ B;  3AVR A;  4ZEY A;  2E5V A;  2LM2 A;  3D0T A;  3P4Q A;  3LBX A;  1SUM B;  2XQ5 A;  1IJ6 A;  2WZI A;  5HEJ A;  1Z8U A;  2XQ7 A;  1MMA A;  3BK9 A;  3RX6 A;  3ZCI A;  4ZS3 A;  4EEB A;  4UF0 B;  2YK0 A;  4H9P C;  5ABF B;  3RC8 A;  4CI1 B;  3DP7 A;  4QXB B;  1WYB A;  4QXC B;  4OK0 A;  2V6X A;  2V8S V;  4JI2 T;  3VHL A;  4DV5 T;  4J2C A;  2HH7 A;  1HX8 A;  3FBZ A;  3EAM A;  2V7I A;  1D1B A;  3KVB A;  5JQG E;  2BG9 C;  1J5W A;  1BR1 A;  4XBF B;  3QB5 A;  4DV4 T;  5F5W A;  4EZH A;  4ZI2 D;  1XDP A;  1KF6 A;  2B76 A;  2Q9Q D;  2KZ7 B;  2V7K A;  2Q9Q B;  3PV0 F;  5LB7 B;  3HKC E;  3R6N A;  3VU7 H;  4DID B;  5BMV E;  3LBX B;  4K0K T;  3UFG A;  5JDL A;  1OED E;  4DV0 T;  3I9Y A;  5FXZ A;  4BJN A;  2WAU A;  3J9X 1;  4LF9 T;  5EZY E;  3UUX B;  4JI1 T;  5ABH A;  5LCY A;  5AQK B;  4LF5 T;  2CLY C;  3NZQ A;  4IRE A;  3ESL A;  4UEM A;  2VK9 A;  1W09 A;  1ZP0 A;  3AE3 A;  3ZT5 A;  2YDQ A;  3O9X A;  3HA4 A;  4P09 A;  4C91 A;  2A2F X;  4O2A E;  2DHR A;  5KMG P;  2A3D A;  3K3N A;  2HHH T;  4B6X A;  2J1D G;  3Q5W A;  4IE5 A;  4AIU A;  4IE6 A;  5AQF B;  3QUJ A;  1UUR A;  2QA7 A;  4KUM B;  2IC6 A;  3JC6 C;  4YY3 T;  4ZXL A;  3MZK B;  4CZZ B;  3G06 A;  4CN1 A;  1WCR A;  3LJC A;  2YKS A;  4X64 T;  5FMN A;  3LFM A;  3V5S A;  1YQ4 A;  2V26 A;  3PJA A;  4CI3 B;  2BKO A;  3AEA A;  3AXJ B;  2FJB A;  4ZZC A;  2LT3 A;  1BR0 A;  3ANW A;  2E9X A;  5HEU A;  4L5G A;  1MND A;  1D0Y A;  1VCS A;  3Q2M A;  3CX6 B;  1QUU A;  4Z8X A;  5JDF A;  5FVL A;  4JV5 T;  2IHR 1;  2PTF A;  5KDM C;  5JH7 E;  2EHO C;  4JEH B;  2WDQ A;  1UCU A;  2WP9 A;  1W9R A;  5FKY A;  2H3R A;  1WR0 A;  3K3O A;  2WU2 A;  1D1A A;  1Y64 B;  3ZPO A;  2K3W A;  5JRE A;  3OKQ A;  5AQL B;  5F8P A;  3ZT7 A;  2YIN A;  5AQU B;  2XQ3 A;  1M7K A;  3T1H T;  2CA5 A;  4UVC B;  2BVL A;  3E22 E;  5FP3 A;  4NXN T;  2W63 A;  3RIF A;  4ERR A;  3RC3 A;  4O2B E;  1GQE A;  2M6B A;  3UU8 A;  4GKJ T;  4GK0 E;  2VKO A;  2VUR A;  2I6H A;  4AKL A;  3P50 A;  1NAF A;  1R8I A;  4P1N A;  4HE8 A;  3RRW A;  2NR4 A;  1W0B A;  3ABV A;  4JBW F;  5H6Q B;  1LVK A;  2XAF B;  2KWH A;  3QNU A;  4HWD A;  3ZJ1 A;  2Y8D A;  3ANW B;  2E9X B;  2WBL A;  3T1Y T;  3I0O A;  2VKJ A;  3NRX A;  4IDO A;  4EV6 A;  2CPT A;  2LOS A;  2MTQ A;  1XZY A;  5LYJ E;  4FI5 A;  1FJG T;  3ZT6 A;  3QC9 A;  3ZYK A;  4JI0 T;  4U3C A;  3TKL B;  1SE7 A;  1B7T A;  4DR7 T;  3LDQ B;  2DLR A;  3AAE B;  3RKO A;  5DQW A;  3CX7 B;  3FZL B;  5LBM A;  2UXC T;  2J62 A;  3JAE A;  2Z6E A;  4O4I E;  1S94 A;  3TLU A;  1UGO A;  3P7I A;  3P4S A;  2ZM0 A;  2B1E A;  3ONJ A;  3GA8 A;  5CFB A;  3OVU A;  4U72 A;  2WSS V;  5L3D B;  3RGL A;  1JNZ A;  1E7P A;  3PUA A;  3ZC1 A;  1OED C;  2MYS A;  1VCT A;  5L3G B;  2LSG A;  3IA3 A;  4V1A v;  1HX1 B;  4LFA T;  3C51 A;  5FXV A;  3UUL A;  3HKD E;  4WZX A;  2M67 A;  5AQQ B;  2GK9 A;  2UU9 T;  3HR0 A;  5ETW A;  5AQS B;  3JAF A;  2YDR A;  4ZS2 A;  3AE8 A;  3IBP A;  3LSV A;  1YKE B;  3RQW A;  1HTJ F;  1O3X A;  2XM1 A;  1ZOY A;  2VQF T;  4LFC T;  4JYA T;  3ZCJ A;  3AE6 A;  4YFS A;  4K0U A;  4HFH A;  3CQX C;  3GMI A;  3Q5X A;  4PJM A;  5C8Y E;  4O4H E;  3M65 A;  3OJA A;  2UUC T;  3F57 A;  4X65 T;  1V9D A;  2W67 A;  4PK6 A;  1CHU A;  3B13 A;  4ILB A;  2Q9Q C;  2IW5 B;  2QYW A;  4ILC A;  1DU2 A;  1MMN A;  3VR8 A;  3SFD A;  3MK7 C;  3VKH A;  5FY0 A;  5AQM B;  3AAI A;  2M6I A;  3TLW A;  4I43 B;  5IYZ E;  3B57 A;  3BQI A;  1E2A A;  2C5J A;  3N2G E;  2LHN A;  3F2E A;  3FZM B;  4OHF A;  1YXR A;  1VOM A;  2X9Y A;  2H7V C;  4DO0 A;  4A97 A;  4ZI3 D;  4LMJ A;  2CE7 A;  4AKI A;  1L0V A;  2XZE A;  3Q5D A;  3UU6 A;  4YJ2 E;  3VKG A;  4LF7 T;  1BR4 A;  2NW8 A;  3PUX F;  4IHJ E;  5CGM A;  3FB2 A;  4QH4 A;  3NBX X;  3PUW F;  1HS7 A;  2V5D A;  4TV9 E;  4DR2 T;  2D9D A;  2XM2 A;  2WWV A;  2BS2 A;  1EZ3 A;  1WFD A;  4JEU B;  2PBI A;  5L47 A;  2NP9 A;  4EED A;  4Z91 A;  4QHO A;  5EK3 A;  2NTX A;  2V7J A;  3WAJ A;  5LGT B;  5HEH A;  2AE9 A;  4LF8 T;  2WM9 A;  4JLE A;  4ILA A;  2JPF A;  4GYS A;  3KVA A;  2KLQ A;  2YU1 A;  3GN5 A;  2DCF A;  4OYK A;  4M1P A;  1KFY A;  2WZH A;  2WMN A;  3EAB A;  1J1J A;  3AA0 B;  5LOV E;  4I4T E;  4YTP A;  3ZKR A;  2DL1 A;  1MIY A;  1OED B;  2UUA T;  4WBN E;  4H9S E;  3CQG B;  2WQY A;  4HFV A;  4X1Y E;  4COF A;  2R6G F;  3CVR A;  2L3L A;  4B3S T;  2ZM8 A;  5JDM A;  3AAA B;  2J47 A;  3EHZ A;  3TLS A;  2WB5 A;  4GKK T;  1HF8 A;  3H37 A;  4AI6 A;  4WW0 A;  2LM9 A;  2N2N A;  3QB5 K;  3PUG A;  4E7Z A;  3UQ7 A;  3E08 A;  5JVD E;  3MJX A;  2XTL A;  2YU2 A;  3ZMS B;  3RKG A;  3UU3 A;  3OYZ A;  3PUQ A;  3RH3 A;  5JDQ A;  4UVB B;  4MBQ A;  1CUN A;  4NXM T;  5HWY A;  4LF4 T;  1M62 A;  4H63 V;  4MFR A;  2LHR A;  3I9W A;  3O4X E;  2XAQ B;  3C64 A;  2OA5 A;  2PFV A;  3GN5 B;  2NWB A;  3ZST A;  2W00 A;  3EDU A;  1Y01 A;  2K9A A;  2E9X C;  4CN4 A;  4DR6 T;  3N9O A;  3ZMZ B;  4P0A A;  2OV9 A;  3TLV A;  4AQY T;  3L3P A;  2YEV C;  2XHE B;  5LHH B;  2E8I A;  4JUY A;  2KXP B;  2QVA A;  4I0U A;  4TWD A;  3JAD A;  4AQF A;  2ACX A;  2V7M A;  4ADZ A;  4TNV A;  2UXN B;  5FXX A;  2H88 A;  4X62 T;  5AQH B;  2XQ8 A;  3RLF F;  3UU4 A;  3S4U A;  5KX5 E;  1MIV A;  1ZEE A;  1AJ3 A;  3FZH B;  2DNX A;  4ILU A;  4LF6 T;  3IF8 B;  2FUP A;  2ODU A;  4HWF A;  2KT9 A;  3L39 A;  5HXH A;  3OPC A;  3J7Y q;  2E2A A;  4U7Y A;  1U4Q A;  3JCF A;  2BDE A;  4XZC A;  4QKN A;  1VRB A;  4EYY R;  4HEA A;  3L09 A;  5DQV A;  5AQN B;  4TWF A;  4CI2 B;  4QH5 A;  3AE9 A;  2V5C A;  2WCA A;  2I59 A;  2X0Y A;  4H9O C;  4EB6 E;  3AEF A;  1HR0 T;  3ETV A;  2LEH A;  1XWM A;  4KX6 A;  3MKD A;  4NIQ A;  2C0S A;  3FBL A;  2VB6 A;  3V5U A;  1YKH B;  4PNI A;  3CPZ A;  2VKH A;  3RYH E;  5EK4 A;  3FZF B;  4UV9 B;  3IHR A;  3RRC A;  2VVN A;  1N32 T;  4YHJ A;  5AQR B;  4HWC A;  1SA0 E;  5L3F B;  1N36 T;  1T8B A;  4O4L E;  2WWU A;  2D0U A;  5FYM A;  2VL0 A;  1WLX A;  5HCJ A;  4PFO A;  2LRK A;  3ZMV B;  3MXZ A;  3HI2 A;  2LLY A;  3WI3 A;  3T8O A;  1T98 A;  4TWH A;  5J1G A;  3FXE B;  4IT4 A;  3FXD B;  3IEE A;  1JNR A;  1D0X A;  4EGW A;  4X66 T;  3PUV F;  2W0G A;  1XDO A;  2WDV A;  4OFZ A;  1XNR T;  4ZHQ E;  3U78 A;  2LKG A;  4X1I E;  1NEK A;  2CCQ A;  2MBG A;  5LP6 E;  2YDS A;  2JQ9 A;  2RP4 A;  4DV6 T;  2XJ7 A;  3RIU A;  4ZI3 C;  5HWX A;  1T72 A;  5J0Z A;  4PK4 A;  3A7M A;  4DR3 T;  5JR9 A;  3AA6 B;  2DWG A;  4TX5 A;  3ZEF B;  4MHC A;  1FMV A;  5DAB A;  3K1S A;  1KNR A;  2A72 A;  2W62 A;  1HG5 A;  4HFD A;  5AQP B;  4YTM A;  4HFC A;  4AQG A;  5A1L A;  5LG4 A;  5TAO A;  5LHI B;  1SHZ C;  4DR1 T;  5CJ5 A;  5HXC A;  4DBQ A;  5LA6 E; 
#chains in the Genus database with same CATH homology
 3MK7 C;  3VKH A;  2QGS A;  2VL8 A;  5FY0 A;  4YJ3 E;  5LXT E;  4MAL A;  3ZCI A;  5FNV E;  4ZS3 A;  3AAI A;  1UX5 A;  4DMW A;  1X79 A;  4I43 B;  4X1K E;  5IYZ E;  3KV6 A;  4UF0 B;  2YK0 A;  3N9Q A;  3B57 A;  4H9P C;  4UXN B;  2G0U A;  4CQI A;  5JRC A;  3RC8 A;  3BQI A;  4ASK A;  4CI1 B;  3DP7 A;  2C5J A;  3N2G E;  4QXB B;  1WYB A;  2LHN A;  4PW8 A;  3F2E A;  4QXC B;  4OHF A;  3SWH A;  2CM0 A;  3MA9 A;  1VOM A;  2X9Y A;  2H7V C;  4OK0 A;  4UV8 B;  4DO0 A;  4CXW A;  3VHL A;  4L0R A;  4ZI3 D;  4J2C A;  2CE7 A;  2HH7 A;  3NRY A;  1HX8 A;  4AKI A;  3FBZ A;  3HKE E;  1LKX A;  1FIO A;  4YJ2 E;  3VKG A;  4HGA A;  1BR4 A;  2NW8 A;  4IHJ E;  2V7I A;  1D1B A;  3KVB A;  5JQG E;  5EK2 A;  3FB2 A;  1BR1 A;  4XBF B;  2PG8 A;  3NBX X;  3N9M A;  3N2K E;  2XAJ B;  4EZH A;  1HS7 A;  2BZB A;  5JDG A;  4ZI2 D;  2D0T A;  1WRD A;  2PJQ A;  4TV9 E;  2Q9Q D;  4HTE A;  2KZ7 B;  2V7K A;  5AFU L;  1WYC A;  1E1H B;  2Q9Q B;  3PUR A;  5M4Y A;  3HKC E;  5JR9 B;  3R6N A;  5FY1 A;  3VU7 H;  4GIW A;  2ODV A;  1EZ3 A;  5BMV E;  4JEU B;  2PBI A;  4KMC A;  3KFW X;  3AA1 B;  3LBX B;  2NP9 A;  4G2A A;  2CXD A;  3ZN1 B;  4QHO A;  2JMK A;  3U3I A;  5JDH A;  5JDL A;  5LGN B;  5EK3 A;  2NTX A;  2V7J A;  2V1D B;  3WAJ A;  5LGT B;  3ZN0 B;  3I9Y A;  4TN7 B;  5FXZ A;  4BJN A;  2WAU A;  5L3B B;  1UX4 A;  3DTO A;  3J9X 1;  2HPJ A;  2WM9 A;  5EZY E;  2VAS A;  4JLE A;  3UUX B;  4EZ4 A;  2JPF A;  3F31 A;  4GYS A;  3K8P C;  5LCY A;  2CMR A;  2CLY C;  3KVA A;  2KLQ A;  3NZQ A;  3ESL A;  1BR2 A;  2YU1 A;  4UEM A;  2KIN B;  2VK9 A;  4DMV A;  3GN5 A;  2DCF A;  4OYK A;  4M1P A;  2WMN A;  2IC9 A;  4H9R C;  3O9X A;  3HA4 A;  5JRC B;  4AKG A;  3AB3 B;  3GWH A;  4P09 A;  4C91 A;  3AA0 B;  5LOV E;  4ZI2 C;  2P9B A;  4QX8 B;  4I4T E;  4G63 A;  5LNK A;  2A2F X;  2V7L A;  4O2A E;  1ZV4 X;  2DHR A;  4IE7 A;  2ZMA A;  5KMG P;  4HN9 A;  1MIY A;  5CA0 E;  4WBN E;  3OYX A;  4IST A;  2A3D A;  3K3N A;  4DVD A;  4H9S E;  3CQG B;  4HFV A;  4X1Y E;  3ZLI A;  4B6X A;  2J1D G;  2JRK A;  3C4X A;  3CVR A;  3ETU A;  3Q5W A;  4IE5 A;  2L3L A;  4AKR B;  4DND A;  4IE6 A;  1H7C A;  2EHO D;  3QUJ A;  4NUU A;  4PJJ A;  4BAY B;  4IE0 A;  2ZM8 A;  4X20 E;  5JDM A;  2QA7 A;  3SS1 A;  2E9X D;  2ZLY A;  3AAA B;  5CA1 E;  1LRZ A;  1OXZ A;  1LVF A;  3PU3 A;  4KUM B;  2IAK A;  2XQY A;  2IC6 A;  3A5X A;  3JC6 C;  3P8C D;  3MZK B;  2LOP A;  4CZZ B;  1HF8 A;  3H37 A;  2WMO A;  3SRZ A;  4PJL A;  4AI6 A;  4WW0 A;  4A56 A;  1WR6 A;  3LJC A;  2LM9 A;  2N2N A;  2X9H A;  3PUG A;  4E7Z A;  4E7S A;  4OYJ A;  3E08 A;  5JVD E;  3DJB A;  3MJX A;  3ZMT B;  2XTL A;  2YU2 A;  5FMN A;  3LFM A;  3V5S A;  1D0Z A;  3ZMS B;  2V26 A;  1D1C A;  4YLH A;  4KP3 C;  4QX7 B;  3N5L A;  3OYZ A;  4WNK A;  3PUQ A;  2CLY B;  4UIG A;  3RH3 A;  5JDQ A;  4UVB B;  4CI3 B;  4MBQ A;  1CUN A;  3NZP A;  5HWY A;  5LJN A;  3I0Q A;  3LK4 2;  4H63 V;  4L9I A;  4MFR A;  2LHR A;  3I9W A;  3O4X E;  4XAX B;  1HG2 A;  3KBU A;  1IZN B;  3UT5 E;  3QK6 A;  2XAQ B;  2EHO A;  2LT3 A;  4CXY A;  3C64 A;  2OA5 A;  4WBO A;  1BR0 A;  5HXE A;  3ANW A;  2E9X A;  3I1A A;  5E0O A;  2PFV A;  1MND A;  4L5G A;  1D0Y A;  2JMH A;  3Q2M A;  3CX6 B;  1QUU A;  2NWB A;  3GN5 B;  4KBM B;  4Z8X A;  3OBV E;  5JDF A;  2W00 A;  3EDU A;  4UEL A;  5KDM C;  5LHG B;  4I50 E;  3RYI E;  5JH7 E;  2EHO C;  2K9A A;  2K24 A;  4JEH B;  1UCU A;  2E9X C;  3RYC E;  3KV4 A;  3N9O A;  3ZMZ B;  4P0A A;  3CML A;  5H6R B;  4IE4 A;  3KBT A;  2NW9 A;  3K3Q C;  3L3P A;  2H3R A;  5L3C B;  2YEV C;  2SPC A;  2XHE B;  5LHH B;  3JC6 D;  4FJO A;  2E8I A;  2NW7 A;  4PJN A;  3KDS E;  4UF0 A;  4JUY A;  2KXP B;  1MIW A;  3K3O A;  4BJM A;  1D1A A;  1Y64 B;  1FMW A;  3ZPO A;  5LGU B;  4AQF A;  2ACX A;  2CWO A;  2N9D A;  5JRE A;  1G8X A;  3KV9 A;  4EYU A;  3OKQ A;  4MLK A;  5F8P A;  1ZHC A;  2V7M A;  2YIN A;  1IJ5 A;  4ADZ A;  3O1J A;  2UXN B;  3N9P A;  3RYF E;  2CA5 A;  5FXX A;  4AKH A;  3O1H A;  4UVC B;  4AXP A;  4EIW A;  3PU8 A;  3S4U A;  2BVL A;  3E22 E;  3LG7 A;  3LK3 B;  4O8S A;  1MIV A;  1ZEE A;  5KX5 E;  1AJ3 A;  4AQF C;  5FP3 A;  2JJ9 A;  2DNX A;  4ILU A;  1HFA A;  2W63 A;  3IF8 B;  4IDZ A;  2XUE A;  2ODU A;  4CXX A;  4HKA A;  1QSD A;  4ERR A;  2D5U A;  3RC3 A;  2KT9 A;  4O2B E;  5HXH A;  3H3A A;  3J7Y q;  4GK0 E;  3WAK A;  3BQK A;  2KMF A;  2UXX B;  4IGU A;  4EAH A;  3HKB E;  2VKO A;  1U4Q A;  3CKD A;  4TZ4 C;  4AKL A;  5DJQ C;  1NAF A;  4HE8 A;  2LE8 A;  4O4J E;  2BDE A;  3RRW A;  3C4Z A;  4XZC A;  4QKN A;  2HPL A;  5H6Q B;  1LVK A;  5LA6 E;  1VRB A;  3EUH A;  2XAF B;  4EYY R;  4HEA A;  4QXH B;  3L09 A;  4GYR A;  5DQV A;  2KWH A;  4CI2 B;  1OWA A;  2EHO B;  2XAS B;  3ZJ1 A;  2LSJ A;  2Y8D A;  3ANW B;  2E9X B;  2WBL A;  3PDY A;  3CQC B;  2I59 A;  4N78 D;  1G73 A;  5FY7 A;  3I0O A;  2VKJ A;  2Y48 B;  3NRX A;  4H9O C;  4EB6 E;  2LOS A;  2MTQ A;  2XAH B;  3HL6 A;  3ZYL A;  3ETV A;  5LYJ E;  4FI5 A;  2LEH A;  3QC9 A;  3ZYK A;  3AVS A;  3MKD A;  3ZYM A;  5F3J A;  4UVA B;  3UTK A;  5L3E B;  2C0S A;  3C98 B;  4TUY E;  5IHY A;  3TKL B;  5L2L A;  1B7T A;  2VB6 A;  2X68 A;  3FBL A;  3V5U A;  5J2U E;  1YKH B;  4PFP A;  3ZJ2 A;  2DLR A;  2CXL A;  2DI4 A;  3AAE B;  1Z0P A;  3CPZ A;  4PNI A;  3RKO A;  2X0L B;  2VKH A;  5DQW A;  2KWI B;  3PUS A;  4H63 H;  4GOU A;  5ADX L;  5HXR A;  3RYH E;  3CX7 B;  5EK4 A;  5LBM A;  3UUM A;  5FXW A;  3ZMU B;  4C90 A;  2Z6E A;  4UV9 B;  4O4I E;  3IHR A;  1S94 A;  1US7 B;  3RRC A;  2H7O A;  3P7I A;  2DWK A;  3EDV A;  4YHJ A;  2K5B B;  2ZM0 A;  2B1E A;  3UFE A;  1SA0 E;  5HYA A;  2BVM A;  4ANJ A;  5J2T E;  2K48 A;  5L3F B;  2NTY A;  3GA8 A;  4I55 E;  3BQL A;  2MOZ A;  2X9W A;  2JQQ A;  4ZOL E;  3MAC A;  4O4L E;  2L8K A;  2N1G A;  2WWU A;  2D0U A;  5FYM A;  4U72 A;  2VWA A;  2WSS V;  3PE0 A;  3ZC0 A;  5HXS A;  1WLX A;  3SOL A;  3RPU A;  2LSY A;  4EOZ B;  5L3D B;  4PFO A;  4F6R C;  3PUA A;  3ZMV B;  2KND A;  4DBR A;  3ZC1 A;  2MYS A;  5GON E;  4PAG A;  5L3G B;  3AA7 B;  2LSG A;  3MXZ A;  2CWY A;  4V1A v;  3HI2 A;  3E0Z A;  3WI3 A;  2XAG B;  3C4W A;  2LSK A;  2CEA A;  2W61 A;  3T8O A;  3C50 A;  5JDN A;  3C51 A;  3KIN B;  1KK7 A;  5FXV A;  3LK2 B;  3UUL A;  3CX8 B;  1T98 A;  1ZKE A;  2NOX A;  2L9Q A;  3FHN A;  3HKD E;  3W15 B;  5J1G A;  1YD8 G;  3FXE B;  2M67 A;  2X51 A;  3FXD B;  5CB4 E;  2GK9 A;  2ZM2 A;  3IEE A;  2X66 A;  3HR0 A;  5ETW A;  3R84 B;  4ISS A;  1D0X A;  2W0G A;  3KV5 A;  4ZS2 A;  1FEW A;  3IBP A;  4BA9 A;  4TV8 E;  4OFZ A;  2CXF A;  4PK5 A;  4EXT A;  1YKE B;  1HCI A;  4ZHQ E;  3U78 A;  2LJL A;  1HTJ F;  4X1I E;  2CCQ A;  4H9N C;  2MBG A;  1YW0 A;  5LP6 E;  1O3X A;  1MNE A;  4U74 A;  3UUN A;  2RP4 A;  2C5K T;  2LSI A;  4ZI7 E;  2D2S A;  4ZI3 C;  5HAX A;  1U5P A;  3ZCJ A;  1MMG A;  3Q9D A;  5HWX A;  4YFS A;  1MMD A;  4K0U A;  3CQX C;  3GMI A;  4PK4 A;  2Q9Q A;  2Y6X A;  3Q5X A;  1S35 A;  4PJM A;  4IIJ E;  3N2O A;  5C8Y E;  4O4H E;  5JR9 A;  3AA6 B;  2X67 A;  2DWG A;  3M65 A;  3OJA A;  3F57 A;  5LBQ B;  4TX5 A;  3AVR A;  3ZEF B;  1V9D A;  2C5I T;  2VKD A;  3D0T A;  3N9N A;  4MHC A;  1FMV A;  4P0B A;  5DAB A;  3LBX A;  4PK6 A;  3EVY A;  3B13 A;  1IAP A;  2A72 A;  2Q9Q C;  2IW5 B;  2W62 A;  1HG5 A;  1IJ6 A;  3N9L A;  4AQG A;  5LJM A;  2ES0 A;  4NUV A;  5A1L A;  5JR9 C;  2X9X A;  5LG4 A;  5TAO A;  4GK5 E;  5LHI B;  4H9Q C;  1SHZ C;  1MMA A;  1KNZ A;  3O1I A;  3PTR B;  3ONX A;  3CWZ B;  4QWN B;  5HXC A;  3BK9 A;  1MMN A;  4DBQ A;  3RX6 A;  2RA1 A;  1NWM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...