2DI4A

Crystal structure of the ftsh protease domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
176
Chain Sequence
TISPKEKEKIAIHEAGHALMGLVSDDDDKVHKISIIKHIYDKKDLYNKILVLLGGRAAEEVFFGKDGITTGAENDLQRATDLAYRMVSMWGMSDKVGPIAIRRTAVDTSPDLLREIDEEVKRIITEQYEKAKAIVEEYKEPLKAVVKKLLEKETITCEEFVEVFKLYGIELKDKCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Whole Cytosolic Region of ATP-Dependent Protease FtsH
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords Cell division protein ftsH homolog
total genus 59
structure length 176
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2006-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01434 Peptidase_M41 Peptidase family M41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.760 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2di4A00
2DI4A 3KDSE 4Z8XA 4EIWA 2CEAA 2CE7A 4WW0A 2DHRA
chains in the Genus database with same CATH superfamily
1MMDA 5FY0A 4WYVA 1ZV4X 3UU4A 3EHZA 5H6QB 3RI5A 2E9XA 4IL9A 2CBJA 5JRCA 3PUWF 4UELA 3AEGA 3NWIA 3LBXA 4PJJA 3KV4A 4AKIA 4TN7B 5AQTB 2LLYA 2NP9A 4MHCA 3P4SA 3ZT5A 3MA9A 3ANWA 2DWKA 4QX8B 5LMUT 3D0TA 4YTMA 1YKHB 4ZI2D 2W63A 3WAKA 2VB6A 4TV9E 3NRYA 4ILAA 4O2AE 1QUUA 3T1HT 1JNRA 1Y01A 2XY8B 1UUSA 3AE1A 4PAGA 5FP3A 2NTYA 3KBUA 3E0ZA 3F31A 2MPKA 5JDFA 4HN9A 2UUCT 1XNQT 2V6XA 1H7CA 3BQIA 4ILCA 4MLKA 3QB5K 5E0OA 4QWNB 3RYHE 4DV1T 2ZM8A 1HX8A 1BR0A 2E9XD 3X1DA 4ZI3D 2NTXA 3T8OA 2Y48B 5L3GB 4I50E 4ASKA 2CLYB 3HL6A 3IA3A 2A72A 3JAFA 3KV9A 3WI3A 4OYKA 3UU5A 4UEMA 2ODUA 3MACA 3O1IA 1I6ZA 2BBHA 1VCTA 4HFCA 5HEJA 5L3EB 2X67A 3C4ZA 3UTKA 2XAQB 3EABA 3HKEE 2YEVC 3LSVA 3O1HA 4EGWA 3AA1B 5TAOA 3EI0A 4Z91A 3SS1A 4EYYR 4HWFA 1WLXA 3RPUA 4H9SE 1WR6A 3L3PA 2PTFA 2H88A 2NWBA 1YD8G 2FUPA 3Q9DA 2Q9QD 4GOUA 4X20E 5FMNA 4DBQA 1O3XA 3KINB 5IUXA 2CXFA 3RHWA 4ZXLA 2LHNA 4QHOA 2BDEA 3R6NA 2X9XA 1YW0A 3UUNA 3UUXB 5AQSB 4YLHA 5EK3A 4DVDA 3EAMA 2VL8A 1NEKA 2UU9T 2D0UA 2V6YA 2XQ3A 4TNVA 4QH4A 3PURA 4JUYA 2DHRA 3AE7A 2VVNA 2G0UA 1LVFA 2QVAA 3N9PA 4HTEA 3AEAA 2KNDA 4TWHA 2WQYA 3V5SA 2VQET 4AQYT 1HNXT 3HR0A 5DQVA 3AECA 3BK9A 3RC3A 3VR8A 4ERRA 1WFDA 5ABEA 4YFSA 3MKDA 4X64T 4XBFB 3KVBA 4OX9T 4AI6A 3AXJA 4P0BA 5HEOA 2IDOB 3ZYLA 5CFBA 4YJ2E 4DR2T 3FZMB 1J5WA 2BG9A 2UXDT 2LE8A 5LNKA 1YQ3A 3VU7H 2JQQA 2CBIA 2LKGA 4F6RC 3PUVF 2IAKA 2CHNA 5JR9B 4AKGA 3ZT6A 2B76A 2J62A 2EHOB 3M3ZB 2CCQA 2CA5A 4YHJA 3ZCIA 4UF0A 4HFDA 5ABHA 2CWOA 3SRZA 2XAHB 4Z8XA 3UQ4A 4A56A 2P9BA 3IHRA 4E7ZA 3MZKB 3JC6C 4X65T 2V6YB 2YDRA 2NW8A 1HS7A 3CQXC 4UVAB 3B5MA 4GKKT 4I0UA 2YN6A 4O4JE 4PFPA 2Q9QC 5F5WA 2YINA 4WNKA 4CI3B 3N5LA 4H63H 3RIFA 4ZI7E 4KX6A 5LG3A 1B7TA 1HG2A 2XQ7A 3HA4A 5LG4A 5L2LA 4U3CA 2VQFT 1XDPA 3OKQA 1S94A 2E2AA 3K3NA 4L0RA 2WZHA 3C98B 2V7LA 4EEDA 3PUAA 2E9XB 4B3MT 2C0SA 2WWUA 4ISSA 2VKHA 4TNWA 5ETWA 2FBWA 4GK0E 4GYRA 4YTPA 4TUYE 5FXXA 3TLUA 4JI1T 3ZN1B 1HR0T 1OEDC 3ABVA 3L09A 4U33A 4QH1A 2LSYA 2WAUA 4JI3T 2I0MA 4TV8E 4IDOA 4IE0A 2NW7A 2W2UA 4E7SA 2WDQA 4KI0F 3FZLB 4AISA 2L3LA 4CI1B 3GN5A 2C5IT 1MMNA 3AE5A 4WZXA 2L9QA 3H37A 1ZP0A 4H9RC 2ES0A 5LOVE 4DR6T 1MIYA 1MNDA 1VRBA 2V5DA 3ETUA 1NWMX 4FI5A 4LMJA 3RIAA 2IMLA 2B1EA 2EHOD 2WB5A 3PUXF 3AB3B 2J4GA 1SA0E 2CE7A 2MOZA 3DP7A 2XM1A 3LDQB 3ONXA 4PJLA 4EAHA 1UURA 2WU2A 2LRKA 5JVDE 3RF1A 2YDQA 3ZMVB 1HF8A 4IT4A 5ABFB 4LFBT 3RGLA 1IBKT 3PUGA 4NUVA 1D0XA 2EHOC 2XZEA 5BMVE 4IIJE 2LM9A 2LJLA 2UXCT 2PBIA 1IBLT 2ACXA 3FXDB 4DR3T 3UU3A 1IJ6A 4U72A 1I94T 2HHHT 3K3QC 2BG9B 2XQ4A 3H3AA 3UU8A 2M6IA 2WSSV 2FJAA 2X0HA 3AE3A 4UVCB 3C51A 5HEGA 4AXPA 4YT0A 3CX8B 4XZCA 2QYWA 1KF6A 3ETVA 5HYAA 4Z90A 2A3DA 5A1LA 4DV6T 3A8YC 2X0LB 4P1NA 1E1HB 1ZEEA 1ZKEA 2ZMAA 5LGUB 3RC8A 3S4UA 4CI2B 4CXWA 2H3RA 2XAGB 3IBPA 3PU8A 5LHHB 1OXZA 2W66A 4LMLA 4CQIA 3VKHA 4QXHB 1UX5A 5LGNB 3AEEA 3BQKA 3BQLA 2HPLA 5AQVB 4IDNA 4UV9B 4WBOA 2ODVA 4DUZT 1CHUA 1SE7A 3MXZA 4PK4A 2BS4A 1KEYA 3CQCB 3RX6A 2LEHA 2LM2A 3JCFA 4HFEA 3ZLIA 3CIRA 4AQGA 3KBTA 4CXYA 3SFEA 1N34T 4ILUA 4JBWF 4GKJT 4DR4T 1IZNB 3NKZA 3V5UA 5HWYA 4JLEA 3UULA 4P0AA 4J2CA 3RYFE 1IBMT 3AA7B 4BA9A 1MMGA 2BKPA 2VVSA 4WBNE 3C64A 5HCJA 4DNDA 3UFGA 2AE9A 5JR9A 5ABGA 2MBGA 3MK7C 4U2YA 4A5XA 3HKCE 1BR4A 2C5KT 4ISTA 3UT5E 4EZHA 1J5ET 3AE9A 2XQAA 5DJQC 1EZ3A 5CB4E 4IE5A 3ZKRA 1HFAA 2LT3A 4KP3C 4EV6A 4HWHA 2E9XC 3RRWA 5HXHA 3PV0F 2VKJA 3PDYA 2KWHA 4UF0B 2DI4A 5C3JA 3P50A 4HWDA 5J2UE 2UXBT 2EHOA 2WCAA 5LHGB 5J1GA 3PUSA 3H3MA 4HFVA 4QKNA 5HEHA 3ZMUB 5L47A 1N32T 1HNWT 3OYXA 1OWAA 2W0GA 3SOLA 5KX5E 1Z0PA 2X68A 2I59A 3L39A 3OYZA 1WYCA 4JYAT 2WMOA 2CWYA 3CQGB 1JNZA 4H63V 3LFMA 4JI0T 5AQMB 5AQJB 5AQQB 3B13A 2K48A 3LK42 5AFUL 3P8CD 2LRLA 2XM2A 4IE4A 1FIOA 3N2GE 1LRZA 3OVUA 3PUZF 2NW9A 5LXTE 4IDPA 2MAWA 3HKBE 3N9MA 3P7IA 5L4EA 3O4XE 1U5PA 1HX1B 4X5TA 3UUBA 2JJ9A 4ADZA 4O2BE 4X66T 2AXDS 3AEBA 3J9X1 2LSJA 4KBMB 2KZ7B 4WW0A 3UQ7A 3P4PA 5CA1E 3AEFA 1YXRA 4EB6E 2UXXB 3GN5B 3PJAA 4PK6A 4C90A 5LB7B 4IE7A 3AE8A 2BG9C 4DV3T 4KMCA 5JR9C 1D1AA 4ZZCA 1KFYA 4HWCA 3RIUA 4YTNA 5JQGE 2JMKA 5F8PA 3FBLA 1L0VA 2H7OA 2KXPB 3PUYF 4CZZB 2N9DA 2XQ6A 4GIWA 2NOXA 2CHOA 5C8YE 4YSXA 1FMWA 4DV5T 2HPJA 5LBQB 2RA1A 3R84B 2UUAT 4LFCT 4K0KT 5HAXA 3A5XA 4YSYA 4YXDA 1G73A 3OTOT 2XASB 4ZOLE 3NVOA 5HCMA 2BS2A 4AKHA 1YKEB 4IHJE 3EDUA 4JI2T 2YKSA 5HXCA 2VKOA 4JI7T 2WMNA 3NRXA 1ZHCA 2BZBA 3TLSA 2BVMA 3UU6A 5JRCB 4KHPT 3PE0A 2YK0A 3I0QA 2HH7A 1WYBA 3KV5A 3N9NA 4L5GA 4PJNA 3QC9A 3ZJ2A 3AA0B 5H6RB 2RP4A 4B6XA 4MBQA 3NBXX 2Y8DA 2LOSA 2ZM2A 3B57A 4CN6A 1N36T 3NZQA 5F3JA 4AQFA 1T72A 2LSGA 2WM9A 3C4XA 3ONLC 3KVAA 3J7Yq 3ZMTB 3ANWB 2E5LT 2CM0A 4LF4T 3QUJA 3FBZA 2KT9A 3KFWX 4V1Av 3OBVE 5JDHA 4JI4T 5J2TE 2XAFB 3ZN0B 1G8XA 2XQ5A 3F57A 3P4WA 3QNUA 4IDQA 3RH3A 2YU2A 5IYZE 3GA8A 4K0UA 5FNVE 4NPPA 2CMRA 4UV8B 3TLWA 1T98A 3MJXA 4HGAA 4F8HA 2C5JA 4YY3T 3Q5WA 3ZCJA 3ONJA 1DU2A 3I0OA 3TKLB 1MMAA 3UUMA 3QOFA 4U31A 1UCUA 5JREA 2WY2A 3K3OA 1X79A 4MFRA 2DNXA 3AAAB 3LBXB 2JQKA 5AQIB 5IHYA 2V7KA 5AQNB 3U78A 5L3FB 5L3BB 3GMIA 5HXEA 5LGTB 1E2AA 1QLBA 2ACZA 1V9DA 5LA6E 2CEAA 4ZI3C 2YDSA 1Y64B 1KK7A 4DO0A 3CPZA 1OEDB 3ZPOA 5HWXA 2L8KA 3JC6D 2WBLA 2VASA 3OPCA 1HG5A 2W00A 4PJMA 4DBRA 5JDGA 2LSIA 2E5VA 1D0ZA 2PG8A 3AVSA 4KHZF 1W0AA 1WR0A 4FJOA 4U7YA 3CX6B 3PTRB 4TZ4C 3RKGA 4TWFA 1MIVA 3FB2A 4HWIB 1W9RA 2N1GA 2X0YA 5LYJE 4IREA 4DV7T 4EYUA 4NUUA 2J1DG 2W62A 2JQ9A 1FEWA 3PU3A 3ZC1A 4AKLA 1T7SA 5CJ5A 4IL4A 2D0TA 5FY1A 4MALA 3T1YT 3VHLA 4H9PC 3LG7A 4OHFA 1BR1A 5EK4A 5LBMA 1FMVA 4IDZA 3N9LA 4Q25A 5FY7A 5L4HA 5L3DB 2FJDA 2PFVA 4QH5A 5DABA 4DIDB 3SWHA 4B3TT 2V7IA 3RYIE 2VWAA 1BR2A 2WP9A 3P4QA 4JEUB 2LHRA 1AJ3A 4HFHA 4DV4T 2MYSA 2A9UA 2K3WA 3ZC0A 3O9XA 4DMVA 3QB5A 1LVKA 1US7B 2KINB 4LMKA 5EZYE 2K24A 2OA5A 2XJ7A 4ILBA 4NXMT 3ZJ1A 5L3CB 3IF8B 2X9HA 3JADA 4A98A 3CMLA 3NZPA 2LOPA 3RYCE 1XNRT 2BVLA 1W09A 2I6HA 1XZYA 3CKDA 4I4TE 3ZSTA 4DUYT 1YQ4A 1XMOT 4O4LE 2YU1A 2ZM0A 2K5BB 4CN1A 4NIQA 2YOEA 4ZEYA 1J1JA 4LF7T 4DR5T 4BJNA 4LF5T 1KNPA 3FZFB 2Y6XA 3DJBA 3PUQA 1E7PA 4JI5T 1WCRA 3I1AA 2IW5B 5JDMA 2OLTA 5JDNA 3N2KE 5LHIB 2XSAA 3HKDE 4P09A 4PFOA 3RQWA 5HXRA 5JDLA 5JH7E 4B3ST 1M62A 2HN2A 4M1PA 2MTQA 2CPTA 1D1BA 4EOZB 5LJNA 1FJGT 3ZYMA 3G06A 3KV6A 2X9WA 2W4XA 4QX7B 2D2SA 2H89A 2SPCA 1CUNA 1D0YA 3JAEA 3RKOA 4UXNB 2Q9QA 4YSZA 5M4YA 3K8PC 4NXNT 5IWAT 1VOMA 2CXLA 2CRBA 2WS3A 2D9DA 3CK6A 2XSBA 4A97A 5DQWA 3SFDA 4I55E 3IEEA 2WDRA 3N9QA 3L8RA 2VK9A 1MNEA 1GQEA 2BKOA 4X1YE 1U4QA 2FJEA 5ADXL 4X1IE 4DV0T 3F2EA 3LJCA 3Q5DA 1OEDE 4YHHT 5AQOB 4O8SA 1XMQT 3VKGA 5FXZA 2W61A 3A7MA 3OJAA 1NAFA 4QXCB 2WDVA 5EK2A 2V1DB 2WU5A 5AQPB 3AE2A 3TLTA 5LP6E 4EEBA 1KNZA 2XQ8A 5FKYA 2IHR1 2V5CA 4BJMA 4ANJA 2XHEB 1VCSA 4TX5A 2JRKA 5JDQA 3N2OA 5KMGP 4LF9T 3LK3B 2LSKA 2JMHA 3EUHA 3P4RA 2GK9A 4H9NC 3ZT7A 3E08A 2FJBA 3Q5XA 2XTLA 2OV9A 1UX4A 5LCYA 3ZMZB 4DR7T 1Z8UA 2KSRA 5FYMA 5C2TA 4CN4A 2ZM6T 5CGMA 4U74A 3AAIA 2WZIA 5KDMC 2XQYA 5J0ZA 1ZOYA 3K1SA 4LF8T 4L9IA 4EIWA 2IC6A 2BG9E 3ESLA 5AQUB 5LMNT 3AA6B 1QSDA 2M6BA 3CWZB 1KNRA 2BBJA 3N9OA 4PNIA 4ZS3A 4OK0A 5FXVA 3QK6A 3UFEA 3GWHA 5FL1A 2KMFA 2XAJB 3EVYA 5KXJA 2R6GF 4GYSA 4DV2T 1OEDA 4UR9A 4H9OC 3Q5EA 1R8IA 4OYJA 2UXNB 3C50A 5FVKA 4U2ZA 4AKRB 4TWDA 4EZ4A 4ZI2C 3HI2A 1T8BA 2K9AA 5FL0A 5GONE 1HTJF 2JIWA 4BAYB 2PJQA 2IUBA 2X66A 4GK5E 3W15B 2Q9QB 2QRXA 4LF6T 2D5UA 2V7MA 3CVRA 2F4VT 5HXSA 3AE6A 4JV5T 2JPFA 3PJAJ 1IJ5A 4IE6A 3VRAA 4PW8A 4X1KE 3WAJA 4N78D 4O4IE 2UUBT 3ZSSA 4U7IA 2LKHA 4PK5A 4AIUA 2X51A 4ZS2A 1HNZT 3AEDA 2DCFA 2VL0A 4DR1T 2J47A 3FZKB 2BKNA 4QXBB 3E22E 4HFBA 3VRBA 5AQRB 1X9BA 3VR9A 4G2AA 4COFA 4LFAT 4IGUA 5AQGB 5JTGA 2VKDA 1HCIA 1XWMA 1UGOA 5AQFB 4EXTA 2RPAA 4H9QC 3I9WA 4B3RT 2X9YA 5AQHB 2N2NA 4HEAA 3I9YA 2WWVA 3RIUC 1WRDA 3RLFF 3ZYKA 2NR4A 3FZHB 1D1CA 3ZEFB 5HEUA 4XAXB 4X62T 2KLQA 2DL1A 3AXJB 4OFZA 4JI6T 1M7KA 2V8SV 2CLYC 4KUMB 4AQFC 1LKXA 2BS3A 3EDVA 4UVBB 3ZMSB 2E8IA 2M67A 3AVRA 1XDOA 2JQHA 4G63A 3DTOA 3O1JA 2QA7A 3M65A 3C4WA 4DMWA 3RRCA 4HE8A 5BR8T 2XQ9A 2Z6EA 2HN1A 3AAEB 4UIGA 4HKAA 5FVLA 4ZHQE 5LJMA 3FHNA 2H7VC 2XUEA 3KDSE 3RQUA 1SUMB 5FXWA 4I43B 4JI8T 3Q2MA 4C91A 2VURA 3AE4A 1MIWA 2V26A 2DLRA 5ABFA 4JEHB 2DWGA 2XPKA 3CX7B 2CXDA 2IC9A 2ZLYA 2A2FX 1UK5A 2IIUA 4HFIA 4O4HE 4YJ3E 3TLVA 1S35A 2QGSA 2V7JA 2W67A 4CXXA 4ZZBA 5CA0E 5AQLB 1N33T 1IAPA 1SHZC 1W0BA 3FXEB 5AQKB 1NENA 3U3IA 2KWIB 3LK2B
chains in the Genus database with same CATH topology
1MMDA 5FY0A 1ZV4X 5H6QB 2E9XA 5JRCA 4UELA 4PJJA 3LBXA 4AKIA 3KV4A 4TN7B 2NP9A 4MHCA 3MA9A 3ANWA 2DWKA 4QX8B 3D0TA 1YKHB 4ZI2D 2W63A 3WAKA 2VB6A 4TV9E 3NRYA 4O2AE 1QUUA 4B6XA 4PAGA 5FP3A 2NTYA 3KBUA 3E0ZA 3F31A 5JDFA 4HN9A 1H7CA 3BQIA 4MLKA 5E0OA 3RYHE 4QWNB 2ZM8A 1HX8A 1BR0A 2E9XD 4ZI3D 2NTXA 3T8OA 2Y48B 5L3GB 4I50E 4ASKA 2CLYB 3HL6A 2A72A 3KV9A 3WI3A 4OYKA 4UEMA 2ODUA 3MACA 3O1IA 5L3EB 2X67A 3C4ZA 3UTKA 2XAQB 3HKEE 2YEVC 3O1HA 3AA1B 5TAOA 3SS1A 4EYYR 1WLXA 3RPUA 4H9SE 1WR6A 3L3PA 4GOUA 2NWBA 1YD8G 3Q9DA 4X20E 2Q9QD 4DBQA 5FMNA 1O3XA 3KINB 2CXFA 2LHNA 4QHOA 2BDEA 3R6NA 2X9XA 1YW0A 3UUNA 3UUXB 4YLHA 5EK3A 4DVDA 2VL8A 2D0UA 4YJ3E 5JQGE 3PURA 4JUYA 2DHRA 5LHIB 2G0UA 1LVFA 3N9PA 4HTEA 3V5SA 2KNDA 3HR0A 5DQVA 3BK9A 3RC3A 4ERRA 4YFSA 3MKDA 4XBFB 3KVBA 4AI6A 4P0BA 3ZYLA 4YJ2E 2LE8A 5LNKA 3VU7H 2JQQA 4F6RC 4AKGA 2IAKA 5JR9B 2EHOB 2CCQA 2CA5A 4YHJA 3ZCIA 4UF0A 2CWOA 3SRZA 2XAHB 4Z8XA 4A56A 2P9BA 3IHRA 4E7ZA 3MZKB 3JC6C 1HS7A 2NW8A 3CQXC 4UVAB 4O4JE 4CI3B 4PFPA 2Q9QC 2YINA 4WNKA 3N5LA 4H63H 4ZI7E 1B7TA 1HG2A 3HA4A 5LG4A 5L2LA 3OKQA 1S94A 3K3NA 4L0RA 3C98B 2V7LA 3PUAA 2E9XB 2C0SA 2WWUA 4ISSA 2VKHA 5ETWA 4GK0E 4GYRA 4TUYE 5FXXA 3ZN1B 3L09A 2LSYA 2WAUA 4TV8E 4IE0A 2NW7A 4E7SA 4CI1B 2L3LA 3GN5A 2C5IT 1MMNA 2L9QA 3H37A 4H9RC 2ES0A 5LOVE 1MIYA 1MNDA 1VRBA 3ETUA 1NWMX 4FI5A 2B1EA 2EHOD 3AB3B 1SA0E 2CE7A 2MOZA 3DP7A 4PJLA 3ONXA 4EAHA 5JVDE 3ZMVB 1HF8A 3PUGA 4NUVA 1D0XA 2EHOC 5BMVE 4IIJE 2LM9A 2LJLA 2PBIA 2ACXA 3FXDB 1IJ6A 4U72A 3K3QC 3H3AA 4AXPA 2WSSV 4UVCB 3C51A 5HYAA 3CX8B 4XZCA 3ETVA 2A3DA 5A1LA 2X0LB 1E1HB 1ZEEA 1ZKEA 2ZMAA 5LGUB 3RC8A 3S4UA 4CI2B 4CXWA 2H3RA 2XAGB 3IBPA 3PU8A 5LHHB 1OXZA 3VKHA 4CQIA 4QXHB 1UX5A 5LGNB 3BQKA 3BQLA 2HPLA 4UV9B 4WBOA 2ODVA 3MXZA 4PK4A 3CQCB 3RX6A 2LEHA 3ZLIA 4AQGA 4CXYA 3KBTA 4ILUA 1IZNB 3V5UA 5HWYA 4JLEA 3UULA 4P0AA 4J2CA 3RYFE 3AA7B 4BA9A 1MMGA 4WBNE 3C64A 4DNDA 5JR9A 2MBGA 3MK7C 3HKCE 1BR4A 2C5KT 4ISTA 3UT5E 4EZHA 5DJQC 1EZ3A 5CB4E 4IE5A 1HFAA 2LT3A 4KP3C 2E9XC 3RRWA 5HXHA 2VKJA 3PDYA 2KWHA 4UF0B 2DI4A 5J2UE 2EHOA 5LHGB 5J1GA 3PUSA 4HFVA 4QKNA 3ZMUB 3OYXA 1OWAA 2W0GA 3SOLA 5KX5E 1Z0PA 2X68A 2I59A 3OYZA 1WYCA 2WMOA 2CWYA 3CQGB 4H63V 3LFMA 3B13A 2K48A 3LK42 5AFUL 3P8CD 4IE4A 1FIOA 3N2GE 1LRZA 2NW9A 5LXTE 3HKBE 3N9MA 3P7IA 3O4XE 1U5PA 2JJ9A 4ADZA 4O2BE 3J9X1 2LSJA 4KBMB 2KZ7B 4WW0A 1KNZA 5CA1E 4EB6E 2UXXB 3GN5B 4PK6A 4C90A 4IE7A 4KMCA 5JR9C 1D1AA 2JMKA 5F8PA 3FBLA 2H7OA 2KXPB 4CZZB 2N9DA 4GIWA 2NOXA 5C8YE 1FMWA 2HPJA 5LBQB 2RA1A 3R84B 5HAXA 3A5XA 1G73A 2XASB 4ZOLE 4AKHA 1YKEB 4IHJE 3EDUA 5HXCA 2VKOA 2WMNA 3NRXA 1ZHCA 2BZBA 5JRCB 2BVMA 3PE0A 2YK0A 3I0QA 2HH7A 1WYBA 3KV5A 3N9NA 4L5GA 4PJNA 3QC9A 3ZJ2A 3AA0B 5H6RB 2RP4A 4MBQA 3NBXX 2Y8DA 2LOSA 2ZM2A 3B57A 3NZQA 5F3JA 4AQFA 2LSGA 2WM9A 3C4XA 3KVAA 3J7Yq 3ZMTB 3ANWB 2CM0A 3QUJA 3FBZA 2KT9A 3KFWX 4V1Av 3OBVE 5JDHA 5J2TE 2XAFB 3ZN0B 1G8XA 3F57A 3RH3A 2YU2A 5IYZE 3GA8A 4K0UA 5FNVE 2CMRA 4UV8B 1T98A 3MJXA 4HGAA 2C5JA 3Q5WA 3ZCJA 3I0OA 3TKLB 1MMAA 3UUMA 5JREA 1UCUA 5IHYA 3K3OA 1X79A 4MFRA 2DNXA 3AAAB 3LBXB 4AKLA 5L3BB 5L3FB 2V7KA 3U78A 5LGTB 3GMIA 5HXEA 1V9DA 5LA6E 2CEAA 4ZI3C 1Y64B 1KK7A 4DO0A 3CPZA 5HWXA 3ZPOA 2L8KA 3JC6D 2WBLA 2VASA 4DBRA 1HG5A 2W00A 4PJMA 5JDGA 2LSIA 1D0ZA 2PG8A 3AVSA 4FJOA 3CX6B 3PTRB 4TZ4C 1MIVA 3FB2A 2N1GA 5LYJE 4EYUA 4NUUA 2J1DG 2W62A 3PU3A 1FEWA 3ZC1A 2D0TA 5FY1A 4MALA 3VHLA 4H9PC 3LG7A 4OHFA 1BR1A 5EK4A 5LBMA 1FMVA 4IDZA 3N9LA 5FY7A 5L3DB 2PFVA 5DABA 3SWHA 2V7IA 3RYIE 2VWAA 1BR2A 4JEUB 2LHRA 2MYSA 3ZC0A 3O9XA 4DMVA 1LVKA 1US7B 2KINB 5EZYE 2K24A 2OA5A 3ZJ1A 5L3CB 3IF8B 2X9HA 3CMLA 3NZPA 2LOPA 3RYCE 2BVLA 3CKDA 4I4TE 4O4LE 2YU1A 2ZM0A 2K5BB 4BJNA 2Y6XA 3DJBA 3PUQA 3I1AA 2IW5B 5JDMA 5JDNA 3N2KE 3HKDE 4P09A 4PFOA 5JDLA 5HXRA 5JH7E 1AJ3A 4M1PA 2MTQA 4EOZB 1D1BA 5LJNA 3ZYMA 3KV6A 2X9WA 4QX7B 3RKOA 2D2SA 2SPCA 4ZHQE 1CUNA 1D0YA 5M4YA 4UXNB 2Q9QA 3K8PC 1VOMA 2CXLA 5DQWA 4I55E 3IEEA 3N9QA 2VK9A 1MNEA 4X1YE 1U4QA 5ADXL 4X1IE 3F2EA 3LJCA 4O8SA 3VKGA 5FXZA 2W61A 3OJAA 1NAFA 4QXCB 5EK2A 2V1DB 5LP6E 4BJMA 4ANJA 2XHEB 4TX5A 2JRKA 5JDQA 3N2OA 5KMGP 3LK3B 2LSKA 2JMHA 3EUHA 2GK9A 4H9NC 3E08A 3Q5XA 2XTLA 1UX4A 5LCYA 3ZMZB 5FYMA 4U74A 3AAIA 5KDMC 2XQYA 4L9IA 4EIWA 2IC6A 3ESLA 3AA6B 1QSDA 3CWZB 3N9OA 4PNIA 4ZS3A 5FXVA 4OK0A 3UFEA 3QK6A 3GWHA 2KMFA 2XAJB 3EVYA 4GYSA 4H9OC 4OYJA 2UXNB 3C50A 4AKRB 4EZ4A 4ZI2C 3HI2A 2K9AA 5GONE 1HTJF 4BAYB 2PJQA 2X66A 4GK5E 3W15B 2Q9QB 2D5UA 2V7MA 3CVRA 5HXSA 2JPFA 1IJ5A 4IE6A 4PW8A 4X1KE 3WAJA 4N78D 4O4IE 4PK5A 2X51A 4ZS2A 2DCFA 4QXBB 3E22E 4G2AA 4IGUA 2VKDA 1HCIA 4EXTA 4H9QC 3I9WA 2X9YA 2N2NA 4HEAA 3I9YA 1WRDA 3ZYKA 3ZEFB 1D1CA 4XAXB 2KLQA 4OFZA 4KUMB 2CLYC 4AQFC 1LKXA 3EDVA 4UVBB 3ZMSB 2E8IA 2M67A 3AVRA 4DMWA 4G63A 3DTOA 3O1JA 2QA7A 3M65A 3C4WA 3RRCA 4HE8A 2Z6EA 3AAEB 4UIGA 4HKAA 5LJMA 3FHNA 2H7VC 2XUEA 3KDSE 5FXWA 4I43B 3Q2MA 4C91A 1MIWA 2V26A 2DLRA 4JEHB 2DWGA 3CX7B 2CXDA 2IC9A 2ZLYA 2A2FX 4O4HE 4CXXA 1S35A 2QGSA 2V7JA 5CA0E 1IAPA 1SHZC 3FXEB 3U3IA 2KWIB 3LK2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DI4 A;  3KDS E;  4Z8X A;  4EIW A;  2CEA A;  2CE7 A;  4WW0 A;  2DHR A; 
#chains in the Genus database with same CATH topology
 1MMD A;  5FY0 A;  4WYV A;  1ZV4 X;  3UU4 A;  3EHZ A;  5H6Q B;  3RI5 A;  2E9X A;  4IL9 A;  2CBJ A;  5JRC A;  3PUW F;  4UEL A;  3AEG A;  3NWI A;  3LBX A;  4PJJ A;  3KV4 A;  4AKI A;  4TN7 B;  5AQT B;  2LLY A;  2NP9 A;  4MHC A;  3P4S A;  3ZT5 A;  3MA9 A;  3ANW A;  2DWK A;  4QX8 B;  5LMU T;  3D0T A;  4YTM A;  1YKH B;  4ZI2 D;  2W63 A;  3WAK A;  2VB6 A;  4TV9 E;  3NRY A;  4ILA A;  4O2A E;  1QUU A;  3T1H T;  1JNR A;  1Y01 A;  2XY8 B;  1UUS A;  3AE1 A;  4PAG A;  5FP3 A;  2NTY A;  3KBU A;  3E0Z A;  3F31 A;  2MPK A;  5JDF A;  4HN9 A;  2UUC T;  1XNQ T;  2V6X A;  1H7C A;  3BQI A;  4ILC A;  4MLK A;  3QB5 K;  5E0O A;  4QWN B;  3RYH E;  4DV1 T;  2ZM8 A;  1HX8 A;  1BR0 A;  2E9X D;  3X1D A;  4ZI3 D;  2NTX A;  3T8O A;  2Y48 B;  5L3G B;  4I50 E;  4ASK A;  2CLY B;  3HL6 A;  3IA3 A;  2A72 A;  3JAF A;  3KV9 A;  3WI3 A;  4OYK A;  3UU5 A;  4UEM A;  2ODU A;  3MAC A;  3O1I A;  1I6Z A;  2BBH A;  1VCT A;  4HFC A;  5HEJ A;  5L3E B;  2X67 A;  3C4Z A;  3UTK A;  2XAQ B;  3EAB A;  3HKE E;  2YEV C;  3LSV A;  3O1H A;  4EGW A;  3AA1 B;  5TAO A;  3EI0 A;  4Z91 A;  3SS1 A;  4EYY R;  4HWF A;  1WLX A;  3RPU A;  4H9S E;  1WR6 A;  3L3P A;  2PTF A;  2H88 A;  2NWB A;  1YD8 G;  2FUP A;  3Q9D A;  2Q9Q D;  4GOU A;  4X20 E;  5FMN A;  4DBQ A;  1O3X A;  3KIN B;  5IUX A;  2CXF A;  3RHW A;  4ZXL A;  2LHN A;  4QHO A;  2BDE A;  3R6N A;  2X9X A;  1YW0 A;  3UUN A;  3UUX B;  5AQS B;  4YLH A;  5EK3 A;  4DVD A;  3EAM A;  2VL8 A;  1NEK A;  2UU9 T;  2D0U A;  2V6Y A;  2XQ3 A;  4TNV A;  4QH4 A;  3PUR A;  4JUY A;  2DHR A;  3AE7 A;  2VVN A;  2G0U A;  1LVF A;  2QVA A;  3N9P A;  4HTE A;  3AEA A;  2KND A;  4TWH A;  2WQY A;  3V5S A;  2VQE T;  4AQY T;  1HNX T;  3HR0 A;  5DQV A;  3AEC A;  3BK9 A;  3RC3 A;  3VR8 A;  4ERR A;  1WFD A;  5ABE A;  4YFS A;  3MKD A;  4X64 T;  4XBF B;  3KVB A;  4OX9 T;  4AI6 A;  3AXJ A;  4P0B A;  5HEO A;  2IDO B;  3ZYL A;  5CFB A;  4YJ2 E;  4DR2 T;  3FZM B;  1J5W A;  2BG9 A;  2UXD T;  2LE8 A;  5LNK A;  1YQ3 A;  3VU7 H;  2JQQ A;  2CBI A;  2LKG A;  4F6R C;  3PUV F;  2IAK A;  2CHN A;  5JR9 B;  4AKG A;  3ZT6 A;  2B76 A;  2J62 A;  2EHO B;  3M3Z B;  2CCQ A;  2CA5 A;  4YHJ A;  3ZCI A;  4UF0 A;  4HFD A;  5ABH A;  2CWO A;  3SRZ A;  2XAH B;  4Z8X A;  3UQ4 A;  4A56 A;  2P9B A;  3IHR A;  4E7Z A;  3MZK B;  3JC6 C;  4X65 T;  2V6Y B;  2YDR A;  2NW8 A;  1HS7 A;  3CQX C;  4UVA B;  3B5M A;  4GKK T;  4I0U A;  2YN6 A;  4O4J E;  4PFP A;  2Q9Q C;  5F5W A;  2YIN A;  4WNK A;  4CI3 B;  3N5L A;  4H63 H;  3RIF A;  4ZI7 E;  4KX6 A;  5LG3 A;  1B7T A;  1HG2 A;  2XQ7 A;  3HA4 A;  5LG4 A;  5L2L A;  4U3C A;  2VQF T;  1XDP A;  3OKQ A;  1S94 A;  2E2A A;  3K3N A;  4L0R A;  2WZH A;  3C98 B;  2V7L A;  4EED A;  3PUA A;  2E9X B;  4B3M T;  2C0S A;  2WWU A;  4ISS A;  2VKH A;  4TNW A;  5ETW A;  2FBW A;  4GK0 E;  4GYR A;  4YTP A;  4TUY E;  5FXX A;  3TLU A;  4JI1 T;  3ZN1 B;  1HR0 T;  1OED C;  3ABV A;  3L09 A;  4U33 A;  4QH1 A;  2LSY A;  2WAU A;  4JI3 T;  2I0M A;  4TV8 E;  4IDO A;  4IE0 A;  2NW7 A;  2W2U A;  4E7S A;  2WDQ A;  4KI0 F;  3FZL B;  4AIS A;  2L3L A;  4CI1 B;  3GN5 A;  2C5I T;  1MMN A;  3AE5 A;  4WZX A;  2L9Q A;  3H37 A;  1ZP0 A;  4H9R C;  2ES0 A;  5LOV E;  4DR6 T;  1MIY A;  1MND A;  1VRB A;  2V5D A;  3ETU A;  1NWM X;  4FI5 A;  4LMJ A;  3RIA A;  2IML A;  2B1E A;  2EHO D;  2WB5 A;  3PUX F;  3AB3 B;  2J4G A;  1SA0 E;  2CE7 A;  2MOZ A;  3DP7 A;  2XM1 A;  3LDQ B;  3ONX A;  4PJL A;  4EAH A;  1UUR A;  2WU2 A;  2LRK A;  5JVD E;  3RF1 A;  2YDQ A;  3ZMV B;  1HF8 A;  4IT4 A;  5ABF B;  4LFB T;  3RGL A;  1IBK T;  3PUG A;  4NUV A;  1D0X A;  2EHO C;  2XZE A;  5BMV E;  4IIJ E;  2LM9 A;  2LJL A;  2UXC T;  2PBI A;  1IBL T;  2ACX A;  3FXD B;  4DR3 T;  3UU3 A;  1IJ6 A;  4U72 A;  1I94 T;  2HHH T;  3K3Q C;  2BG9 B;  2XQ4 A;  3H3A A;  3UU8 A;  2M6I A;  2WSS V;  2FJA A;  2X0H A;  3AE3 A;  4UVC B;  3C51 A;  5HEG A;  4AXP A;  4YT0 A;  3CX8 B;  4XZC A;  2QYW A;  1KF6 A;  3ETV A;  5HYA A;  4Z90 A;  2A3D A;  5A1L A;  4DV6 T;  3A8Y C;  2X0L B;  4P1N A;  1E1H B;  1ZEE A;  1ZKE A;  2ZMA A;  5LGU B;  3RC8 A;  3S4U A;  4CI2 B;  4CXW A;  2H3R A;  2XAG B;  3IBP A;  3PU8 A;  5LHH B;  1OXZ A;  2W66 A;  4LML A;  4CQI A;  3VKH A;  4QXH B;  1UX5 A;  5LGN B;  3AEE A;  3BQK A;  3BQL A;  2HPL A;  5AQV B;  4IDN A;  4UV9 B;  4WBO A;  2ODV A;  4DUZ T;  1CHU A;  1SE7 A;  3MXZ A;  4PK4 A;  2BS4 A;  1KEY A;  3CQC B;  3RX6 A;  2LEH A;  2LM2 A;  3JCF A;  4HFE A;  3ZLI A;  3CIR A;  4AQG A;  3KBT A;  4CXY A;  3SFE A;  1N34 T;  4ILU A;  4JBW F;  4GKJ T;  4DR4 T;  1IZN B;  3NKZ A;  3V5U A;  5HWY A;  4JLE A;  3UUL A;  4P0A A;  4J2C A;  3RYF E;  1IBM T;  3AA7 B;  4BA9 A;  1MMG A;  2BKP A;  2VVS A;  4WBN E;  3C64 A;  5HCJ A;  4DND A;  3UFG A;  2AE9 A;  5JR9 A;  5ABG A;  2MBG A;  3MK7 C;  4U2Y A;  4A5X A;  3HKC E;  1BR4 A;  2C5K T;  4IST A;  3UT5 E;  4EZH A;  1J5E T;  3AE9 A;  2XQA A;  5DJQ C;  1EZ3 A;  5CB4 E;  4IE5 A;  3ZKR A;  1HFA A;  2LT3 A;  4KP3 C;  4EV6 A;  4HWH A;  2E9X C;  3RRW A;  5HXH A;  3PV0 F;  2VKJ A;  3PDY A;  2KWH A;  4UF0 B;  2DI4 A;  5C3J A;  3P50 A;  4HWD A;  5J2U E;  2UXB T;  2EHO A;  2WCA A;  5LHG B;  5J1G A;  3PUS A;  3H3M A;  4HFV A;  4QKN A;  5HEH A;  3ZMU B;  5L47 A;  1N32 T;  1HNW T;  3OYX A;  1OWA A;  2W0G A;  3SOL A;  5KX5 E;  1Z0P A;  2X68 A;  2I59 A;  3L39 A;  3OYZ A;  1WYC A;  4JYA T;  2WMO A;  2CWY A;  3CQG B;  1JNZ A;  4H63 V;  3LFM A;  4JI0 T;  5AQM B;  5AQJ B;  5AQQ B;  3B13 A;  2K48 A;  3LK4 2;  5AFU L;  3P8C D;  2LRL A;  2XM2 A;  4IE4 A;  1FIO A;  3N2G E;  1LRZ A;  3OVU A;  3PUZ F;  2NW9 A;  5LXT E;  4IDP A;  2MAW A;  3HKB E;  3N9M A;  3P7I A;  5L4E A;  3O4X E;  1U5P A;  1HX1 B;  4X5T A;  3UUB A;  2JJ9 A;  4ADZ A;  4O2B E;  4X66 T;  2AXD S;  3AEB A;  3J9X 1;  2LSJ A;  4KBM B;  2KZ7 B;  4WW0 A;  3UQ7 A;  3P4P A;  5CA1 E;  3AEF A;  1YXR A;  4EB6 E;  2UXX B;  3GN5 B;  3PJA A;  4PK6 A;  4C90 A;  5LB7 B;  4IE7 A;  3AE8 A;  2BG9 C;  4DV3 T;  4KMC A;  5JR9 C;  1D1A A;  4ZZC A;  1KFY A;  4HWC A;  3RIU A;  4YTN A;  5JQG E;  2JMK A;  5F8P A;  3FBL A;  1L0V A;  2H7O A;  2KXP B;  3PUY F;  4CZZ B;  2N9D A;  2XQ6 A;  4GIW A;  2NOX A;  2CHO A;  5C8Y E;  4YSX A;  1FMW A;  4DV5 T;  2HPJ A;  5LBQ B;  2RA1 A;  3R84 B;  2UUA T;  4LFC T;  4K0K T;  5HAX A;  3A5X A;  4YSY A;  4YXD A;  1G73 A;  3OTO T;  2XAS B;  4ZOL E;  3NVO A;  5HCM A;  2BS2 A;  4AKH A;  1YKE B;  4IHJ E;  3EDU A;  4JI2 T;  2YKS A;  5HXC A;  2VKO A;  4JI7 T;  2WMN A;  3NRX A;  1ZHC A;  2BZB A;  3TLS A;  2BVM A;  3UU6 A;  5JRC B;  4KHP T;  3PE0 A;  2YK0 A;  3I0Q A;  2HH7 A;  1WYB A;  3KV5 A;  3N9N A;  4L5G A;  4PJN A;  3QC9 A;  3ZJ2 A;  3AA0 B;  5H6R B;  2RP4 A;  4B6X A;  4MBQ A;  3NBX X;  2Y8D A;  2LOS A;  2ZM2 A;  3B57 A;  4CN6 A;  1N36 T;  3NZQ A;  5F3J A;  4AQF A;  1T72 A;  2LSG A;  2WM9 A;  3C4X A;  3ONL C;  3KVA A;  3J7Y q;  3ZMT B;  3ANW B;  2E5L T;  2CM0 A;  4LF4 T;  3QUJ A;  3FBZ A;  2KT9 A;  3KFW X;  4V1A v;  3OBV E;  5JDH A;  4JI4 T;  5J2T E;  2XAF B;  3ZN0 B;  1G8X A;  2XQ5 A;  3F57 A;  3P4W A;  3QNU A;  4IDQ A;  3RH3 A;  2YU2 A;  5IYZ E;  3GA8 A;  4K0U A;  5FNV E;  4NPP A;  2CMR A;  4UV8 B;  3TLW A;  1T98 A;  3MJX A;  4HGA A;  4F8H A;  2C5J A;  4YY3 T;  3Q5W A;  3ZCJ A;  3ONJ A;  1DU2 A;  3I0O A;  3TKL B;  1MMA A;  3UUM A;  3QOF A;  4U31 A;  1UCU A;  5JRE A;  2WY2 A;  3K3O A;  1X79 A;  4MFR A;  2DNX A;  3AAA B;  3LBX B;  2JQK A;  5AQI B;  5IHY A;  2V7K A;  5AQN B;  3U78 A;  5L3F B;  5L3B B;  3GMI A;  5HXE A;  5LGT B;  1E2A A;  1QLB A;  2ACZ A;  1V9D A;  5LA6 E;  2CEA A;  4ZI3 C;  2YDS A;  1Y64 B;  1KK7 A;  4DO0 A;  3CPZ A;  1OED B;  3ZPO A;  5HWX A;  2L8K A;  3JC6 D;  2WBL A;  2VAS A;  3OPC A;  1HG5 A;  2W00 A;  4PJM A;  4DBR A;  5JDG A;  2LSI A;  2E5V A;  1D0Z A;  2PG8 A;  3AVS A;  4KHZ F;  1W0A A;  1WR0 A;  4FJO A;  4U7Y A;  3CX6 B;  3PTR B;  4TZ4 C;  3RKG A;  4TWF A;  1MIV A;  3FB2 A;  4HWI B;  1W9R A;  2N1G A;  2X0Y A;  5LYJ E;  4IRE A;  4DV7 T;  4EYU A;  4NUU A;  2J1D G;  2W62 A;  2JQ9 A;  1FEW A;  3PU3 A;  3ZC1 A;  4AKL A;  1T7S A;  5CJ5 A;  4IL4 A;  2D0T A;  5FY1 A;  4MAL A;  3T1Y T;  3VHL A;  4H9P C;  3LG7 A;  4OHF A;  1BR1 A;  5EK4 A;  5LBM A;  1FMV A;  4IDZ A;  3N9L A;  4Q25 A;  5FY7 A;  5L4H A;  5L3D B;  2FJD A;  2PFV A;  4QH5 A;  5DAB A;  4DID B;  3SWH A;  4B3T T;  2V7I A;  3RYI E;  2VWA A;  1BR2 A;  2WP9 A;  3P4Q A;  4JEU B;  2LHR A;  1AJ3 A;  4HFH A;  4DV4 T;  2MYS A;  2A9U A;  2K3W A;  3ZC0 A;  3O9X A;  4DMV A;  3QB5 A;  1LVK A;  1US7 B;  2KIN B;  4LMK A;  5EZY E;  2K24 A;  2OA5 A;  2XJ7 A;  4ILB A;  4NXM T;  3ZJ1 A;  5L3C B;  3IF8 B;  2X9H A;  3JAD A;  4A98 A;  3CML A;  3NZP A;  2LOP A;  3RYC E;  1XNR T;  2BVL A;  1W09 A;  2I6H A;  1XZY A;  3CKD A;  4I4T E;  3ZST A;  4DUY T;  1YQ4 A;  1XMO T;  4O4L E;  2YU1 A;  2ZM0 A;  2K5B B;  4CN1 A;  4NIQ A;  2YOE A;  4ZEY A;  1J1J A;  4LF7 T;  4DR5 T;  4BJN A;  4LF5 T;  1KNP A;  3FZF B;  2Y6X A;  3DJB A;  3PUQ A;  1E7P A;  4JI5 T;  1WCR A;  3I1A A;  2IW5 B;  5JDM A;  2OLT A;  5JDN A;  3N2K E;  5LHI B;  2XSA A;  3HKD E;  4P09 A;  4PFO A;  3RQW A;  5HXR A;  5JDL A;  5JH7 E;  4B3S T;  1M62 A;  2HN2 A;  4M1P A;  2MTQ A;  2CPT A;  1D1B A;  4EOZ B;  5LJN A;  1FJG T;  3ZYM A;  3G06 A;  3KV6 A;  2X9W A;  2W4X A;  4QX7 B;  2D2S A;  2H89 A;  2SPC A;  1CUN A;  1D0Y A;  3JAE A;  3RKO A;  4UXN B;  2Q9Q A;  4YSZ A;  5M4Y A;  3K8P C;  4NXN T;  5IWA T;  1VOM A;  2CXL A;  2CRB A;  2WS3 A;  2D9D A;  3CK6 A;  2XSB A;  4A97 A;  5DQW A;  3SFD A;  4I55 E;  3IEE A;  2WDR A;  3N9Q A;  3L8R A;  2VK9 A;  1MNE A;  1GQE A;  2BKO A;  4X1Y E;  1U4Q A;  2FJE A;  5ADX L;  4X1I E;  4DV0 T;  3F2E A;  3LJC A;  3Q5D A;  1OED E;  4YHH T;  5AQO B;  4O8S A;  1XMQ T;  3VKG A;  5FXZ A;  2W61 A;  3A7M A;  3OJA A;  1NAF A;  4QXC B;  2WDV A;  5EK2 A;  2V1D B;  2WU5 A;  5AQP B;  3AE2 A;  3TLT A;  5LP6 E;  4EEB A;  1KNZ A;  2XQ8 A;  5FKY A;  2IHR 1;  2V5C A;  4BJM A;  4ANJ A;  2XHE B;  1VCS A;  4TX5 A;  2JRK A;  5JDQ A;  3N2O A;  5KMG P;  4LF9 T;  3LK3 B;  2LSK A;  2JMH A;  3EUH A;  3P4R A;  2GK9 A;  4H9N C;  3ZT7 A;  3E08 A;  2FJB A;  3Q5X A;  2XTL A;  2OV9 A;  1UX4 A;  5LCY A;  3ZMZ B;  4DR7 T;  1Z8U A;  2KSR A;  5FYM A;  5C2T A;  4CN4 A;  2ZM6 T;  5CGM A;  4U74 A;  3AAI A;  2WZI A;  5KDM C;  2XQY A;  5J0Z A;  1ZOY A;  3K1S A;  4LF8 T;  4L9I A;  4EIW A;  2IC6 A;  2BG9 E;  3ESL A;  5AQU B;  5LMN T;  3AA6 B;  1QSD A;  2M6B A;  3CWZ B;  1KNR A;  2BBJ A;  3N9O A;  4PNI A;  4ZS3 A;  4OK0 A;  5FXV A;  3QK6 A;  3UFE A;  3GWH A;  5FL1 A;  2KMF A;  2XAJ B;  3EVY A;  5KXJ A;  2R6G F;  4GYS A;  4DV2 T;  1OED A;  4UR9 A;  4H9O C;  3Q5E A;  1R8I A;  4OYJ A;  2UXN B;  3C50 A;  5FVK A;  4U2Z A;  4AKR B;  4TWD A;  4EZ4 A;  4ZI2 C;  3HI2 A;  1T8B A;  2K9A A;  5FL0 A;  5GON E;  1HTJ F;  2JIW A;  4BAY B;  2PJQ A;  2IUB A;  2X66 A;  4GK5 E;  3W15 B;  2Q9Q B;  2QRX A;  4LF6 T;  2D5U A;  2V7M A;  3CVR A;  2F4V T;  5HXS A;  3AE6 A;  4JV5 T;  2JPF A;  3PJA J;  1IJ5 A;  4IE6 A;  3VRA A;  4PW8 A;  4X1K E;  3WAJ A;  4N78 D;  4O4I E;  2UUB T;  3ZSS A;  4U7I A;  2LKH A;  4PK5 A;  4AIU A;  2X51 A;  4ZS2 A;  1HNZ T;  3AED A;  2DCF A;  2VL0 A;  4DR1 T;  2J47 A;  3FZK B;  2BKN A;  4QXB B;  3E22 E;  4HFB A;  3VRB A;  5AQR B;  1X9B A;  3VR9 A;  4G2A A;  4COF A;  4LFA T;  4IGU A;  5AQG B;  5JTG A;  2VKD A;  1HCI A;  1XWM A;  1UGO A;  5AQF B;  4EXT A;  2RPA A;  4H9Q C;  3I9W A;  4B3R T;  2X9Y A;  5AQH B;  2N2N A;  4HEA A;  3I9Y A;  2WWV A;  3RIU C;  1WRD A;  3RLF F;  3ZYK A;  2NR4 A;  3FZH B;  1D1C A;  3ZEF B;  5HEU A;  4XAX B;  4X62 T;  2KLQ A;  2DL1 A;  3AXJ B;  4OFZ A;  4JI6 T;  1M7K A;  2V8S V;  2CLY C;  4KUM B;  4AQF C;  1LKX A;  2BS3 A;  3EDV A;  4UVB B;  3ZMS B;  2E8I A;  2M67 A;  3AVR A;  1XDO A;  2JQH A;  4G63 A;  3DTO A;  3O1J A;  2QA7 A;  3M65 A;  3C4W A;  4DMW A;  3RRC A;  4HE8 A;  5BR8 T;  2XQ9 A;  2Z6E A;  2HN1 A;  3AAE B;  4UIG A;  4HKA A;  5FVL A;  4ZHQ E;  5LJM A;  3FHN A;  2H7V C;  2XUE A;  3KDS E;  3RQU A;  1SUM B;  5FXW A;  4I43 B;  4JI8 T;  3Q2M A;  4C91 A;  2VUR A;  3AE4 A;  1MIW A;  2V26 A;  2DLR A;  5ABF A;  4JEH B;  2DWG A;  2XPK A;  3CX7 B;  2CXD A;  2IC9 A;  2ZLY A;  2A2F X;  1UK5 A;  2IIU A;  4HFI A;  4O4H E;  4YJ3 E;  3TLV A;  1S35 A;  2QGS A;  2V7J A;  2W67 A;  4CXX A;  4ZZB A;  5CA0 E;  5AQL B;  1N33 T;  1IAP A;  1SHZ C;  1W0B A;  3FXE B;  5AQK B;  1NEN A;  3U3I A;  2KWI B;  3LK2 B; 
#chains in the Genus database with same CATH homology
 1MMD A;  5FY0 A;  1ZV4 X;  5H6Q B;  2E9X A;  5JRC A;  4UEL A;  4PJJ A;  3LBX A;  4AKI A;  3KV4 A;  4TN7 B;  2NP9 A;  4MHC A;  3MA9 A;  3ANW A;  2DWK A;  4QX8 B;  3D0T A;  1YKH B;  4ZI2 D;  2W63 A;  3WAK A;  2VB6 A;  4TV9 E;  3NRY A;  4O2A E;  1QUU A;  4B6X A;  4PAG A;  5FP3 A;  2NTY A;  3KBU A;  3E0Z A;  3F31 A;  5JDF A;  4HN9 A;  1H7C A;  3BQI A;  4MLK A;  5E0O A;  3RYH E;  4QWN B;  2ZM8 A;  1HX8 A;  1BR0 A;  2E9X D;  4ZI3 D;  2NTX A;  3T8O A;  2Y48 B;  5L3G B;  4I50 E;  4ASK A;  2CLY B;  3HL6 A;  2A72 A;  3KV9 A;  3WI3 A;  4OYK A;  4UEM A;  2ODU A;  3MAC A;  3O1I A;  5L3E B;  2X67 A;  3C4Z A;  3UTK A;  2XAQ B;  3HKE E;  2YEV C;  3O1H A;  3AA1 B;  5TAO A;  3SS1 A;  4EYY R;  1WLX A;  3RPU A;  4H9S E;  1WR6 A;  3L3P A;  4GOU A;  2NWB A;  1YD8 G;  3Q9D A;  4X20 E;  2Q9Q D;  4DBQ A;  5FMN A;  1O3X A;  3KIN B;  2CXF A;  2LHN A;  4QHO A;  2BDE A;  3R6N A;  2X9X A;  1YW0 A;  3UUN A;  3UUX B;  4YLH A;  5EK3 A;  4DVD A;  2VL8 A;  2D0U A;  4YJ3 E;  5JQG E;  3PUR A;  4JUY A;  2DHR A;  5LHI B;  2G0U A;  1LVF A;  3N9P A;  4HTE A;  3V5S A;  2KND A;  3HR0 A;  5DQV A;  3BK9 A;  3RC3 A;  4ERR A;  4YFS A;  3MKD A;  4XBF B;  3KVB A;  4AI6 A;  4P0B A;  3ZYL A;  4YJ2 E;  2LE8 A;  5LNK A;  3VU7 H;  2JQQ A;  4F6R C;  4AKG A;  2IAK A;  5JR9 B;  2EHO B;  2CCQ A;  2CA5 A;  4YHJ A;  3ZCI A;  4UF0 A;  2CWO A;  3SRZ A;  2XAH B;  4Z8X A;  4A56 A;  2P9B A;  3IHR A;  4E7Z A;  3MZK B;  3JC6 C;  1HS7 A;  2NW8 A;  3CQX C;  4UVA B;  4O4J E;  4CI3 B;  4PFP A;  2Q9Q C;  2YIN A;  4WNK A;  3N5L A;  4H63 H;  4ZI7 E;  1B7T A;  1HG2 A;  3HA4 A;  5LG4 A;  5L2L A;  3OKQ A;  1S94 A;  3K3N A;  4L0R A;  3C98 B;  2V7L A;  3PUA A;  2E9X B;  2C0S A;  2WWU A;  4ISS A;  2VKH A;  5ETW A;  4GK0 E;  4GYR A;  4TUY E;  5FXX A;  3ZN1 B;  3L09 A;  2LSY A;  2WAU A;  4TV8 E;  4IE0 A;  2NW7 A;  4E7S A;  4CI1 B;  2L3L A;  3GN5 A;  2C5I T;  1MMN A;  2L9Q A;  3H37 A;  4H9R C;  2ES0 A;  5LOV E;  1MIY A;  1MND A;  1VRB A;  3ETU A;  1NWM X;  4FI5 A;  2B1E A;  2EHO D;  3AB3 B;  1SA0 E;  2CE7 A;  2MOZ A;  3DP7 A;  4PJL A;  3ONX A;  4EAH A;  5JVD E;  3ZMV B;  1HF8 A;  3PUG A;  4NUV A;  1D0X A;  2EHO C;  5BMV E;  4IIJ E;  2LM9 A;  2LJL A;  2PBI A;  2ACX A;  3FXD B;  1IJ6 A;  4U72 A;  3K3Q C;  3H3A A;  4AXP A;  2WSS V;  4UVC B;  3C51 A;  5HYA A;  3CX8 B;  4XZC A;  3ETV A;  2A3D A;  5A1L A;  2X0L B;  1E1H B;  1ZEE A;  1ZKE A;  2ZMA A;  5LGU B;  3RC8 A;  3S4U A;  4CI2 B;  4CXW A;  2H3R A;  2XAG B;  3IBP A;  3PU8 A;  5LHH B;  1OXZ A;  3VKH A;  4CQI A;  4QXH B;  1UX5 A;  5LGN B;  3BQK A;  3BQL A;  2HPL A;  4UV9 B;  4WBO A;  2ODV A;  3MXZ A;  4PK4 A;  3CQC B;  3RX6 A;  2LEH A;  3ZLI A;  4AQG A;  4CXY A;  3KBT A;  4ILU A;  1IZN B;  3V5U A;  5HWY A;  4JLE A;  3UUL A;  4P0A A;  4J2C A;  3RYF E;  3AA7 B;  4BA9 A;  1MMG A;  4WBN E;  3C64 A;  4DND A;  5JR9 A;  2MBG A;  3MK7 C;  3HKC E;  1BR4 A;  2C5K T;  4IST A;  3UT5 E;  4EZH A;  5DJQ C;  1EZ3 A;  5CB4 E;  4IE5 A;  1HFA A;  2LT3 A;  4KP3 C;  2E9X C;  3RRW A;  5HXH A;  2VKJ A;  3PDY A;  2KWH A;  4UF0 B;  2DI4 A;  5J2U E;  2EHO A;  5LHG B;  5J1G A;  3PUS A;  4HFV A;  4QKN A;  3ZMU B;  3OYX A;  1OWA A;  2W0G A;  3SOL A;  5KX5 E;  1Z0P A;  2X68 A;  2I59 A;  3OYZ A;  1WYC A;  2WMO A;  2CWY A;  3CQG B;  4H63 V;  3LFM A;  3B13 A;  2K48 A;  3LK4 2;  5AFU L;  3P8C D;  4IE4 A;  1FIO A;  3N2G E;  1LRZ A;  2NW9 A;  5LXT E;  3HKB E;  3N9M A;  3P7I A;  3O4X E;  1U5P A;  2JJ9 A;  4ADZ A;  4O2B E;  3J9X 1;  2LSJ A;  4KBM B;  2KZ7 B;  4WW0 A;  1KNZ A;  5CA1 E;  4EB6 E;  2UXX B;  3GN5 B;  4PK6 A;  4C90 A;  4IE7 A;  4KMC A;  5JR9 C;  1D1A A;  2JMK A;  5F8P A;  3FBL A;  2H7O A;  2KXP B;  4CZZ B;  2N9D A;  4GIW A;  2NOX A;  5C8Y E;  1FMW A;  2HPJ A;  5LBQ B;  2RA1 A;  3R84 B;  5HAX A;  3A5X A;  1G73 A;  2XAS B;  4ZOL E;  4AKH A;  1YKE B;  4IHJ E;  3EDU A;  5HXC A;  2VKO A;  2WMN A;  3NRX A;  1ZHC A;  2BZB A;  5JRC B;  2BVM A;  3PE0 A;  2YK0 A;  3I0Q A;  2HH7 A;  1WYB A;  3KV5 A;  3N9N A;  4L5G A;  4PJN A;  3QC9 A;  3ZJ2 A;  3AA0 B;  5H6R B;  2RP4 A;  4MBQ A;  3NBX X;  2Y8D A;  2LOS A;  2ZM2 A;  3B57 A;  3NZQ A;  5F3J A;  4AQF A;  2LSG A;  2WM9 A;  3C4X A;  3KVA A;  3J7Y q;  3ZMT B;  3ANW B;  2CM0 A;  3QUJ A;  3FBZ A;  2KT9 A;  3KFW X;  4V1A v;  3OBV E;  5JDH A;  5J2T E;  2XAF B;  3ZN0 B;  1G8X A;  3F57 A;  3RH3 A;  2YU2 A;  5IYZ E;  3GA8 A;  4K0U A;  5FNV E;  2CMR A;  4UV8 B;  1T98 A;  3MJX A;  4HGA A;  2C5J A;  3Q5W A;  3ZCJ A;  3I0O A;  3TKL B;  1MMA A;  3UUM A;  5JRE A;  1UCU A;  5IHY A;  3K3O A;  1X79 A;  4MFR A;  2DNX A;  3AAA B;  3LBX B;  4AKL A;  5L3B B;  5L3F B;  2V7K A;  3U78 A;  5LGT B;  3GMI A;  5HXE A;  1V9D A;  5LA6 E;  2CEA A;  4ZI3 C;  1Y64 B;  1KK7 A;  4DO0 A;  3CPZ A;  5HWX A;  3ZPO A;  2L8K A;  3JC6 D;  2WBL A;  2VAS A;  4DBR A;  1HG5 A;  2W00 A;  4PJM A;  5JDG A;  2LSI A;  1D0Z A;  2PG8 A;  3AVS A;  4FJO A;  3CX6 B;  3PTR B;  4TZ4 C;  1MIV A;  3FB2 A;  2N1G A;  5LYJ E;  4EYU A;  4NUU A;  2J1D G;  2W62 A;  3PU3 A;  1FEW A;  3ZC1 A;  2D0T A;  5FY1 A;  4MAL A;  3VHL A;  4H9P C;  3LG7 A;  4OHF A;  1BR1 A;  5EK4 A;  5LBM A;  1FMV A;  4IDZ A;  3N9L A;  5FY7 A;  5L3D B;  2PFV A;  5DAB A;  3SWH A;  2V7I A;  3RYI E;  2VWA A;  1BR2 A;  4JEU B;  2LHR A;  2MYS A;  3ZC0 A;  3O9X A;  4DMV A;  1LVK A;  1US7 B;  2KIN B;  5EZY E;  2K24 A;  2OA5 A;  3ZJ1 A;  5L3C B;  3IF8 B;  2X9H A;  3CML A;  3NZP A;  2LOP A;  3RYC E;  2BVL A;  3CKD A;  4I4T E;  4O4L E;  2YU1 A;  2ZM0 A;  2K5B B;  4BJN A;  2Y6X A;  3DJB A;  3PUQ A;  3I1A A;  2IW5 B;  5JDM A;  5JDN A;  3N2K E;  3HKD E;  4P09 A;  4PFO A;  5JDL A;  5HXR A;  5JH7 E;  1AJ3 A;  4M1P A;  2MTQ A;  4EOZ B;  1D1B A;  5LJN A;  3ZYM A;  3KV6 A;  2X9W A;  4QX7 B;  3RKO A;  2D2S A;  2SPC A;  4ZHQ E;  1CUN A;  1D0Y A;  5M4Y A;  4UXN B;  2Q9Q A;  3K8P C;  1VOM A;  2CXL A;  5DQW A;  4I55 E;  3IEE A;  3N9Q A;  2VK9 A;  1MNE A;  4X1Y E;  1U4Q A;  5ADX L;  4X1I E;  3F2E A;  3LJC A;  4O8S A;  3VKG A;  5FXZ A;  2W61 A;  3OJA A;  1NAF A;  4QXC B;  5EK2 A;  2V1D B;  5LP6 E;  4BJM A;  4ANJ A;  2XHE B;  4TX5 A;  2JRK A;  5JDQ A;  3N2O A;  5KMG P;  3LK3 B;  2LSK A;  2JMH A;  3EUH A;  2GK9 A;  4H9N C;  3E08 A;  3Q5X A;  2XTL A;  1UX4 A;  5LCY A;  3ZMZ B;  5FYM A;  4U74 A;  3AAI A;  5KDM C;  2XQY A;  4L9I A;  4EIW A;  2IC6 A;  3ESL A;  3AA6 B;  1QSD A;  3CWZ B;  3N9O A;  4PNI A;  4ZS3 A;  5FXV A;  4OK0 A;  3UFE A;  3QK6 A;  3GWH A;  2KMF A;  2XAJ B;  3EVY A;  4GYS A;  4H9O C;  4OYJ A;  2UXN B;  3C50 A;  4AKR B;  4EZ4 A;  4ZI2 C;  3HI2 A;  2K9A A;  5GON E;  1HTJ F;  4BAY B;  2PJQ A;  2X66 A;  4GK5 E;  3W15 B;  2Q9Q B;  2D5U A;  2V7M A;  3CVR A;  5HXS A;  2JPF A;  1IJ5 A;  4IE6 A;  4PW8 A;  4X1K E;  3WAJ A;  4N78 D;  4O4I E;  4PK5 A;  2X51 A;  4ZS2 A;  2DCF A;  4QXB B;  3E22 E;  4G2A A;  4IGU A;  2VKD A;  1HCI A;  4EXT A;  4H9Q C;  3I9W A;  2X9Y A;  2N2N A;  4HEA A;  3I9Y A;  1WRD A;  3ZYK A;  3ZEF B;  1D1C A;  4XAX B;  2KLQ A;  4OFZ A;  4KUM B;  2CLY C;  4AQF C;  1LKX A;  3EDV A;  4UVB B;  3ZMS B;  2E8I A;  2M67 A;  3AVR A;  4DMW A;  4G63 A;  3DTO A;  3O1J A;  2QA7 A;  3M65 A;  3C4W A;  3RRC A;  4HE8 A;  2Z6E A;  3AAE B;  4UIG A;  4HKA A;  5LJM A;  3FHN A;  2H7V C;  2XUE A;  3KDS E;  5FXW A;  4I43 B;  3Q2M A;  4C91 A;  1MIW A;  2V26 A;  2DLR A;  4JEH B;  2DWG A;  3CX7 B;  2CXD A;  2IC9 A;  2ZLY A;  2A2F X;  4O4H E;  4CXX A;  1S35 A;  2QGS A;  2V7J A;  5CA0 E;  1IAP A;  1SHZ C;  3FXE B;  3U3I A;  2KWI B;  3LK2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...