2DIGA

Solusion structure of the todor domain of human lamin-b receptor
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
68
Chain Sequence
GSSGSSGMPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lamin-B receptor
publication title Solusion structure of the Todor domain of human Lamin-B receptor
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 3
structure length 68
sequence length 68
ec nomenclature ec 1.3.1.70: Delta(14)-sterol reductase.
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09465 LBR_tudor Lamin-B receptor of TUDOR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2digA00
3LGLA 2O4XA 2M16A 2HQEA 3QBYA 5KE3A 2K3XA 3CEYA 1OZ2A 2CKKA 2JZ2A 3PMIA 2P0KA 3QIIA 3QKJA 4A4HA 5FRMA 3H8ZA 4IURA 4RG2A 2O4XB 1N27A 4CRIA 4BDYA 2FHDA 4ZTJA 1WJSA 2GFAA 5KCHA 3OYLA 2DIGA 3LX7A 3QJ6A 3S6WA 3H6ZA 3LGFA 4N4GA 2L8DA 2LRQA 4BACA 3O8VA 2RJDA 3Q1JA 2G3RA 2VYTA 3KUFA 3MO8A 3OYBA 4GY5A 5D6YA 2NLUA 5D6XA 5IN1A 3E9FA 4A4EA 2WACA 1OI1A 5IAYA 5KE2A 3LYIA 2XK0A 3OYMA 5M9OA 4IUQA 3S3NA 1KHCA 3OA6A 5FRNA 2K3YA 3DB3A 4ZTFA 2R5AA 2RI3A 4B9WA 4QQDA 3MP6A 2BIVA 3OYIA 2L3RA 2DAQA 4BE1A 2JTFA 4IUPA 5CIUA 2BKDN 3S3MA 2RO0A 3P8HA 2HQXA 3UWNA 3ME9A 3OYEA 3OYHA 2M0OA 3E9GA 3OS0A 4C5HA 3C4SA 3OB9A 4PL6A 2X4WA 4EDUA 4C5EA 4Z02A 2IG0A 3L2WA 4LD6A 1WGSA 2MWPA 1RI0A 2MWOA 3MEVA 3NTKA 4UC4A 3EAEA 4E7KA 4IUVA 3SD4A 4E7IA 2R5MA 2RHXA 4BE0A 2M1HA 3PNWC 4FU6A 2X4YA 2EQMA 3UT1A 2QQSA 4C5IA 3FEOA 5J26A 3MEWA 4PLIA 2GF7A 1OYXA 4OVAA 4QVZA 5KCOA 3MP8A 3OYFA 2EQJA 3L2QA 3L2RA 3S3OA 3FDRA 2L89A 4II1A 4BE2A 2RJEA 2X35A 4A4GA 5C0MA 2RHUA 4L59A 4QQGA 3OS1A 1WJRA 2B8AA 4X34A 1WJQA 4B9XA 3OYJA 2EQUA 3GOXA 3DB4A 3MEUA 4C5GA 2BUDA 2RJCA 1OZ3A 4BD3A 2RJFA 3OY9A 2R57A 3OYCA 5FROA 3OYAA 4BDZA 1G5VA 5KH6A 3NTHA 2DIQA 2RI5A 4IUUA 3OYKA 2PQWA 3P8DA 2EFIA 5D6WA 1MHNA 2E6NA 2X4XA 2RI2A 3M9QA 4FL6A 4IUTA 2RHZA 5J39A 4E7LA 3DLMA 3LH0A 3FLGA 3LLRA 3OMGA 4N4HA 4A4FA 3OYNA 3FC3A 1SSFA 2XDPA 3META 2QQRA 4N4IA 4E7HA 4E7JA 3OMCA 4HCZA 1XNIA 2D9TA 2LTOA 3F70A 4NS5A 4QQ6A 3MEAA 4QW2A 3OS2A 2F5KA 4PLLA 2LDMA 3ASKA 2EKOA 2LVMA 3OYGA 3L2VA 3OYDA 3PFSA 2RHIA 3L2UA 2EQKA 2RHYA 3L42A 3PMTA 4Q5WA 5C6SA 1H3ZA 2R58A 2YRVA 2E5QA 3BDLA 3NTIA 3OQ5A 3MP1A 2GFUA 4IKFA 3ZEHA 2LCCA
chains in the Genus database with same CATH superfamily
4PJOG 1PKSA 5GANg 4LXCA 4CRIA 1GL5A 2KMTA 2JUFA 4X1VA 1Y7XA 3DLLA 4FSXA 1FMKA 3H6ZA 4XTYA 1VQ6Q 1AWXA 2RQTA 1RABB 3OSSC 3RNJA 2RM4A 4GLMA 3M0TA 4BACA 2DE0X 2ZAEA 5I21A 1M8MA 4J9FA 2NLUA 1BI0A 3G7ZA 3V7RA 2QASA 2CUBA 3PT9A 1KHCA 3BY7A 2DLPA 3A98A 5CAIA 1VQOA 3OYIA 4F14A 2HSPA 5IHKA 2YLCA 1S72Q 2JTMA 1PM3A 4PJOB 1NJIR 4OB1B 3E9GA 3OS0A 1U8RA 4PJOD 3TQ7P 2DERA 1IGUA 1ZBXA 1D1AA 5D7UA 1TUDA 5I22A 5DM7R 1R77A 3MEWA 1IO6A 5LJ5f 5J3BA 3NPFA 2BZYA 3I56Q 3EFOB 2BUDA 3OY9A 3CCJT 5KH6A 1MMNA 1O9SA 2YDLA 1GXIE 1Q86U 1BI2A 1YI2T 1K73R 2DETA 3CCRT 3H41A 4AFZC 3FJPA 3OMGA 2V8JA 3OW2S 4D8KA 1PG5B 2EW3A 4EMKB 1R0BG 3DKMA 4HCBA 2OTJA 4JLIA 2DYBA 2HKQB 4ZGJB 1NJIU 5GAMd 1KHIA 3EHRA 4XAXB 5A0DA 1Q82C 2J05A 1NE8A 3M54A 1GRIA 5ECAA 2JZ2A 4DEYA 4QKUA 3P8BB 2FRYA 4DOWA 1UECA 3TVTA 1YITA 3OBWA 3RBBB 4EMKC 5LJ5j 2LJ0A 1SEMA 3WVEB 4C92B 1JJ2S 3MO8A 3KUFA 4C92D 1X75C 2COWA 5IN1A 1M1KR 4FSSA 3CCET 2QAZA 2EWNA 4LDVA 3G1JA 3O5ZA 3JB9G 2GTOA 3CCLQ 2QQ9A 2BIVA 1KC8C 3SFMA 4HXJA 2EJGA 2K4YA 2RO0A 1PSEA 1RUWA 4E2FB 1VQNT 3SWNC 1WDXA 4ZGDB 1VQLT 2VUBA 1KSWA 4PLIA 3L2RA 1R0CB 2KGTA 1YJWQ 4A4GA 1WLPB 4OB3B 4BY6B 3CCUA 3EG1A 1N8RR 1D1CA 1VQKQ 3JV3A 3JCMV 4M7DF 5GAOr 1K9MC 1KD1C 1M1KU 2HKNA 3CC4Q 2NUTB 3LLRA 1IHWA 1RAHB 1LJOA 2DILA 2EQIA 3C12A 3MPUB 1WFWA 1OQKA 1YN8A 1WZOA 3F70A 4QQ6A 2KE9A 1UTIA 2K3BA 4LN2A 3MEAA 3URGA 4FCYA 4L6V5 1M3CA 2LX9A 4BY6C 5GAMf 1I07A 1SPKA 2OTLT 2KBTA 2CZ0B 5FW9A 5IXFA 2CH4W 2COYA 2A36A 2A7YA 4IIMA 3PMIA 4BI8B 1JXMA 1Q81R 1N27A 2CSQA 4BDYA 2LCSA 3QWYA 2CDTA 2LT4A 5KCHA 3UA6A 2CP0A 2KRSA 1LOJA 4TVRA 3R6OA 2DJZA 4E7SA 3OYBA 2PTKA 1W1FA 1N8RU 2ED1A 1M8VA 3BW1A 1OX9A 3CPWP 1ZX6A 2YUPA 1UDLA 4BI4A 1KFZA 4K11A 5GANf 2FZGB 2DAQA 1ZLMA 2KRMA 2EVRA 4KUDK 4XTZA 4QVDA 2D8JA 1LPLA 1S1NA 4J83A 1M30A 3V8LA 3G4ST 3L2WA 1WGSA 5GAMj 3EAEA 4KULA 2E65A 5CK9A 1QP2A 1K76A 3H9NA 4C5IA 2L5QA 2P84A 1ABOA 2QYZA 5IXBA 5LJ5e 3L2QA 3CCQQ 4ZTFA 1VIEA 4Z88A 1H92A 3CCST 4JRQA 2F69A 2OAUA 2LMJA 1FX7A 4DBQA 3CC7T 4FIBA 1BI1A 2FRWA 2SRCA 1YCSB 3AT1B 4RTTA 3VJPA 2XDPA 3I35A 3RESA 3REBB 5CCAA 1YIJT 3HRUA 3PMTA 5AT1B 3QWXX 2YRVA 3IQLA 1I8FA 5AYFA 1C0MA 2CKKA 2X4JA 2JS0A 4IIOA 2QEXQ 3GIBA 1J3TA 1U3OA 2GNCA 2O31A 1MMGA 1RAAB 3CMAT 2YRDA 2DXBA 1K8AU 2CZ1B 1SRLA 1NBEB 3EHQA 1RAIB 3PVLA 2DD5A 3M4YA 1PD0A 4A4EA 3BDUA 2MYSA 1H8KA 2VASA 4XTXA 2QTXA 2HMAA 5IHIA 4N0AA 3V7CA 2Y90A 4ZGEB 1VQ7T 1H3HA 2D8HA 1TWBA 2L3RA 1K0SA 1MUZA 2HQHA 1BBZA 1M27C 2DL8A 2I0NA 1YBYA 2QA4Q 2DEQA 3KBGA 2LJ3A 1D3BA 3TU4K 3CC2T 1X2KA 5GAN8 4JS5A 4BE0A 2CP6A 2KAFA 2X4YA 3EFRA 2A0FB 5GMKj 2CGHA 1M2VA 1B7TA 2B86A 3INZA 3X20B 1TUGB 4CI0C 2A28A 5FU6B 4ORZA 3HTRA 2M0YA 1TS9A 3M57A 4ZN3A 3M9QA 2DVJA 2QK0A 4J9EA 1SSFA 1VA7A 3J7AF 2EYYA 3EGDA 1MMDA 5GAMe 1QWFA 2F5KA 3CCMA 3A8OB 2DNUA 3L2VA 2LVMA 1UEBA 2RHIA 2D0QB 2RK2A 1TOVA 3OQ5A 1BIAA 2ESWA 2M16A 5FU6C 2DTOA 3QIIA 4J9BA 2O4XB 1VQOQ 1W2BP 2QDLA 2GFAA 4J6YA 3PVQA 3QYGB 4N4GA 1B34A 4J9IA 4RTVA 3CCLT 1HYOA 4HVVA 2G3RA 1Y57A 1XOVA 2XKOC 1OI1A 4FYVB 2KRNA 3X25B 5GANe 1YHQT 5HCKA 5GAOn 4J7IA 1UJYA 1I81A 1Q7YU 3QJYA 3VV0A 2BKDN 1SRMA 1WPYA 2FVUA 2KXCA 1VQPT 3T9NA 2ROLA 4OMQA 1CKAA 4LD6A 2R5MA 4E6RA 2M1HA 1UG1A 3S3OA 2DK3A 3NGPA 2KDSA 2EYWA 3EG0A 2H3EB 2JOYA 1DJ7B 3CC4T 3SWNA 2OTJQ 4XU3A 1RLPC 5IHNA 4ELYC 3JCMg 2LT1A 2HBWA 2O01E 3CXCA 1EIFA 5GAOq 3HFOA 1N9RA 4IKFA 1UFFA 4M7AF 1AWJA 1M90U 1JO8A 4E7HA 4HA8A 1YITQ 1YI2A 4M77F 3CCRA 4Z89A 3HL8A 8AT1B 4M7AA 3OS2A 2QA4A 4CC7A 4A63B 2E3HA 4M77A 2QGFB 2G6FX 3M55A 3ZEHA 1AWOA 1PC0A 3I55T 1ZSGA 1OZ2A 3H0HA 4A4HA 3H8ZA 1QW1A 4FT4A 1ZBJA 4RTYA 4C0ZA 2DKGA 3MHXA 4LDXA 2ZPHB 2E5KA 1X69A 1I0CA 1OX8A 1D3BB 2DTHA 1X01A 2PNIA 3M58A 2MIOA 2XK0A 2FPDA 4IUQA 3PIPA 4DEXA 1OU9A 4M7AE 4RTXA 4KGZB 3CCEA 3EG3A 1BB9A 1M2VB 3G6EA 1Y96A 3FIFA 4N0AC 1RADB 4M77E 1VQ5A 3CCUQ 3OYEA 1RAGB 4ZN1A 1WQWA 1Q86R 4EDUA 2V26A 3MEVA 1RI0A 3QHSA 4J9GA 2DMOA 2W10A 3H0IA 5FU7B 1VQNA 1QKXA 4OGCA 1X6GA 3GF5A 4J7FA 3FDRA 1WX6A 2MOXA 4YTLA 2JVVA 3V8KA 2B8AA 1VQLA 3EGDB 2D1XA 2RD1A 4QVCA 2RJFA 2EIFA 5FROA 3VYHB 5I11A 1CSKA 3VS7A 2MI6A 3JCMX 2ZPEB 5EG2A 2KXDA 3CBMA 4EIKA 5FU7C 2XDBA 1ABQA 2V1QA 5CO7A 1W2BS 4LDWA 1LNXA 1WHJA 1GBQA 1V1CA 1QCOA 4MDWA 1B34B 2D6FA 2BE9B 2YUOA 4OMLA 1KQSA 3EGXB 1X43A 3KFVA 1B07A 1AEYA 3JCMd 3JCMP 2XG8D 1UJ0A 2VGNA 1VYVA 4MZPA 1ARKA 3U23A 4HT9A 2OTLA 1AD5A 1NPPA 3QUIA 4ZTJA 3FJ5A 3ZBDA 1WHMA 2CZ7B 2RN8A 2QTVA 1UGRB 2HL3A 2ZCFB 1YJ9Q 2DBKA 4DBFA 2DZCA 2X3WD 2DL3A 3J81E 3RERA 4ESRA 2RK1A 4M7AG 3C0CA 4P5NA 2R5AA 1I5OB 3ZL7C 2RPNA 2EGEA 8ATCB 4M77G 3EG9A 4J8OA 2VWFA 1UGVA 5KYWA 1I4K1 2FEIA 1Q82U 3SWNB 1RL2A 3VUBA 2VKNA 2OI3A 1W6XA 2ABLA 2GCXA 2LNHB 2MWPA 2PUKB 5LL6S 1QP3A 3NFCA 3VKIA 4OMPA 1KJWA 3CBOA 4OB0B 1K73C 4II1A 3G4SA 3OBYA 5L8RE 1T3SA 2HL5C 3M5AA 1KD1R 4BD3A 1PWTA 1SG5A 4JJDA 3QYHB 2P4RA 2DIQA 2EYQA 3EG2A 4JRIA 3L1AA 1G2BA 3CCSA 1NM7A 2IPOB 1VQ9T 3HPWA 2E6NA 3AHUA 5J39A 1KC8U 3OYNA 3FC3A 1QLYA 1BYMA 3FB9A 3CC7A 4J5YA 1RI9A 2EJFA 3CPFA 1OEBA 4KBMB 5GAOm 4LDUA 4M7AC 3HFNA 2QQBA 4AT1B 3JB9D 3LW5E 2A08A 3JCMf 4M77C 1RAEB 1YIJA 5CKEA 1M1KC 4M75F 4RUGA 4M7DA 1WJSA 3JCMW 3CCVA 5FWCA 4HVUA 1N5ZA 1C1AA 1Y96B 1BIBA 1BKBA 2JMAA 3Q1JA 3SEMA 2VYTA 1KD1U 1K9MU 1GBRA 5IH2A 1ZUUA 1WHHA 2PZ1A 4JJCA 2JTEA 3CMAA 2GQIA 3HRTA 2E1HA 2YT6A 3QSUA 3OW2A 5M9OA 1QVFP 4R0KA 3JCMQ 2RI3A 2YSQA 2ECZA 2HNIA 1FMWA 1BCMA 2LQNA 2OAWA 2ZGWA 4PK4A 1RAFB 5CVIA 4C5HA 4M4ZA 3C4SA 1VQ7A 1BU1A 1TSFA 4C5EA 3A1PA 1QVGP 4WTOB 4ZNXA 4M7DE 1U1TA 1AWWA 3MP8A 1VQ8T 2WSFE 2K5LA 2X35A 3JCMh 2JNGA 1ZQ1A 1K1ZA 3EFSA 3CC2A 4L59A 1WJRA 1JJ2A 2LP5A 4WCIA 3CCMQ 2K9GA 4M78F 4OB2B 2FL7A 4X9DA 2L2PA 1FWZA 1YJ9A 2KSSA 3UDCA 2RQVA 4IUTA 2RF0A 2RI2A 1MMAA 4E7LA 3CMEA 1EZZB 4N4HA 4OMNA 2YUNA 2CP2A 4C0FA 3UF4A 3JB9I 3NHNA 4HCZA 4OF1A 3VS1A 1K8AR 3G71T 1Q81C 4PLLA 1UGPB 4Y91A 2FZCB 2HD0A 4FW1A 4E47A 4DQ2A 3CD6T 1YJNA 4F7UF 2LCCA 2EFIA 5KE3A 1VQ4T 4OMFB 3EGUA 4L5GA 1D1BA 4C8QF 3M59A 3VU3C 1U5SA 4AFQC 2DIGA 5GAN7 3EG9B 4MMKA 1R8OB 2L8DA 1Y07A 4C8QA 2PUOB 3NMZC 1GFDA 5KYWB 1AZEA 4RTZA 4Z8AA 1PRLC 5A0LA 1VQ6T 2LQWA 2W0ZA 2MMPA 1MNDA 4HKEA 4AMCA 2NUPA 4BE1A 2DFUA 2AZSA 2EKHA 2EGCA 3LWHA 1ZA2B 3UWNA 2YXYA 1YHQA 4PJMA 1NEGA 2V8KA 3THKA 1IGQA 1S72T 4M7DG 2DXUA 3EH1A 4ATOA 4CC2A 5J26A 2O2OA 3VUZA 4A54A 2DEUA 3X28B 3X24B 1VQPA 1NG2A 1YI2Q 4C8QE 3CCRQ 3D7SB 3GOXA 2KK4A 2XDDA 3DB4A 5GJWB 4KUIA 4PFOA 2RJCA 2MPXC 5GAN4 2R57A 2AK5A 3M56A 1YWPA 1NYGA 4IUUA 2E3IA 1OULA 4J9CA 4LD9K 1TXQA 3I56T 3VRYA 2VC8A 4HT8A 2GBQA 2J6KA 4M7DB 3GP8A 1NLOC 2WSEE 1WHGA 4M7DD 5GAOl 2K57A 4F04B 2Z0WA 3L42A 1UHFA 2H3JA 3JCMc 3VS0A 1WHKA 3NTIA 1X6BA 1TH7A 5KYUA 2HQEA 2VGMA 3BFMA 4J9DA 3TCJA 4RG2A 4OGEA 2DF6A 1VQMA 2YLBA 1Q7YR 1QVFS 1GFCA 2RB6A 2RQRA 3CCEQ 1SKUB 5LJ3h 3G6EQ 2DD4A 4VUBA 5DY9A 1VQ5Q 3I55A 4M7DC 4RCCA 2CH4A 1QMCA 2FG0A 3O8VA 4JPBW 5EC7A 3VS3A 4R55A 2JJ9A 1MNEA 3A8MB 4M75C 2DVEA 4PJOF 1QVGS 3OYMA 2DA9A 3VYGA 1IB8A 4MZMA 3E2UA 1FXXA 1VQNQ 1N9SA 1PD1A 4B9WA 2BTTA 1U1SA 1XTDA 2JS2A 4E7ZA 2M51A 3MKDA 3CPWS 5CKDA 4BUGA 1VQLQ 2A3LA 4RCBA 3P8HA 1TU0B 2M0OA 1M4ZA 1XQHA 4AFUC 2DRKA 1YCYA 2MWOA 3M53A 3SD4A 5HKCA 2XICA 4E7IA 1G83A 1OPLA 3RKWA 1M90R 3A8GB 2AIRB 2FZKB 3FEOA 3WXMB 5KCOA 1G3YA 2MK5A 2DL4A 4C0GA 4C8QG 3SB2A 4LE9A 3VS2A 2L89A 4BE2A 2RJEA 4LNPA 1HJDA 1WJQA 5HY6A 3UA7A 4BDZA 3OYAA 1G5VA 3ZFJA 3NTHA 2FPEA 1YJWT 1VYTA 4J6XA 2ENMA 5KYXA 3OYKA 2PQWA 2KYMA 2JMCA 3GNFB 1VYUA 2X4XA 2CP7A 1OPKA 2V8IA 4M78C 2CS7A 1VQKT 2E10A 2OTLQ 2HEQA 4ANJA 1EX4A 2P0QA 3MJXA 3JRZA 2LQKA 2LX7A 2F2VA 2DJQA 4XTWA 1QVPA 4JDSA 3A8HB 2CP5A 4F16A 5FRNA 4C92F 5FRMA 4IURA 3CCJA 2ED0A 1ZSZC 4V2SA 4RTUA 1JU5C 3UPUA 2YRCA 2NUPB 3TREA 1X2QA 2ZPIB 3RMQA 3M0UA 4HCKA 2RJDA 1AT1B 2OX7A 1I1JA 3E9FA 4C8QC 5GMKe 5KE2A 4PFZA 3LYIA 2CT3A 2DXCA 1VOMA 2YUQA 4X9CA 3GPLA 5A2QE 3G4SQ 5I2SA 1G3WA 1KK7A 3QO3A 3A8LB 1IRXA 3PE0A 1UUEA 4JS4A 3E1SA 1NLPC 2IG0A 3I5SA 3HRSA 2DBMA 3NTKA 3CCSQ 1VIFA 5FLXE 2QQSA 4C92E 3OYFA 1OYXA 4QVZA 1OU8A 2EQJA 3CC7Q 1PSFA 1PCXA 4QQGA 2VV5A 3OYJA 5GAN3 4C5GA 4XU0A 2LJ1A 2DM1A 1KQ1A 3CCQT 2QQAA 2MAMA 2E41A 4KGVB 2CUDA 2JXBA 5GMKm 2DXTA 3P8DA 1KQ2A 2PVGB 1KIKA 1MHNA 4FL6A 1YIJQ 5KYUB 1OOTA 1D09B 2JM8A 2KT1A 2YWWA 2K7AA 1HSQA 3CCVQ 1E7OA 2D9TA 2LTOA 3FRNA 1VQ9A 4QW2A 4FT2A 2EPDA 5GJVB 3PFSA 1TTHB 2LC4A 2BZXA 2GTJA 4NL2A 2AT1B 2DX1A 3MP1A 2C0IA 3CMAQ 1BCOA 2AZVA 3QBYA 2K3XA 2K2VA 3MCAB 3TSZA 1O75A 2CREA 1GCPA 2LZ6B 3M0QA 2LNVA 1Q82R 2XD0A 2QEXT 1VQ7Q 2EYZA 5D6YA 4JZ3A 1NZ9A 2M9UA 4CC3A 2VXFA 2WACA 2O9SA 4KH0B 1Q86C 3RKXA 2KQWA 3RR6A 3S3NA 4OMOA 2YHTA 2XMFA 4QQDA 4RKUE 3A5ZB 1LVKA 2HBPA 1EFNA 2KROA 1P92A 3CC2Q 1TUCA 4IUPA 2JN0A 2HDAA 3S3MA 1NYFA 1BK2A 4PJOC 4DA4A 2D0NA 2AKKA 4BB7A 5CR2A 4PL6A 2EAYA 3BE3A 2RA2A 5LJ3g 3SDZA 1NJIC 2RNAA 2F5TX 1KC8R 4C92G 5KYXB 5CKHA 2QA4T 1I5LA 3UT1A 2F1LA 2J06A 4FW2A 3WVDB 3CMEQ 4LUEA 2QI2A 5L23A 2K6DA 3OS1A 5GMKi 5KYYA 2C06A 2QDYB 2FYKA 4Y28E 4NOYA 1M2OA 4MDXA 1VQ8A 2GGRA 2RMOA 1YJNQ 4ELZC 2O88A 7AT1B 5D6WA 2K5FA 4J9HA 4OMMA 1YFNA 1D0XA 2ZPFB 2PVDB 4F17A 5A0GA 3JSCA 4GBQA 1ZHIA 4EPCA 1M1FA 3OMCA 2DZ9A 4XTUA 1SSHA 1K9MR 5LJ5h 1UGQB 4M7AB 3HSBA 5HK3A 4M7AD 3ER0A 4AG2C 1WXUA 3BDLA 3G6ET 2X3XD 1VQ5T 4M77B 3G71A 2RH2A 5CIUA 1K73U 2C0OA 3CEYA 1WXTA 1AZGB 4M77D 3QKJA 1G3SA 5IT9E 3CD6A 5GANd 2EGAA 1CKBA 3OYLA 2E70A 1VQ4A 4A53A 3V8JA 1YHQQ 2LRQA 4C92C 3LH5A 2CYZB 2L3PA 5CQXA 1VQOT 1YP5A 1M1GA 5GAOp 3GLXA 5IAYA 3N5BB 3DB3A 1MV3A 4PJJA 1VQPQ 3PGGA 1W2BA 2BE7D 2DPPB 1SF9A 1VQ6A 3ME9A 3VRZA 3OYHA 1IHVA 3PTAA 4M75A 1MV0B 1OV3A 2XIDA 2X4WA 4JZ4A 3HKSA 3R6NA 1IREB 1WXBA 4IUVA 3M0RA 3CXCP 1G3TA 3PNWC 3E19A 4PNOA 1IXDA 4PKCC 4KGXB 2DL5A 2NUZA 1S72A 2RHUA 2MCNA 3X26B 5GAN2 1OZ3A 4OP0A 1A0NB 2X51A 3I5RA 2J6FA 4JRPA 5GMKl 3C95A 4FM4B 4JUVA 1N8RC 3RIRA 4PJNA 5GAN5 2OTJT 2CP3A 4FYXB 1G8XA 5KYNA 4A4FA 5LJ3d 4N4IA 1VQMQ 1QCNA 4XU2A 4A4KA 4M75E 2KYBA 2PVOB 2ZZDA 2DYIA 5DLQE 3I55Q 3I56A 3OYGA 4EMGA 2DL7A 1X6OA 2EQKA 3L2UA 3M4GA 2ZPGB 1YITT 6AT1B 2O4XA 1PNJA 4M78A 3PIOA 3RMSA 2KR3A 3LWIA 2JT4A 5FWBA 3J80E 3QPHA 3LX7A 4XQ3A 2K79A 3LGFA 3QDFA 3QG1A 1VUBA 1KG1A 3QZ5B 1WHLA 4GY5A 4PJLA 4JJBA 2PU9B 4AFSC 4C0DB 3CBPA 5GAN6 5GAMh 1ZSZA 4KT0E 2L3QA 1HK9A 2GQVA 2K3YA 2E64A 2XI9A 3MP6A 1Q81U 4F7UA 5HK0A 1GCQA 4FYYB 2CZ6B 2JTFA 5KYYB 3KXTA 1SHFA 4M78E 1Y71A 4E7KA 1ZA1B 2JW4A 1Y0MA 1H641 4FU6A 3CCUT 4C0DC 2EQMA 2GF7A 3CCLA 2ATCB 5C0MA 4MMLA 5GANj 1LCKA 4B9XA 2CSIA 3MEUA 5GANh 1B3QA 2M02A 2J6OA 2HCKA 2HZYA 2VXEA 2HSEB 4DOVA 1UGSB 1YWOA 1K8AC 3CCVT 1U06A 1KQSP 3OYYA 1M3BA 2LCLA 4KRTA 4F7UE 3TEEA 1SHGA 3LH0A 3FLGA 5LJ3f 3CCJQ 3META 4M75G 4E7JA 1YJWA 3VS4A 2JM9A 2V1RA 2FPFA 1T0HA 2LDMA 1WQ7A 4D6WA 4QT7A 2EJ9A 1VQKA 4R56A 5C6SA 2ROTA 2ZPBB 4KH1B 2IIMA 3RKYA 3LGLA 3V7SA 1T0JA 2DTIA 2VB6A 1BI3A 3CC4A 2P0KA 3VS5A 1K4US 4O5VA 2KNBB 2FHDA 3L2ZA 2H8HA 3ULRB 3S6WA 3QJ6A 3TSWA 1JXOA 1WI7A 1MGQA 1W4SA 1V76A 3EH2A 3QXEB 1E6GA 1RLQC 3QDRB 5D6XA 4M75B 3JCMe 1XJWB 4M75D 2E4HA 1PRMC 4JRKA 3CXCS 3HHTB 5LJ5g 2L3SA 2IVWA 3OA6A 3JCMJ 4MZTA 2XU8A 4XTVA 3HP9A 2LQ8A 3REAB 5LJ3j 1YJ9T 5GMKh 1C6VX 1W70A 2HQXA 3CMET 4M78G 1M3AA 2X9HA 3OB9A 1QCFA 2QXFA 1ACMB 4HVWA 1QKWA 3JCMb 1JEGA 1Z9ZA 1F1BB 1E6HA 2CT4A 2OJ2A 4Y92A 1D0YA 4OVAA 1QWEA 3C94A 2KY9A 1QQJA 3UATA 1YJNT 4CC4B 5DLOA 4PJOA 2RQWA 4RG8A 1WA7A 4J6WA 1VQ9Q 2A37A 1D0ZA 4PFPA 4DBHA 1FYNA 1X27A 4F7UG 4GLKA 2AHJB 2NWMA 1NPRA 3DLMA 3CCQA 4M78B 2XHCA 2O9VA 1T3LA 5CKFA 2QG9B 2QQRA 4M78D 1YNZA 4WF2A 1XNIA 3GBQA 2K5IA 3EFOA 1HXDA 1Q7YC 3ASKA 2EKOA 1IZ6A 2L0AA 4Q5WA 2KI7A 3OSVA 3EGXA 4O6JA 3OS5A 1Z9QA 2KT8A 2GFUA 1AOJA 3RUXA 2MF2A 2VVKA 5I2MA 3OW2P 2DO3A 4DBRA 1ZSZB 4PJOE 1TG0A 4EMKA 1M9SA 2KVQG 2AKLA 4F7UB 1M5Q1 2SEMA 4LUDA 2Y4XA 3I9QA 2RQUA 4XU1A 4C8QB 3CQTA 4C8QD 2E6ZA 4RMOA 1K0XA 2F2XA 2P4TA 4BI3A 3SHWA 3GNGA 2QEXA 2C0TA 5CQYA 1Q95G 2E12A 2FO0A 1M90C 4C92A 1JJ2P 1UE9A 1ZUKA 2FB7A 4XK8E 4LDYA 2EYXA 1GCQC 3JAME 1UB4A 1JQQA 1VQ8Q 4D8DA 4Z02A 4UC4A 1WIEA 1PKTA 4EMHA 1HD3A 2RHXA 4ME7A 1KQSS 2HAXA 2EBPA 4FYWB 9ATCB 1QVFA 2P0PA 1JB0E 4HCCA 1AHJB 5LJ5d 5CKBA 1UHCA 5GAMg 4X34A 1AVZC 1NEBA 2EQUA 2J7IA 1WYXA 2KEAA 1V29B 3VS6A 3M0PA 3M0SA 3OYCA 2F2WA 1JRIA 1VQMT 2COZA 3RDVA 2NYSA 1N6AA 2RI5A 2Y4YA 1PHTA 1QVGA 5LJ3e 4JLGA 3G71Q 3CCMT 2DRMA 2RHZA 2K2MA 4AG1C 3JB9F 1K9AA 3CPWA 1RACB 2BZ8A 3CD6Q 4JJNK 2QGGA 3H0FA 1ZUYA 4NS5A 1WNLA 1VQ4Q 1FMVA 2WSCE 4NL3A 3OYDA 3JB9J 2RHYA 1JBMA 2I2LA 4B6MA 2R58A 1H3ZA 3JB9H 2E5QA 3QZ9B 4RTWA 2NUTA
chains in the Genus database with same CATH topology
4PJOG 5FU6C 2M16A 5KE3A 1K73U 5GANg 1VQ4T 3CEYA 2DTOA 4M77D 3QIIA 4OMFB 3QKJA 4L5GA 1G3SA 2O4XB 5IT9E 4CRIA 4C8QF 3CD6A 5GANd 3M59A 3VU3C 2KMTA 2GFAA 2JUFA 1Y7XA 3DLLA 4FSXA 3OYLA 2DIGA 4J6YA 3H6ZA 3QYGB 4N4GA 5GAN7 4XTYA 2E70A 3OSSC 1B34A 1VQ4A 4MMKA 1R8OB 2L8DA 2RM4A 3V8JA 2LRQA 4A53A 1Y07A 4C8QA 2PUOB 3CCLT 4C92C 4BACA 2G3RA 5I21A 1XOVA 2NLUA 1BI0A 2CYZB 5CQXA 1VQOT 3G7ZA 1M1GA 5GAOp 3GLXA 2XKOC 1OI1A 5IAYA 5A0LA 3V7RA 1VQ6T 3PT9A 3X25B 5GANe 1YHQT 3N5BB 1KHCA 3BY7A 3DB3A 5GAOn 4J7IA 5CAIA 2MMPA 1I81A 3PGGA 1VQOA 1W2BA 3OYIA 1Q7YU 4HKEA 2YLCA 4BE1A 2JTMA 3QJYA 3VV0A 2BKDN 3LWHA 2DPPB 1VQ6A 4PJOB 3UWNA 3ME9A 4OB1B 1YHQA 1WPYA 3OYHA 3E9GA 3OS0A 3PTAA 1U8RA 2FVUA 4M75A 4PJOD 2XIDA 2V8KA 2X4WA 1VQPT 3HKSA 3T9NA 1IREB 4LD6A 1S72T 4M7DG 1ZBXA 4IUVA 2DXUA 4ATOA 2R5MA 1G3TA 2M1HA 3PNWC 3E19A 5J26A 4PNOA 5DM7R 3MEWA 3VUZA 4A54A 4PKCC 3S3OA 2DK3A 3X28B 3X24B 1VQPA 2KDSA 4C8QE 1S72A 2RHUA 5LJ5f 5J3BA 2JOYA 3GOXA 2KK4A 1DJ7B 3X26B 3CC4T 2XDDA 3DB4A 3SWNA 4KUIA 5GAN2 2BUDA 2RJCA 1OZ3A 5GAN4 3OY9A 4OP0A 2R57A 3CCJT 4XU3A 5KH6A 1O9SA 3M56A 4ELYC 3JCMg 4JRPA 1Q86U 1GXIE 1BI2A 2LT1A 1YI2T 5GMKl 4IUUA 2O01E 3CCRT 3CXCA 3C95A 4LD9K 3FJPA 1EIFA 4FM4B 4JUVA 3HFOA 3RIRA 1N9RA 5GAOq 3I56T 1N8RC 5GAN5 4IKFA 2OTJT 4M7AF 3OMGA 4A4FA 1M90U 2V8JA 5LJ3d 3OW2S 4N4IA 2VC8A 4E7HA 4HA8A 1YI2A 4HT8A 4XU2A 4A4KA 4EMKB 4M77F 4M75E 3CCRA 4M7DB 2RH2A 3HL8A 2PVOB 3DKMA 4HCBA 2ZZDA 3GP8A 4M7AA 3OS2A 2WSEE 5DLQE 3I56A 4M7DD 2OTJA 4JLIA 2QA4A 3OYGA 5GAOl 4EMGA 2K57A 4ZGJB 1X6OA 2EQKA 3L42A 3L2UA 1NJIU 5GAMd 3M4GA 1KHIA 2ZPGB 4M77A 1YITT 2H3JA 3JCMc 4XAXB 5A0DA 1Q82C 3NTIA 1NE8A 3M55A 3ZEHA 1TH7A 3M54A 2O4XA 2HQEA 4M78A 3I55T 2VGMA 3BFMA 3PIOA 1OZ2A 2JZ2A 3TCJA 3RMSA 4A4HA 3H8ZA 4RG2A 4OGEA 3P8BB 1QW1A 4FT4A 4DOWA 1VQMA 2YLBA 1QVFS 3LWIA 2RB6A 1YITA 3OBWA 3J80E 4C0ZA 2DKGA 3LX7A 3QPHA 4XQ3A 5LJ3h 2DD4A 3LGFA 4VUBA 5DY9A 4EMKC 5LJ5j 3I55A 3MHXA 4LDXA 2ZPHB 3WVEB 4C92B 4M7DC 4RCCA 1JJ2S 3QG1A 1VUBA 3O8VA 3MO8A 3KUFA 3QZ5B 1X75C 4C92D 4GY5A 4R55A 1KG1A 5IN1A 1D3BB 3CCET 2DTHA 1X01A 3A8MB 2EWNA 2PU9B 4M75C 4C0DB 2DVEA 3CBPA 3M58A 4LDVA 4PJOF 5GAN6 5GAMh 2XK0A 4KT0E 1QVGS 3OYMA 4IUQA 3VYGA 4MZMA 3PIPA 1FXXA 1HK9A 1N9SA 3JB9G 2GQVA 2K3YA 4B9WA 2E64A 2XI9A 1U1SA 4M7AE 3MP6A 1XTDA 2QQ9A 1Q81U 2BIVA 3CCEA 4F7UA 3SFMA 5HK0A 1KC8C 3CPWS 2CZ6B 2JTFA 3G6EA 5CIUA 5CKDA 4BUGA 1Y96A 3FIFA 4N0AC 4M77E 1VQ5A 2A3LA 2EJGA 2K4YA 2RO0A 1PSEA 3P8HA 4RCBA 3OYEA 4ZN1A 1VQNT 2M0OA 1WQWA 3KXTA 1M4ZA 1XQHA 4M78E 3SWNC 4EDUA 1YCYA 1Y71A 3MEVA 2MWOA 1RI0A 3QHSA 4E7KA 3M53A 3SD4A 5HKCA 2XICA 4ZGDB 4E7IA 1VQLT 1H641 5FU7B 3RKWA 4FU6A 2VUBA 3CCUT 4C0DC 2EQMA 3A8GB 3FEOA 1VQNA 4PLIA 4OGCA 2GF7A 3WXMB 1G3YA 5KCOA 3L2RA 4C0GA 4C8QG 3GF5A 3CCLA 3SB2A 4J7FA 3FDRA 2L89A 4BE2A 2RJEA 4A4GA 5C0MA 4MMLA 5GANj 4YTLA 2JVVA 3V8KA 2B8AA 1VQLA 4B9XA 1WJQA 4OB3B 4BY6B 3MEUA 5GANh 3CCUA 2RD1A 4QVCA 5HY6A 4BDZA 2RJFA 3OYAA 2EIFA 1G5VA 5FROA 2VXEA 3VYHB 3ZFJA 4DOVA 1UGSB 3NTHA 1K8AC 1YJWT 3JCMV 3CCVT 4J6XA 2MI6A 4M7DF 3OYKA 2PQWA 5GAOr 1K9MC 3OYYA 2ZPEB 3JCMX 1KD1C 1M1KU 5EG2A 3GNFB 2LCLA 2X4XA 4F7UE 3CBMA 3TEEA 2V8IA 3LH0A 3FLGA 3LLRA 5FU7C 5LJ3f 1LJOA 2XDBA 3META 4M78C 3C12A 2CS7A 4M75G 1VQKT 2E10A 4E7JA 1YJWA 5CO7A 2P0QA 3JRZA 3F70A 4QQ6A 1W2BS 2LQKA 4LDWA 3URGA 3MEAA 1LNXA 4MDWA 2LDMA 1WQ7A 4L6V5 1B34B 2LX9A 4XTWA 4BY6C 4D6WA 2D6FA 1QVPA 2EJ9A 5GAMf 4JDSA 4R56A 3A8HB 5C6SA 1VQKA 2ZPBB 2OTLT 2CZ0B 3RKYA 1KQSA 5FRNA 3LGLA 3V7SA 2DTIA 4C92F 3JCMd 2A7YA 1BI3A 3JCMP 2XG8D 3CC4A 5FRMA 2VGNA 3PMIA 2P0KA 4BI8B 4IURA 4MZPA 3CCJA 4O5VA 1N27A 4HT9A 4BDYA 2FHDA 2OTLA 4V2SA 1NPPA 3QUIA 4ZTJA 2LT4A 5KCHA 3L2ZA 3S6WA 3QJ6A 3UPUA 3ZBDA 1LOJA 4TVRA 3TREA 2CZ7B 3R6OA 2ZPIB 1MGQA 1W4SA 1UGRB 2DJZA 2RJDA 3RMQA 3QXEB 3OYBA 2ZCFB 3QDRB 5D6XA 1N8RU 4M75B 3E9FA 3JCMe 4C8QC 2DZCA 3BW1A 5GMKe 1M8VA 4M75D 3J81E 5KE2A 3RERA 3LYIA 4JRKA 2DXCA 2RK1A 3CXCS 3HHTB 4M7AG 4P5NA 5LJ5g 2IVWA 3OA6A 3JCMJ 4MZTA 2XU8A 4XTVA 2R5AA 3HP9A 2LQ8A 4X9CA 4BI4A 3GPLA 5A2QE 5LJ3j 1YJ9T 5GANf 5GMKh 5I2SA 4M77G 2DAQA 4J8OA 1G3WA 3QO3A 3A8LB 2HQXA 1I4K1 3CMET 4KUDK 4M78G 4JS4A 4XTZA 1Q82U 3E1SA 3SWNB 1RL2A 3VUBA 4QVDA 4J83A 3OB9A 2QXFA 3V8LA 3G4ST 2IG0A 3L2WA 1WGSA 2GCXA 2MWPA 2PUKB 3HRSA 3NTKA 5GAMj 3EAEA 3JCMb 4KULA 1VIFA 2E65A 5CK9A 5LL6S 1QP2A 5FLXE 1QP3A 3NFCA 2QQSA 2L5QA 4C5IA 4C92E 3VKIA 3OYFA 1OYXA 3CBOA 4OVAA 4QVZA 4OB0B 5LJ5e 2EQJA 3L2QA 4ZTFA 1VIEA 2KY9A 3C94A 1K73C 1YJNT 4II1A 3G4SA 3OBYA 5L8RE 1PSFA 4QQGA 5DLOA 3CCST 4PJOA 4RG8A 4JRQA 2VV5A 4J6WA 3OYJA 5GAN3 3M5AA 2F69A 4C5GA 4BD3A 4XU0A 1KQ1A 3CCQT 2QQAA 2MAMA 2OAUA 2E41A 3QYHB 2DIQA 2EYQA 4JRIA 1FX7A 3L1AA 3CC7T 4FIBA 5GMKm 4F7UG 3CCSA 4GLKA 2DXTA 2EFIA 3P8DA 1VQ9T 2AHJB 1BI1A 2PVGB 3HPWA 1KQ2A 1MHNA 2E6NA 3AHUA 1NPRA 4FL6A 5J39A 1KC8U 3DLMA 3VJPA 4M78B 2XHCA 3OYNA 3FC3A 3CCQA 5CKFA 2XDPA 2QQRA 4M78D 3RESA 1BYMA 3FB9A 3CC7A 4J5YA 2EJFA 4WF2A 1XNIA 2D9TA 2LTOA 3CPFA 3FRNA 2K5IA 1VQ9A 4QW2A 5CCAA 4KBMB 1HXDA 4FT2A 1Q7YC 3ASKA 2EKOA 1YIJT 1IZ6A 3HRUA 5GAOm 3PFSA 2LC4A 3PMTA 4LDUA 4Q5WA 3OSVA 4M7AC 3HFNA 2YRVA 4O6JA 2QQBA 3OS5A 4NL2A 3JB9D 3LW5E 3MP1A 2GFUA 3RUXA 1I8FA 2MF2A 5I2MA 3QBYA 5AYFA 4M77C 3JCMf 2K3XA 2CKKA 2DO3A 2K2VA 2X4JA 1YIJA 5CKEA 3MCAB 1M1KC 4PJOE 3GIBA 4M75F 4EMKA 1O75A 1M9SA 2KVQG 4M7DA 1WJSA 3JCMW 3CCVA 4F7UB 3CMAT 2LNVA 2DXBA 1K8AU 2CZ1B 1M5Q1 1Y96B 2XD0A 1BIBA 1BKBA 2QEXT 3Q1JA 1K9MU 2VYTA 2Y4XA 1KD1U 5D6YA 4XU1A 2DD5A 4C8QB 3M4YA 1NZ9A 2M9UA 2VXFA 4A4EA 2WACA 4C8QD 3CMAA 2E6ZA 3BDUA 3HRTA 2E1HA 4RMOA 1Q86C 3QSUA 3RKXA 4XTXA 3OW2A 2KQWA 2P4TA 4BI3A 5M9OA 3S3NA 2QTXA 3JCMQ 2YHTA 3GNGA 2QEXA 2RI3A 4N0AA 2Y90A 4QQDA 4RKUE 5CQYA 3V7CA 4ZGEB 2E12A 2HNIA 1VQ7T 3A5ZB 2HBPA 2L3RA 3G71A 1P92A 1M90C 4IUPA 2JN0A 4C92A 2FB7A 3S3MA 1YBYA 4XK8E 4LDYA 2DEQA 2ZGWA 3KBGA 4PJOC 5CVIA 4C5HA 3JAME 1UB4A 4DA4A 1D3BA 4BB7A 3C4SA 5CR2A 3TU4K 4PL6A 1VQ7A 2EAYA 4C5EA 4Z02A 4UC4A 2RA2A 3CC2T 4EMHA 5LJ3g 3SDZA 1NJIC 2F5TX 2RHXA 4C92G 5GAN8 4JS5A 4BE0A 2KAFA 4M7DE 2X4YA 4ME7A 3EFRA 5CKHA 2QA4T 3UT1A 1KQSS 1I5LA 1U1TA 2HAXA 3WVDB 1QVFA 2P0PA 1JB0E 3MP8A 2QI2A 5GMKj 1VQ8T 2WSFE 2CGHA 4HCCA 2K5LA 2X35A 3JCMh 2JNGA 1ZQ1A 3EFSA 3CC2A 1AHJB 4L59A 5LJ5d 3INZA 5CKBA 5GMKi 1WJRA 3OS1A 3X20B 5GAMg 4X34A 2C06A 1JJ2A 2QDYB 2EQUA 2FYKA 4Y28E 1V29B 4M78F 4OB2B 2FL7A 4NOYA 3OYCA 4X9DA 4MDXA 1JRIA 1VQMT 1VQ8A 1FWZA 4CI0C 2RI5A 1N6AA 2Y4YA 5FU6B 1YJ9A 4ELZC 1QVGA 2KSSA 5D6WA 4JLGA 5LJ3e 2K5FA 3M57A 3UDCA 4ZN3A 3CCMT 4IUTA 2RI2A 2ZPFB 3M9QA 4E7LA 2PVDB 2RHZA 3CMEA 4N4HA 5A0GA 3JB9F 1SSFA 3JSCA 3CPWA 4C0FA 3J7AF 1ZHIA 4EPCA 4JJNK 1M1FA 3JB9I 3OMCA 4HCZA 4OF1A 4NS5A 3G71T 1WNLA 2DZ9A 5GAMe 4XTUA 2F5KA 4PLLA 3CCMA 1Q81C 1UGPB 3A8OB 4Y91A 3L2VA 2LVMA 2WSCE 5LJ5h 4NL3A 3OYDA 2RHIA 1UEBA 1UGQB 2HD0A 4M7AB 4E47A 2RHYA 5HK3A 3JB9J 3HSBA 4DQ2A 1JBMA 2D0QB 2I2LA 2RK2A 2R58A 3CD6T 1H3ZA 4M7AD 3ER0A 1YJNA 3JB9H 2E5QA 3BDLA 3G6ET 4F7UF 3OQ5A 3QZ9B 1BIAA 1VQ5T 4M77B 2LCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGL A;  2O4X A;  2M16 A;  2HQE A;  3QBY A;  5KE3 A;  2K3X A;  3CEY A;  1OZ2 A;  2CKK A;  2JZ2 A;  3PMI A;  2P0K A;  3QII A;  3QKJ A;  4A4H A;  5FRM A;  3H8Z A;  4IUR A;  4RG2 A;  2O4X B;  1N27 A;  4CRI A;  4BDY A;  2FHD A;  4ZTJ A;  1WJS A;  2GFA A;  5KCH A;  3OYL A;  2DIG A;  3LX7 A;  3QJ6 A;  3S6W A;  3H6Z A;  3LGF A;  4N4G A;  2L8D A;  2LRQ A;  4BAC A;  3O8V A;  2RJD A;  3Q1J A;  2G3R A;  2VYT A;  3KUF A;  3MO8 A;  3OYB A;  4GY5 A;  5D6Y A;  2NLU A;  5D6X A;  5IN1 A;  3E9F A;  4A4E A;  2WAC A;  1OI1 A;  5IAY A;  5KE2 A;  3LYI A;  2XK0 A;  3OYM A;  5M9O A;  4IUQ A;  3S3N A;  1KHC A;  3OA6 A;  5FRN A;  2K3Y A;  3DB3 A;  4ZTF A;  2R5A A;  2RI3 A;  4B9W A;  4QQD A;  3MP6 A;  2BIV A;  3OYI A;  2L3R A;  2DAQ A;  4BE1 A;  2JTF A;  4IUP A;  5CIU A;  2BKD N;  3S3M A;  2RO0 A;  3P8H A;  2HQX A;  3UWN A;  3ME9 A;  3OYE A;  3OYH A;  2M0O A;  3E9G A;  3OS0 A;  4C5H A;  3C4S A;  3OB9 A;  4PL6 A;  2X4W A;  4EDU A;  4C5E A;  4Z02 A;  2IG0 A;  3L2W A;  4LD6 A;  1WGS A;  2MWP A;  1RI0 A;  2MWO A;  3MEV A;  3NTK A;  4UC4 A;  3EAE A;  4E7K A;  4IUV A;  3SD4 A;  4E7I A;  2R5M A;  2RHX A;  4BE0 A;  2M1H A;  3PNW C;  4FU6 A;  2X4Y A;  2EQM A;  3UT1 A;  2QQS A;  4C5I A;  3FEO A;  5J26 A;  3MEW A;  4PLI A;  2GF7 A;  1OYX A;  4OVA A;  4QVZ A;  5KCO A;  3MP8 A;  3OYF A;  2EQJ A;  3L2Q A;  3L2R A;  3S3O A;  3FDR A;  2L89 A;  4II1 A;  4BE2 A;  2RJE A;  2X35 A;  4A4G A;  5C0M A;  2RHU A;  4L59 A;  4QQG A;  3OS1 A;  1WJR A;  2B8A A;  4X34 A;  1WJQ A;  4B9X A;  3OYJ A;  2EQU A;  3GOX A;  3DB4 A;  3MEU A;  4C5G A;  2BUD A;  2RJC A;  1OZ3 A;  4BD3 A;  2RJF A;  3OY9 A;  2R57 A;  3OYC A;  5FRO A;  3OYA A;  4BDZ A;  1G5V A;  5KH6 A;  3NTH A;  2DIQ A;  2RI5 A;  4IUU A;  3OYK A;  2PQW A;  3P8D A;  2EFI A;  5D6W A;  1MHN A;  2E6N A;  2X4X A;  2RI2 A;  3M9Q A;  4FL6 A;  4IUT A;  2RHZ A;  5J39 A;  4E7L A;  3DLM A;  3LH0 A;  3FLG A;  3LLR A;  3OMG A;  4N4H A;  4A4F A;  3OYN A;  3FC3 A;  1SSF A;  2XDP A;  3MET A;  2QQR A;  4N4I A;  4E7H A;  4E7J A;  3OMC A;  4HCZ A;  1XNI A;  2D9T A;  2LTO A;  3F70 A;  4NS5 A;  4QQ6 A;  3MEA A;  4QW2 A;  3OS2 A;  2F5K A;  4PLL A;  2LDM A;  3ASK A;  2EKO A;  2LVM A;  3OYG A;  3L2V A;  3OYD A;  3PFS A;  2RHI A;  3L2U A;  2EQK A;  2RHY A;  3L42 A;  3PMT A;  4Q5W A;  5C6S A;  1H3Z A;  2R58 A;  2YRV A;  2E5Q A;  3BDL A;  3NTI A;  3OQ5 A;  3MP1 A;  2GFU A;  4IKF A;  3ZEH A;  2LCC A; 
#chains in the Genus database with same CATH topology
 4PJO G;  1PKS A;  5GAN g;  4LXC A;  4CRI A;  1GL5 A;  2KMT A;  2JUF A;  4X1V A;  1Y7X A;  3DLL A;  4FSX A;  1FMK A;  3H6Z A;  4XTY A;  1VQ6 Q;  1AWX A;  2RQT A;  1RAB B;  3OSS C;  3RNJ A;  2RM4 A;  4GLM A;  3M0T A;  4BAC A;  2DE0 X;  2ZAE A;  5I21 A;  1M8M A;  4J9F A;  2NLU A;  1BI0 A;  3G7Z A;  3V7R A;  2QAS A;  2CUB A;  3PT9 A;  1KHC A;  3BY7 A;  2DLP A;  3A98 A;  5CAI A;  1VQO A;  3OYI A;  4F14 A;  2HSP A;  5IHK A;  2YLC A;  1S72 Q;  2JTM A;  1PM3 A;  4PJO B;  1NJI R;  4OB1 B;  3E9G A;  3OS0 A;  1U8R A;  4PJO D;  3TQ7 P;  2DER A;  1IGU A;  1ZBX A;  1D1A A;  5D7U A;  1TUD A;  5I22 A;  5DM7 R;  1R77 A;  3MEW A;  1IO6 A;  5LJ5 f;  5J3B A;  3NPF A;  2BZY A;  3I56 Q;  3EFO B;  2BUD A;  3OY9 A;  3CCJ T;  5KH6 A;  1MMN A;  1O9S A;  2YDL A;  1GXI E;  1Q86 U;  1BI2 A;  1YI2 T;  1K73 R;  2DET A;  3CCR T;  3H41 A;  4AFZ C;  3FJP A;  3OMG A;  2V8J A;  3OW2 S;  4D8K A;  1PG5 B;  2EW3 A;  4EMK B;  1R0B G;  3DKM A;  4HCB A;  2OTJ A;  4JLI A;  2DYB A;  2HKQ B;  4ZGJ B;  1NJI U;  5GAM d;  1KHI A;  3EHR A;  4XAX B;  5A0D A;  1Q82 C;  2J05 A;  1NE8 A;  3M54 A;  1GRI A;  5ECA A;  2JZ2 A;  4DEY A;  4QKU A;  3P8B B;  2FRY A;  4DOW A;  1UEC A;  3TVT A;  1YIT A;  3OBW A;  3RBB B;  4EMK C;  5LJ5 j;  2LJ0 A;  1SEM A;  3WVE B;  4C92 B;  1JJ2 S;  3MO8 A;  3KUF A;  4C92 D;  1X75 C;  2COW A;  5IN1 A;  1M1K R;  4FSS A;  3CCE T;  2QAZ A;  2EWN A;  4LDV A;  3G1J A;  3O5Z A;  3JB9 G;  2GTO A;  3CCL Q;  2QQ9 A;  2BIV A;  1KC8 C;  3SFM A;  4HXJ A;  2EJG A;  2K4Y A;  2RO0 A;  1PSE A;  1RUW A;  4E2F B;  1VQN T;  3SWN C;  1WDX A;  4ZGD B;  1VQL T;  2VUB A;  1KSW A;  4PLI A;  3L2R A;  1R0C B;  2KGT A;  1YJW Q;  4A4G A;  1WLP B;  4OB3 B;  4BY6 B;  3CCU A;  3EG1 A;  1N8R R;  1D1C A;  1VQK Q;  3JV3 A;  3JCM V;  4M7D F;  5GAO r;  1K9M C;  1KD1 C;  1M1K U;  2HKN A;  3CC4 Q;  2NUT B;  3LLR A;  1IHW A;  1RAH B;  1LJO A;  2DIL A;  2EQI A;  3C12 A;  3MPU B;  1WFW A;  1OQK A;  1YN8 A;  1WZO A;  3F70 A;  4QQ6 A;  2KE9 A;  1UTI A;  2K3B A;  4LN2 A;  3MEA A;  3URG A;  4FCY A;  4L6V 5;  1M3C A;  2LX9 A;  4BY6 C;  5GAM f;  1I07 A;  1SPK A;  2OTL T;  2KBT A;  2CZ0 B;  5FW9 A;  5IXF A;  2CH4 W;  2COY A;  2A36 A;  2A7Y A;  4IIM A;  3PMI A;  4BI8 B;  1JXM A;  1Q81 R;  1N27 A;  2CSQ A;  4BDY A;  2LCS A;  3QWY A;  2CDT A;  2LT4 A;  5KCH A;  3UA6 A;  2CP0 A;  2KRS A;  1LOJ A;  4TVR A;  3R6O A;  2DJZ A;  4E7S A;  3OYB A;  2PTK A;  1W1F A;  1N8R U;  2ED1 A;  1M8V A;  3BW1 A;  1OX9 A;  3CPW P;  1ZX6 A;  2YUP A;  1UDL A;  4BI4 A;  1KFZ A;  4K11 A;  5GAN f;  2FZG B;  2DAQ A;  1ZLM A;  2KRM A;  2EVR A;  4KUD K;  4XTZ A;  4QVD A;  2D8J A;  1LPL A;  1S1N A;  4J83 A;  1M30 A;  3V8L A;  3G4S T;  3L2W A;  1WGS A;  5GAM j;  3EAE A;  4KUL A;  2E65 A;  5CK9 A;  1QP2 A;  1K76 A;  3H9N A;  4C5I A;  2L5Q A;  2P84 A;  1ABO A;  2QYZ A;  5IXB A;  5LJ5 e;  3L2Q A;  3CCQ Q;  4ZTF A;  1VIE A;  4Z88 A;  1H92 A;  3CCS T;  4JRQ A;  2F69 A;  2OAU A;  2LMJ A;  1FX7 A;  4DBQ A;  3CC7 T;  4FIB A;  1BI1 A;  2FRW A;  2SRC A;  1YCS B;  3AT1 B;  4RTT A;  3VJP A;  2XDP A;  3I35 A;  3RES A;  3REB B;  5CCA A;  1YIJ T;  3HRU A;  3PMT A;  5AT1 B;  3QWX X;  2YRV A;  3IQL A;  1I8F A;  5AYF A;  1C0M A;  2CKK A;  2X4J A;  2JS0 A;  4IIO A;  2QEX Q;  3GIB A;  1J3T A;  1U3O A;  2GNC A;  2O31 A;  1MMG A;  1RAA B;  3CMA T;  2YRD A;  2DXB A;  1K8A U;  2CZ1 B;  1SRL A;  1NBE B;  3EHQ A;  1RAI B;  3PVL A;  2DD5 A;  3M4Y A;  1PD0 A;  4A4E A;  3BDU A;  2MYS A;  1H8K A;  2VAS A;  4XTX A;  2QTX A;  2HMA A;  5IHI A;  4N0A A;  3V7C A;  2Y90 A;  4ZGE B;  1VQ7 T;  1H3H A;  2D8H A;  1TWB A;  2L3R A;  1K0S A;  1MUZ A;  2HQH A;  1BBZ A;  1M27 C;  2DL8 A;  2I0N A;  1YBY A;  2QA4 Q;  2DEQ A;  3KBG A;  2LJ3 A;  1D3B A;  3TU4 K;  3CC2 T;  1X2K A;  5GAN 8;  4JS5 A;  4BE0 A;  2CP6 A;  2KAF A;  2X4Y A;  3EFR A;  2A0F B;  5GMK j;  2CGH A;  1M2V A;  1B7T A;  2B86 A;  3INZ A;  3X20 B;  1TUG B;  4CI0 C;  2A28 A;  5FU6 B;  4ORZ A;  3HTR A;  2M0Y A;  1TS9 A;  3M57 A;  4ZN3 A;  3M9Q A;  2DVJ A;  2QK0 A;  4J9E A;  1SSF A;  1VA7 A;  3J7A F;  2EYY A;  3EGD A;  1MMD A;  5GAM e;  1QWF A;  2F5K A;  3CCM A;  3A8O B;  2DNU A;  3L2V A;  2LVM A;  1UEB A;  2RHI A;  2D0Q B;  2RK2 A;  1TOV A;  3OQ5 A;  1BIA A;  2ESW A;  2M16 A;  5FU6 C;  2DTO A;  3QII A;  4J9B A;  2O4X B;  1VQO Q;  1W2B P;  2QDL A;  2GFA A;  4J6Y A;  3PVQ A;  3QYG B;  4N4G A;  1B34 A;  4J9I A;  4RTV A;  3CCL T;  1HYO A;  4HVV A;  2G3R A;  1Y57 A;  1XOV A;  2XKO C;  1OI1 A;  4FYV B;  2KRN A;  3X25 B;  5GAN e;  1YHQ T;  5HCK A;  5GAO n;  4J7I A;  1UJY A;  1I81 A;  1Q7Y U;  3QJY A;  3VV0 A;  2BKD N;  1SRM A;  1WPY A;  2FVU A;  2KXC A;  1VQP T;  3T9N A;  2ROL A;  4OMQ A;  1CKA A;  4LD6 A;  2R5M A;  4E6R A;  2M1H A;  1UG1 A;  3S3O A;  2DK3 A;  3NGP A;  2KDS A;  2EYW A;  3EG0 A;  2H3E B;  2JOY A;  1DJ7 B;  3CC4 T;  3SWN A;  2OTJ Q;  4XU3 A;  1RLP C;  5IHN A;  4ELY C;  3JCM g;  2LT1 A;  2HBW A;  2O01 E;  3CXC A;  1EIF A;  5GAO q;  3HFO A;  1N9R A;  4IKF A;  1UFF A;  4M7A F;  1AWJ A;  1M90 U;  1JO8 A;  4E7H A;  4HA8 A;  1YIT Q;  1YI2 A;  4M77 F;  3CCR A;  4Z89 A;  3HL8 A;  8AT1 B;  4M7A A;  3OS2 A;  2QA4 A;  4CC7 A;  4A63 B;  2E3H A;  4M77 A;  2QGF B;  2G6F X;  3M55 A;  3ZEH A;  1AWO A;  1PC0 A;  3I55 T;  1ZSG A;  1OZ2 A;  3H0H A;  4A4H A;  3H8Z A;  1QW1 A;  4FT4 A;  1ZBJ A;  4RTY A;  4C0Z A;  2DKG A;  3MHX A;  4LDX A;  2ZPH B;  2E5K A;  1X69 A;  1I0C A;  1OX8 A;  1D3B B;  2DTH A;  1X01 A;  2PNI A;  3M58 A;  2MIO A;  2XK0 A;  2FPD A;  4IUQ A;  3PIP A;  4DEX A;  1OU9 A;  4M7A E;  4RTX A;  4KGZ B;  3CCE A;  3EG3 A;  1BB9 A;  1M2V B;  3G6E A;  1Y96 A;  3FIF A;  4N0A C;  1RAD B;  4M77 E;  1VQ5 A;  3CCU Q;  3OYE A;  1RAG B;  4ZN1 A;  1WQW A;  1Q86 R;  4EDU A;  2V26 A;  3MEV A;  1RI0 A;  3QHS A;  4J9G A;  2DMO A;  2W10 A;  3H0I A;  5FU7 B;  1VQN A;  1QKX A;  4OGC A;  1X6G A;  3GF5 A;  4J7F A;  3FDR A;  1WX6 A;  2MOX A;  4YTL A;  2JVV A;  3V8K A;  2B8A A;  1VQL A;  3EGD B;  2D1X A;  2RD1 A;  4QVC A;  2RJF A;  2EIF A;  5FRO A;  3VYH B;  5I11 A;  1CSK A;  3VS7 A;  2MI6 A;  3JCM X;  2ZPE B;  5EG2 A;  2KXD A;  3CBM A;  4EIK A;  5FU7 C;  2XDB A;  1ABQ A;  2V1Q A;  5CO7 A;  1W2B S;  4LDW A;  1LNX A;  1WHJ A;  1GBQ A;  1V1C A;  1QCO A;  4MDW A;  1B34 B;  2D6F A;  2BE9 B;  2YUO A;  4OML A;  1KQS A;  3EGX B;  1X43 A;  3KFV A;  1B07 A;  1AEY A;  3JCM d;  3JCM P;  2XG8 D;  1UJ0 A;  2VGN A;  1VYV A;  4MZP A;  1ARK A;  3U23 A;  4HT9 A;  2OTL A;  1AD5 A;  1NPP A;  3QUI A;  4ZTJ A;  3FJ5 A;  3ZBD A;  1WHM A;  2CZ7 B;  2RN8 A;  2QTV A;  1UGR B;  2HL3 A;  2ZCF B;  1YJ9 Q;  2DBK A;  4DBF A;  2DZC A;  2X3W D;  2DL3 A;  3J81 E;  3RER A;  4ESR A;  2RK1 A;  4M7A G;  3C0C A;  4P5N A;  2R5A A;  1I5O B;  3ZL7 C;  2RPN A;  2EGE A;  8ATC B;  4M77 G;  3EG9 A;  4J8O A;  2VWF A;  1UGV A;  5KYW A;  1I4K 1;  2FEI A;  1Q82 U;  3SWN B;  1RL2 A;  3VUB A;  2VKN A;  2OI3 A;  1W6X A;  2ABL A;  2GCX A;  2LNH B;  2MWP A;  2PUK B;  5LL6 S;  1QP3 A;  3NFC A;  3VKI A;  4OMP A;  1KJW A;  3CBO A;  4OB0 B;  1K73 C;  4II1 A;  3G4S A;  3OBY A;  5L8R E;  1T3S A;  2HL5 C;  3M5A A;  1KD1 R;  4BD3 A;  1PWT A;  1SG5 A;  4JJD A;  3QYH B;  2P4R A;  2DIQ A;  2EYQ A;  3EG2 A;  4JRI A;  3L1A A;  1G2B A;  3CCS A;  1NM7 A;  2IPO B;  1VQ9 T;  3HPW A;  2E6N A;  3AHU A;  5J39 A;  1KC8 U;  3OYN A;  3FC3 A;  1QLY A;  1BYM A;  3FB9 A;  3CC7 A;  4J5Y A;  1RI9 A;  2EJF A;  3CPF A;  1OEB A;  4KBM B;  5GAO m;  4LDU A;  4M7A C;  3HFN A;  2QQB A;  4AT1 B;  3JB9 D;  3LW5 E;  2A08 A;  3JCM f;  4M77 C;  1RAE B;  1YIJ A;  5CKE A;  1M1K C;  4M75 F;  4RUG A;  4M7D A;  1WJS A;  3JCM W;  3CCV A;  5FWC A;  4HVU A;  1N5Z A;  1C1A A;  1Y96 B;  1BIB A;  1BKB A;  2JMA A;  3Q1J A;  3SEM A;  2VYT A;  1KD1 U;  1K9M U;  1GBR A;  5IH2 A;  1ZUU A;  1WHH A;  2PZ1 A;  4JJC A;  2JTE A;  3CMA A;  2GQI A;  3HRT A;  2E1H A;  2YT6 A;  3QSU A;  3OW2 A;  5M9O A;  1QVF P;  4R0K A;  3JCM Q;  2RI3 A;  2YSQ A;  2ECZ A;  2HNI A;  1FMW A;  1BCM A;  2LQN A;  2OAW A;  2ZGW A;  4PK4 A;  1RAF B;  5CVI A;  4C5H A;  4M4Z A;  3C4S A;  1VQ7 A;  1BU1 A;  1TSF A;  4C5E A;  3A1P A;  1QVG P;  4WTO B;  4ZNX A;  4M7D E;  1U1T A;  1AWW A;  3MP8 A;  1VQ8 T;  2WSF E;  2K5L A;  2X35 A;  3JCM h;  2JNG A;  1ZQ1 A;  1K1Z A;  3EFS A;  3CC2 A;  4L59 A;  1WJR A;  1JJ2 A;  2LP5 A;  4WCI A;  3CCM Q;  2K9G A;  4M78 F;  4OB2 B;  2FL7 A;  4X9D A;  2L2P A;  1FWZ A;  1YJ9 A;  2KSS A;  3UDC A;  2RQV A;  4IUT A;  2RF0 A;  2RI2 A;  1MMA A;  4E7L A;  3CME A;  1EZZ B;  4N4H A;  4OMN A;  2YUN A;  2CP2 A;  4C0F A;  3UF4 A;  3JB9 I;  3NHN A;  4HCZ A;  4OF1 A;  3VS1 A;  1K8A R;  3G71 T;  1Q81 C;  4PLL A;  1UGP B;  4Y91 A;  2FZC B;  2HD0 A;  4FW1 A;  4E47 A;  4DQ2 A;  3CD6 T;  1YJN A;  4F7U F;  2LCC A;  2EFI A;  5KE3 A;  1VQ4 T;  4OMF B;  3EGU A;  4L5G A;  1D1B A;  4C8Q F;  3M59 A;  3VU3 C;  1U5S A;  4AFQ C;  2DIG A;  5GAN 7;  3EG9 B;  4MMK A;  1R8O B;  2L8D A;  1Y07 A;  4C8Q A;  2PUO B;  3NMZ C;  1GFD A;  5KYW B;  1AZE A;  4RTZ A;  4Z8A A;  1PRL C;  5A0L A;  1VQ6 T;  2LQW A;  2W0Z A;  2MMP A;  1MND A;  4HKE A;  4AMC A;  2NUP A;  4BE1 A;  2DFU A;  2AZS A;  2EKH A;  2EGC A;  3LWH A;  1ZA2 B;  3UWN A;  2YXY A;  1YHQ A;  4PJM A;  1NEG A;  2V8K A;  3THK A;  1IGQ A;  1S72 T;  4M7D G;  2DXU A;  3EH1 A;  4ATO A;  4CC2 A;  5J26 A;  2O2O A;  3VUZ A;  4A54 A;  2DEU A;  3X28 B;  3X24 B;  1VQP A;  1NG2 A;  1YI2 Q;  4C8Q E;  3CCR Q;  3D7S B;  3GOX A;  2KK4 A;  2XDD A;  3DB4 A;  5GJW B;  4KUI A;  4PFO A;  2RJC A;  2MPX C;  5GAN 4;  2R57 A;  2AK5 A;  3M56 A;  1YWP A;  1NYG A;  4IUU A;  2E3I A;  1OUL A;  4J9C A;  4LD9 K;  1TXQ A;  3I56 T;  3VRY A;  2VC8 A;  4HT8 A;  2GBQ A;  2J6K A;  4M7D B;  3GP8 A;  1NLO C;  2WSE E;  1WHG A;  4M7D D;  5GAO l;  2K57 A;  4F04 B;  2Z0W A;  3L42 A;  1UHF A;  2H3J A;  3JCM c;  3VS0 A;  1WHK A;  3NTI A;  1X6B A;  1TH7 A;  5KYU A;  2HQE A;  2VGM A;  3BFM A;  4J9D A;  3TCJ A;  4RG2 A;  4OGE A;  2DF6 A;  1VQM A;  2YLB A;  1Q7Y R;  1QVF S;  1GFC A;  2RB6 A;  2RQR A;  3CCE Q;  1SKU B;  5LJ3 h;  3G6E Q;  2DD4 A;  4VUB A;  5DY9 A;  1VQ5 Q;  3I55 A;  4M7D C;  4RCC A;  2CH4 A;  1QMC A;  2FG0 A;  3O8V A;  4JPB W;  5EC7 A;  3VS3 A;  4R55 A;  2JJ9 A;  1MNE A;  3A8M B;  4M75 C;  2DVE A;  4PJO F;  1QVG S;  3OYM A;  2DA9 A;  3VYG A;  1IB8 A;  4MZM A;  3E2U A;  1FXX A;  1VQN Q;  1N9S A;  1PD1 A;  4B9W A;  2BTT A;  1U1S A;  1XTD A;  2JS2 A;  4E7Z A;  2M51 A;  3MKD A;  3CPW S;  5CKD A;  4BUG A;  1VQL Q;  2A3L A;  4RCB A;  3P8H A;  1TU0 B;  2M0O A;  1M4Z A;  1XQH A;  4AFU C;  2DRK A;  1YCY A;  2MWO A;  3M53 A;  3SD4 A;  5HKC A;  2XIC A;  4E7I A;  1G83 A;  1OPL A;  3RKW A;  1M90 R;  3A8G B;  2AIR B;  2FZK B;  3FEO A;  3WXM B;  5KCO A;  1G3Y A;  2MK5 A;  2DL4 A;  4C0G A;  4C8Q G;  3SB2 A;  4LE9 A;  3VS2 A;  2L89 A;  4BE2 A;  2RJE A;  4LNP A;  1HJD A;  1WJQ A;  5HY6 A;  3UA7 A;  4BDZ A;  3OYA A;  1G5V A;  3ZFJ A;  3NTH A;  2FPE A;  1YJW T;  1VYT A;  4J6X A;  2ENM A;  5KYX A;  3OYK A;  2PQW A;  2KYM A;  2JMC A;  3GNF B;  1VYU A;  2X4X A;  2CP7 A;  1OPK A;  2V8I A;  4M78 C;  2CS7 A;  1VQK T;  2E10 A;  2OTL Q;  2HEQ A;  4ANJ A;  1EX4 A;  2P0Q A;  3MJX A;  3JRZ A;  2LQK A;  2LX7 A;  2F2V A;  2DJQ A;  4XTW A;  1QVP A;  4JDS A;  3A8H B;  2CP5 A;  4F16 A;  5FRN A;  4C92 F;  5FRM A;  4IUR A;  3CCJ A;  2ED0 A;  1ZSZ C;  4V2S A;  4RTU A;  1JU5 C;  3UPU A;  2YRC A;  2NUP B;  3TRE A;  1X2Q A;  2ZPI B;  3RMQ A;  3M0U A;  4HCK A;  2RJD A;  1AT1 B;  2OX7 A;  1I1J A;  3E9F A;  4C8Q C;  5GMK e;  5KE2 A;  4PFZ A;  3LYI A;  2CT3 A;  2DXC A;  1VOM A;  2YUQ A;  4X9C A;  3GPL A;  5A2Q E;  3G4S Q;  5I2S A;  1G3W A;  1KK7 A;  3QO3 A;  3A8L B;  1IRX A;  3PE0 A;  1UUE A;  4JS4 A;  3E1S A;  1NLP C;  2IG0 A;  3I5S A;  3HRS A;  2DBM A;  3NTK A;  3CCS Q;  1VIF A;  5FLX E;  2QQS A;  4C92 E;  3OYF A;  1OYX A;  4QVZ A;  1OU8 A;  2EQJ A;  3CC7 Q;  1PSF A;  1PCX A;  4QQG A;  2VV5 A;  3OYJ A;  5GAN 3;  4C5G A;  4XU0 A;  2LJ1 A;  2DM1 A;  1KQ1 A;  3CCQ T;  2QQA A;  2MAM A;  2E41 A;  4KGV B;  2CUD A;  2JXB A;  5GMK m;  2DXT A;  3P8D A;  1KQ2 A;  2PVG B;  1KIK A;  1MHN A;  4FL6 A;  1YIJ Q;  5KYU B;  1OOT A;  1D09 B;  2JM8 A;  2KT1 A;  2YWW A;  2K7A A;  1HSQ A;  3CCV Q;  1E7O A;  2D9T A;  2LTO A;  3FRN A;  1VQ9 A;  4QW2 A;  4FT2 A;  2EPD A;  5GJV B;  3PFS A;  1TTH B;  2LC4 A;  2BZX A;  2GTJ A;  4NL2 A;  2AT1 B;  2DX1 A;  3MP1 A;  2C0I A;  3CMA Q;  1BCO A;  2AZV A;  3QBY A;  2K3X A;  2K2V A;  3MCA B;  3TSZ A;  1O75 A;  2CRE A;  1GCP A;  2LZ6 B;  3M0Q A;  2LNV A;  1Q82 R;  2XD0 A;  2QEX T;  1VQ7 Q;  2EYZ A;  5D6Y A;  4JZ3 A;  1NZ9 A;  2M9U A;  4CC3 A;  2VXF A;  2WAC A;  2O9S A;  4KH0 B;  1Q86 C;  3RKX A;  2KQW A;  3RR6 A;  3S3N A;  4OMO A;  2YHT A;  2XMF A;  4QQD A;  4RKU E;  3A5Z B;  1LVK A;  2HBP A;  1EFN A;  2KRO A;  1P92 A;  3CC2 Q;  1TUC A;  4IUP A;  2JN0 A;  2HDA A;  3S3M A;  1NYF A;  1BK2 A;  4PJO C;  4DA4 A;  2D0N A;  2AKK A;  4BB7 A;  5CR2 A;  4PL6 A;  2EAY A;  3BE3 A;  2RA2 A;  5LJ3 g;  3SDZ A;  1NJI C;  2RNA A;  2F5T X;  1KC8 R;  4C92 G;  5KYX B;  5CKH A;  2QA4 T;  1I5L A;  3UT1 A;  2F1L A;  2J06 A;  4FW2 A;  3WVD B;  3CME Q;  4LUE A;  2QI2 A;  5L23 A;  2K6D A;  3OS1 A;  5GMK i;  5KYY A;  2C06 A;  2QDY B;  2FYK A;  4Y28 E;  4NOY A;  1M2O A;  4MDX A;  1VQ8 A;  2GGR A;  2RMO A;  1YJN Q;  4ELZ C;  2O88 A;  7AT1 B;  5D6W A;  2K5F A;  4J9H A;  4OMM A;  1YFN A;  1D0X A;  2ZPF B;  2PVD B;  4F17 A;  5A0G A;  3JSC A;  4GBQ A;  1ZHI A;  4EPC A;  1M1F A;  3OMC A;  2DZ9 A;  4XTU A;  1SSH A;  1K9M R;  5LJ5 h;  1UGQ B;  4M7A B;  3HSB A;  5HK3 A;  4M7A D;  3ER0 A;  4AG2 C;  1WXU A;  3BDL A;  3G6E T;  2X3X D;  1VQ5 T;  4M77 B;  3G71 A;  2RH2 A;  5CIU A;  1K73 U;  2C0O A;  3CEY A;  1WXT A;  1AZG B;  4M77 D;  3QKJ A;  1G3S A;  5IT9 E;  3CD6 A;  5GAN d;  2EGA A;  1CKB A;  3OYL A;  2E70 A;  1VQ4 A;  4A53 A;  3V8J A;  1YHQ Q;  2LRQ A;  4C92 C;  3LH5 A;  2CYZ B;  2L3P A;  5CQX A;  1VQO T;  1YP5 A;  1M1G A;  5GAO p;  3GLX A;  5IAY A;  3N5B B;  3DB3 A;  1MV3 A;  4PJJ A;  1VQP Q;  3PGG A;  1W2B A;  2BE7 D;  2DPP B;  1SF9 A;  1VQ6 A;  3ME9 A;  3VRZ A;  3OYH A;  1IHV A;  3PTA A;  4M75 A;  1MV0 B;  1OV3 A;  2XID A;  2X4W A;  4JZ4 A;  3HKS A;  3R6N A;  1IRE B;  1WXB A;  4IUV A;  3M0R A;  3CXC P;  1G3T A;  3PNW C;  3E19 A;  4PNO A;  1IXD A;  4PKC C;  4KGX B;  2DL5 A;  2NUZ A;  1S72 A;  2RHU A;  2MCN A;  3X26 B;  5GAN 2;  1OZ3 A;  4OP0 A;  1A0N B;  2X51 A;  3I5R A;  2J6F A;  4JRP A;  5GMK l;  3C95 A;  4FM4 B;  4JUV A;  1N8R C;  3RIR A;  4PJN A;  5GAN 5;  2OTJ T;  2CP3 A;  4FYX B;  1G8X A;  5KYN A;  4A4F A;  5LJ3 d;  4N4I A;  1VQM Q;  1QCN A;  4XU2 A;  4A4K A;  4M75 E;  2KYB A;  2PVO B;  2ZZD A;  2DYI A;  5DLQ E;  3I55 Q;  3I56 A;  3OYG A;  4EMG A;  2DL7 A;  1X6O A;  2EQK A;  3L2U A;  3M4G A;  2ZPG B;  1YIT T;  6AT1 B;  2O4X A;  1PNJ A;  4M78 A;  3PIO A;  3RMS A;  2KR3 A;  3LWI A;  2JT4 A;  5FWB A;  3J80 E;  3QPH A;  3LX7 A;  4XQ3 A;  2K79 A;  3LGF A;  3QDF A;  3QG1 A;  1VUB A;  1KG1 A;  3QZ5 B;  1WHL A;  4GY5 A;  4PJL A;  4JJB A;  2PU9 B;  4AFS C;  4C0D B;  3CBP A;  5GAN 6;  5GAM h;  1ZSZ A;  4KT0 E;  2L3Q A;  1HK9 A;  2GQV A;  2K3Y A;  2E64 A;  2XI9 A;  3MP6 A;  1Q81 U;  4F7U A;  5HK0 A;  1GCQ A;  4FYY B;  2CZ6 B;  2JTF A;  5KYY B;  3KXT A;  1SHF A;  4M78 E;  1Y71 A;  4E7K A;  1ZA1 B;  2JW4 A;  1Y0M A;  1H64 1;  4FU6 A;  3CCU T;  4C0D C;  2EQM A;  2GF7 A;  3CCL A;  2ATC B;  5C0M A;  4MML A;  5GAN j;  1LCK A;  4B9X A;  2CSI A;  3MEU A;  5GAN h;  1B3Q A;  2M02 A;  2J6O A;  2HCK A;  2HZY A;  2VXE A;  2HSE B;  4DOV A;  1UGS B;  1YWO A;  1K8A C;  3CCV T;  1U06 A;  1KQS P;  3OYY A;  1M3B A;  2LCL A;  4KRT A;  4F7U E;  3TEE A;  1SHG A;  3LH0 A;  3FLG A;  5LJ3 f;  3CCJ Q;  3MET A;  4M75 G;  4E7J A;  1YJW A;  3VS4 A;  2JM9 A;  2V1R A;  2FPF A;  1T0H A;  2LDM A;  1WQ7 A;  4D6W A;  4QT7 A;  2EJ9 A;  1VQK A;  4R56 A;  5C6S A;  2ROT A;  2ZPB B;  4KH1 B;  2IIM A;  3RKY A;  3LGL A;  3V7S A;  1T0J A;  2DTI A;  2VB6 A;  1BI3 A;  3CC4 A;  2P0K A;  3VS5 A;  1K4U S;  4O5V A;  2KNB B;  2FHD A;  3L2Z A;  2H8H A;  3ULR B;  3S6W A;  3QJ6 A;  3TSW A;  1JXO A;  1WI7 A;  1MGQ A;  1W4S A;  1V76 A;  3EH2 A;  3QXE B;  1E6G A;  1RLQ C;  3QDR B;  5D6X A;  4M75 B;  3JCM e;  1XJW B;  4M75 D;  2E4H A;  1PRM C;  4JRK A;  3CXC S;  3HHT B;  5LJ5 g;  2L3S A;  2IVW A;  3OA6 A;  3JCM J;  4MZT A;  2XU8 A;  4XTV A;  3HP9 A;  2LQ8 A;  3REA B;  5LJ3 j;  1YJ9 T;  5GMK h;  1C6V X;  1W70 A;  2HQX A;  3CME T;  4M78 G;  1M3A A;  2X9H A;  3OB9 A;  1QCF A;  2QXF A;  1ACM B;  4HVW A;  1QKW A;  3JCM b;  1JEG A;  1Z9Z A;  1F1B B;  1E6H A;  2CT4 A;  2OJ2 A;  4Y92 A;  1D0Y A;  4OVA A;  1QWE A;  3C94 A;  2KY9 A;  1QQJ A;  3UAT A;  1YJN T;  4CC4 B;  5DLO A;  4PJO A;  2RQW A;  4RG8 A;  1WA7 A;  4J6W A;  1VQ9 Q;  2A37 A;  1D0Z A;  4PFP A;  4DBH A;  1FYN A;  1X27 A;  4F7U G;  4GLK A;  2AHJ B;  2NWM A;  1NPR A;  3DLM A;  3CCQ A;  4M78 B;  2XHC A;  2O9V A;  1T3L A;  5CKF A;  2QG9 B;  2QQR A;  4M78 D;  1YNZ A;  4WF2 A;  1XNI A;  3GBQ A;  2K5I A;  3EFO A;  1HXD A;  1Q7Y C;  3ASK A;  2EKO A;  1IZ6 A;  2L0A A;  4Q5W A;  2KI7 A;  3OSV A;  3EGX A;  4O6J A;  3OS5 A;  1Z9Q A;  2KT8 A;  2GFU A;  1AOJ A;  3RUX A;  2MF2 A;  2VVK A;  5I2M A;  3OW2 P;  2DO3 A;  4DBR A;  1ZSZ B;  4PJO E;  1TG0 A;  4EMK A;  1M9S A;  2KVQ G;  2AKL A;  4F7U B;  1M5Q 1;  2SEM A;  4LUD A;  2Y4X A;  3I9Q A;  2RQU A;  4XU1 A;  4C8Q B;  3CQT A;  4C8Q D;  2E6Z A;  4RMO A;  1K0X A;  2F2X A;  2P4T A;  4BI3 A;  3SHW A;  3GNG A;  2QEX A;  2C0T A;  5CQY A;  1Q95 G;  2E12 A;  2FO0 A;  1M90 C;  4C92 A;  1JJ2 P;  1UE9 A;  1ZUK A;  2FB7 A;  4XK8 E;  4LDY A;  2EYX A;  1GCQ C;  3JAM E;  1UB4 A;  1JQQ A;  1VQ8 Q;  4D8D A;  4Z02 A;  4UC4 A;  1WIE A;  1PKT A;  4EMH A;  1HD3 A;  2RHX A;  4ME7 A;  1KQS S;  2HAX A;  2EBP A;  4FYW B;  9ATC B;  1QVF A;  2P0P A;  1JB0 E;  4HCC A;  1AHJ B;  5LJ5 d;  5CKB A;  1UHC A;  5GAM g;  4X34 A;  1AVZ C;  1NEB A;  2EQU A;  2J7I A;  1WYX A;  2KEA A;  1V29 B;  3VS6 A;  3M0P A;  3M0S A;  3OYC A;  2F2W A;  1JRI A;  1VQM T;  2COZ A;  3RDV A;  2NYS A;  1N6A A;  2RI5 A;  2Y4Y A;  1PHT A;  1QVG A;  5LJ3 e;  4JLG A;  3G71 Q;  3CCM T;  2DRM A;  2RHZ A;  2K2M A;  4AG1 C;  3JB9 F;  1K9A A;  3CPW A;  1RAC B;  2BZ8 A;  3CD6 Q;  4JJN K;  2QGG A;  3H0F A;  1ZUY A;  4NS5 A;  1WNL A;  1VQ4 Q;  1FMV A;  2WSC E;  4NL3 A;  3OYD A;  3JB9 J;  2RHY A;  1JBM A;  2I2L A;  4B6M A;  2R58 A;  1H3Z A;  3JB9 H;  2E5Q A;  3QZ9 B;  4RTW A;  2NUT A; 
#chains in the Genus database with same CATH homology
 4PJO G;  5FU6 C;  2M16 A;  5KE3 A;  1K73 U;  5GAN g;  1VQ4 T;  3CEY A;  2DTO A;  4M77 D;  3QII A;  4OMF B;  3QKJ A;  4L5G A;  1G3S A;  2O4X B;  5IT9 E;  4CRI A;  4C8Q F;  3CD6 A;  5GAN d;  3M59 A;  3VU3 C;  2KMT A;  2GFA A;  2JUF A;  1Y7X A;  3DLL A;  4FSX A;  3OYL A;  2DIG A;  4J6Y A;  3H6Z A;  3QYG B;  4N4G A;  5GAN 7;  4XTY A;  2E70 A;  3OSS C;  1B34 A;  1VQ4 A;  4MMK A;  1R8O B;  2L8D A;  2RM4 A;  3V8J A;  2LRQ A;  4A53 A;  1Y07 A;  4C8Q A;  2PUO B;  3CCL T;  4C92 C;  4BAC A;  2G3R A;  5I21 A;  1XOV A;  2NLU A;  1BI0 A;  2CYZ B;  5CQX A;  1VQO T;  3G7Z A;  1M1G A;  5GAO p;  3GLX A;  2XKO C;  1OI1 A;  5IAY A;  5A0L A;  3V7R A;  1VQ6 T;  3PT9 A;  3X25 B;  5GAN e;  1YHQ T;  3N5B B;  1KHC A;  3BY7 A;  3DB3 A;  5GAO n;  4J7I A;  5CAI A;  2MMP A;  1I81 A;  3PGG A;  1VQO A;  1W2B A;  3OYI A;  1Q7Y U;  4HKE A;  2YLC A;  4BE1 A;  2JTM A;  3QJY A;  3VV0 A;  2BKD N;  3LWH A;  2DPP B;  1VQ6 A;  4PJO B;  3UWN A;  3ME9 A;  4OB1 B;  1YHQ A;  1WPY A;  3OYH A;  3E9G A;  3OS0 A;  3PTA A;  1U8R A;  2FVU A;  4M75 A;  4PJO D;  2XID A;  2V8K A;  2X4W A;  1VQP T;  3HKS A;  3T9N A;  1IRE B;  4LD6 A;  1S72 T;  4M7D G;  1ZBX A;  4IUV A;  2DXU A;  4ATO A;  2R5M A;  1G3T A;  2M1H A;  3PNW C;  3E19 A;  5J26 A;  4PNO A;  5DM7 R;  3MEW A;  3VUZ A;  4A54 A;  4PKC C;  3S3O A;  2DK3 A;  3X28 B;  3X24 B;  1VQP A;  2KDS A;  4C8Q E;  1S72 A;  2RHU A;  5LJ5 f;  5J3B A;  2JOY A;  3GOX A;  2KK4 A;  1DJ7 B;  3X26 B;  3CC4 T;  2XDD A;  3DB4 A;  3SWN A;  4KUI A;  5GAN 2;  2BUD A;  2RJC A;  1OZ3 A;  5GAN 4;  3OY9 A;  4OP0 A;  2R57 A;  3CCJ T;  4XU3 A;  5KH6 A;  1O9S A;  3M56 A;  4ELY C;  3JCM g;  4JRP A;  1Q86 U;  1GXI E;  1BI2 A;  2LT1 A;  1YI2 T;  5GMK l;  4IUU A;  2O01 E;  3CCR T;  3CXC A;  3C95 A;  4LD9 K;  3FJP A;  1EIF A;  4FM4 B;  4JUV A;  3HFO A;  3RIR A;  1N9R A;  5GAO q;  3I56 T;  1N8R C;  5GAN 5;  4IKF A;  2OTJ T;  4M7A F;  3OMG A;  4A4F A;  1M90 U;  2V8J A;  5LJ3 d;  3OW2 S;  4N4I A;  2VC8 A;  4E7H A;  4HA8 A;  1YI2 A;  4HT8 A;  4XU2 A;  4A4K A;  4EMK B;  4M77 F;  4M75 E;  3CCR A;  4M7D B;  2RH2 A;  3HL8 A;  2PVO B;  3DKM A;  4HCB A;  2ZZD A;  3GP8 A;  4M7A A;  3OS2 A;  2WSE E;  5DLQ E;  3I56 A;  4M7D D;  2OTJ A;  4JLI A;  2QA4 A;  3OYG A;  5GAO l;  4EMG A;  2K57 A;  4ZGJ B;  1X6O A;  2EQK A;  3L42 A;  3L2U A;  1NJI U;  5GAM d;  3M4G A;  1KHI A;  2ZPG B;  4M77 A;  1YIT T;  2H3J A;  3JCM c;  4XAX B;  5A0D A;  1Q82 C;  3NTI A;  1NE8 A;  3M55 A;  3ZEH A;  1TH7 A;  3M54 A;  2O4X A;  2HQE A;  4M78 A;  3I55 T;  2VGM A;  3BFM A;  3PIO A;  1OZ2 A;  2JZ2 A;  3TCJ A;  3RMS A;  4A4H A;  3H8Z A;  4RG2 A;  4OGE A;  3P8B B;  1QW1 A;  4FT4 A;  4DOW A;  1VQM A;  2YLB A;  1QVF S;  3LWI A;  2RB6 A;  1YIT A;  3OBW A;  3J80 E;  4C0Z A;  2DKG A;  3LX7 A;  3QPH A;  4XQ3 A;  5LJ3 h;  2DD4 A;  3LGF A;  4VUB A;  5DY9 A;  4EMK C;  5LJ5 j;  3I55 A;  3MHX A;  4LDX A;  2ZPH B;  3WVE B;  4C92 B;  4M7D C;  4RCC A;  1JJ2 S;  3QG1 A;  1VUB A;  3O8V A;  3MO8 A;  3KUF A;  3QZ5 B;  1X75 C;  4C92 D;  4GY5 A;  4R55 A;  1KG1 A;  5IN1 A;  1D3B B;  3CCE T;  2DTH A;  1X01 A;  3A8M B;  2EWN A;  2PU9 B;  4M75 C;  4C0D B;  2DVE A;  3CBP A;  3M58 A;  4LDV A;  4PJO F;  5GAN 6;  5GAM h;  2XK0 A;  4KT0 E;  1QVG S;  3OYM A;  4IUQ A;  3VYG A;  4MZM A;  3PIP A;  1FXX A;  1HK9 A;  1N9S A;  3JB9 G;  2GQV A;  2K3Y A;  4B9W A;  2E64 A;  2XI9 A;  1U1S A;  4M7A E;  3MP6 A;  1XTD A;  2QQ9 A;  1Q81 U;  2BIV A;  3CCE A;  4F7U A;  3SFM A;  5HK0 A;  1KC8 C;  3CPW S;  2CZ6 B;  2JTF A;  3G6E A;  5CIU A;  5CKD A;  4BUG A;  1Y96 A;  3FIF A;  4N0A C;  4M77 E;  1VQ5 A;  2A3L A;  2EJG A;  2K4Y A;  2RO0 A;  1PSE A;  3P8H A;  4RCB A;  3OYE A;  4ZN1 A;  1VQN T;  2M0O A;  1WQW A;  3KXT A;  1M4Z A;  1XQH A;  4M78 E;  3SWN C;  4EDU A;  1YCY A;  1Y71 A;  3MEV A;  2MWO A;  1RI0 A;  3QHS A;  4E7K A;  3M53 A;  3SD4 A;  5HKC A;  2XIC A;  4ZGD B;  4E7I A;  1VQL T;  1H64 1;  5FU7 B;  3RKW A;  4FU6 A;  2VUB A;  3CCU T;  4C0D C;  2EQM A;  3A8G B;  3FEO A;  1VQN A;  4PLI A;  4OGC A;  2GF7 A;  3WXM B;  1G3Y A;  5KCO A;  3L2R A;  4C0G A;  4C8Q G;  3GF5 A;  3CCL A;  3SB2 A;  4J7F A;  3FDR A;  2L89 A;  4BE2 A;  2RJE A;  4A4G A;  5C0M A;  4MML A;  5GAN j;  4YTL A;  2JVV A;  3V8K A;  2B8A A;  1VQL A;  4B9X A;  1WJQ A;  4OB3 B;  4BY6 B;  3MEU A;  5GAN h;  3CCU A;  2RD1 A;  4QVC A;  5HY6 A;  4BDZ A;  2RJF A;  3OYA A;  2EIF A;  1G5V A;  5FRO A;  2VXE A;  3VYH B;  3ZFJ A;  4DOV A;  1UGS B;  3NTH A;  1K8A C;  1YJW T;  3JCM V;  3CCV T;  4J6X A;  2MI6 A;  4M7D F;  3OYK A;  2PQW A;  5GAO r;  1K9M C;  3OYY A;  2ZPE B;  3JCM X;  1KD1 C;  1M1K U;  5EG2 A;  3GNF B;  2LCL A;  2X4X A;  4F7U E;  3CBM A;  3TEE A;  2V8I A;  3LH0 A;  3FLG A;  3LLR A;  5FU7 C;  5LJ3 f;  1LJO A;  2XDB A;  3MET A;  4M78 C;  3C12 A;  2CS7 A;  4M75 G;  1VQK T;  2E10 A;  4E7J A;  1YJW A;  5CO7 A;  2P0Q A;  3JRZ A;  3F70 A;  4QQ6 A;  1W2B S;  2LQK A;  4LDW A;  3URG A;  3MEA A;  1LNX A;  4MDW A;  2LDM A;  1WQ7 A;  4L6V 5;  1B34 B;  2LX9 A;  4XTW A;  4BY6 C;  4D6W A;  2D6F A;  1QVP A;  2EJ9 A;  5GAM f;  4JDS A;  4R56 A;  3A8H B;  5C6S A;  1VQK A;  2ZPB B;  2OTL T;  2CZ0 B;  3RKY A;  1KQS A;  5FRN A;  3LGL A;  3V7S A;  2DTI A;  4C92 F;  3JCM d;  2A7Y A;  1BI3 A;  3JCM P;  2XG8 D;  3CC4 A;  5FRM A;  2VGN A;  3PMI A;  2P0K A;  4BI8 B;  4IUR A;  4MZP A;  3CCJ A;  4O5V A;  1N27 A;  4HT9 A;  4BDY A;  2FHD A;  2OTL A;  4V2S A;  1NPP A;  3QUI A;  4ZTJ A;  2LT4 A;  5KCH A;  3L2Z A;  3S6W A;  3QJ6 A;  3UPU A;  3ZBD A;  1LOJ A;  4TVR A;  3TRE A;  2CZ7 B;  3R6O A;  2ZPI B;  1MGQ A;  1W4S A;  1UGR B;  2DJZ A;  2RJD A;  3RMQ A;  3QXE B;  3OYB A;  2ZCF B;  3QDR B;  5D6X A;  1N8R U;  4M75 B;  3E9F A;  3JCM e;  4C8Q C;  2DZC A;  3BW1 A;  5GMK e;  1M8V A;  4M75 D;  3J81 E;  5KE2 A;  3RER A;  3LYI A;  4JRK A;  2DXC A;  2RK1 A;  3CXC S;  3HHT B;  4M7A G;  4P5N A;  5LJ5 g;  2IVW A;  3OA6 A;  3JCM J;  4MZT A;  2XU8 A;  4XTV A;  2R5A A;  3HP9 A;  2LQ8 A;  4X9C A;  4BI4 A;  3GPL A;  5A2Q E;  5LJ3 j;  1YJ9 T;  5GAN f;  5GMK h;  5I2S A;  4M77 G;  2DAQ A;  4J8O A;  1G3W A;  3QO3 A;  3A8L B;  2HQX A;  1I4K 1;  3CME T;  4KUD K;  4M78 G;  4JS4 A;  4XTZ A;  1Q82 U;  3E1S A;  3SWN B;  1RL2 A;  3VUB A;  4QVD A;  4J83 A;  3OB9 A;  2QXF A;  3V8L A;  3G4S T;  2IG0 A;  3L2W A;  1WGS A;  2GCX A;  2MWP A;  2PUK B;  3HRS A;  3NTK A;  5GAM j;  3EAE A;  3JCM b;  4KUL A;  1VIF A;  2E65 A;  5CK9 A;  5LL6 S;  1QP2 A;  5FLX E;  1QP3 A;  3NFC A;  2QQS A;  2L5Q A;  4C5I A;  4C92 E;  3VKI A;  3OYF A;  1OYX A;  3CBO A;  4OVA A;  4QVZ A;  4OB0 B;  5LJ5 e;  2EQJ A;  3L2Q A;  4ZTF A;  1VIE A;  2KY9 A;  3C94 A;  1K73 C;  1YJN T;  4II1 A;  3G4S A;  3OBY A;  5L8R E;  1PSF A;  4QQG A;  5DLO A;  3CCS T;  4PJO A;  4RG8 A;  4JRQ A;  2VV5 A;  4J6W A;  3OYJ A;  5GAN 3;  3M5A A;  2F69 A;  4C5G A;  4BD3 A;  4XU0 A;  1KQ1 A;  3CCQ T;  2QQA A;  2MAM A;  2OAU A;  2E41 A;  3QYH B;  2DIQ A;  2EYQ A;  4JRI A;  1FX7 A;  3L1A A;  3CC7 T;  4FIB A;  5GMK m;  4F7U G;  3CCS A;  4GLK A;  2DXT A;  2EFI A;  3P8D A;  1VQ9 T;  2AHJ B;  1BI1 A;  2PVG B;  3HPW A;  1KQ2 A;  1MHN A;  2E6N A;  3AHU A;  1NPR A;  4FL6 A;  5J39 A;  1KC8 U;  3DLM A;  3VJP A;  4M78 B;  2XHC A;  3OYN A;  3FC3 A;  3CCQ A;  5CKF A;  2XDP A;  2QQR A;  4M78 D;  3RES A;  1BYM A;  3FB9 A;  3CC7 A;  4J5Y A;  2EJF A;  4WF2 A;  1XNI A;  2D9T A;  2LTO A;  3CPF A;  3FRN A;  2K5I A;  1VQ9 A;  4QW2 A;  5CCA A;  4KBM B;  1HXD A;  4FT2 A;  1Q7Y C;  3ASK A;  2EKO A;  1YIJ T;  1IZ6 A;  3HRU A;  5GAO m;  3PFS A;  2LC4 A;  3PMT A;  4LDU A;  4Q5W A;  3OSV A;  4M7A C;  3HFN A;  2YRV A;  4O6J A;  2QQB A;  3OS5 A;  4NL2 A;  3JB9 D;  3LW5 E;  3MP1 A;  2GFU A;  3RUX A;  1I8F A;  2MF2 A;  5I2M A;  3QBY A;  5AYF A;  4M77 C;  3JCM f;  2K3X A;  2CKK A;  2DO3 A;  2K2V A;  2X4J A;  1YIJ A;  5CKE A;  3MCA B;  1M1K C;  4PJO E;  3GIB A;  4M75 F;  4EMK A;  1O75 A;  1M9S A;  2KVQ G;  4M7D A;  1WJS A;  3JCM W;  3CCV A;  4F7U B;  3CMA T;  2LNV A;  2DXB A;  1K8A U;  2CZ1 B;  1M5Q 1;  1Y96 B;  2XD0 A;  1BIB A;  1BKB A;  2QEX T;  3Q1J A;  1K9M U;  2VYT A;  2Y4X A;  1KD1 U;  5D6Y A;  4XU1 A;  2DD5 A;  4C8Q B;  3M4Y A;  1NZ9 A;  2M9U A;  2VXF A;  4A4E A;  2WAC A;  4C8Q D;  3CMA A;  2E6Z A;  3BDU A;  3HRT A;  2E1H A;  4RMO A;  1Q86 C;  3QSU A;  3RKX A;  4XTX A;  3OW2 A;  2KQW A;  2P4T A;  4BI3 A;  5M9O A;  3S3N A;  2QTX A;  3JCM Q;  2YHT A;  3GNG A;  2QEX A;  2RI3 A;  4N0A A;  2Y90 A;  4QQD A;  4RKU E;  5CQY A;  3V7C A;  4ZGE B;  2E12 A;  2HNI A;  1VQ7 T;  3A5Z B;  2HBP A;  2L3R A;  3G71 A;  1P92 A;  1M90 C;  4IUP A;  2JN0 A;  4C92 A;  2FB7 A;  3S3M A;  1YBY A;  4XK8 E;  4LDY A;  2DEQ A;  2ZGW A;  3KBG A;  4PJO C;  5CVI A;  4C5H A;  3JAM E;  1UB4 A;  4DA4 A;  1D3B A;  4BB7 A;  3C4S A;  5CR2 A;  3TU4 K;  4PL6 A;  1VQ7 A;  2EAY A;  4C5E A;  4Z02 A;  4UC4 A;  2RA2 A;  3CC2 T;  4EMH A;  5LJ3 g;  3SDZ A;  1NJI C;  2F5T X;  2RHX A;  4C92 G;  5GAN 8;  4JS5 A;  4BE0 A;  2KAF A;  4M7D E;  2X4Y A;  4ME7 A;  3EFR A;  5CKH A;  2QA4 T;  3UT1 A;  1KQS S;  1I5L A;  1U1T A;  2HAX A;  3WVD B;  1QVF A;  2P0P A;  1JB0 E;  3MP8 A;  2QI2 A;  5GMK j;  1VQ8 T;  2WSF E;  2CGH A;  4HCC A;  2K5L A;  2X35 A;  3JCM h;  2JNG A;  1ZQ1 A;  3EFS A;  3CC2 A;  1AHJ B;  4L59 A;  5LJ5 d;  3INZ A;  5CKB A;  5GMK i;  1WJR A;  3OS1 A;  3X20 B;  5GAM g;  4X34 A;  2C06 A;  1JJ2 A;  2QDY B;  2EQU A;  2FYK A;  4Y28 E;  1V29 B;  4M78 F;  4OB2 B;  2FL7 A;  4NOY A;  3OYC A;  4X9D A;  4MDX A;  1JRI A;  1VQM T;  1VQ8 A;  1FWZ A;  4CI0 C;  2RI5 A;  1N6A A;  2Y4Y A;  5FU6 B;  1YJ9 A;  4ELZ C;  1QVG A;  2KSS A;  5D6W A;  4JLG A;  5LJ3 e;  2K5F A;  3M57 A;  3UDC A;  4ZN3 A;  3CCM T;  4IUT A;  2RI2 A;  2ZPF B;  3M9Q A;  4E7L A;  2PVD B;  2RHZ A;  3CME A;  4N4H A;  5A0G A;  3JB9 F;  1SSF A;  3JSC A;  3CPW A;  4C0F A;  3J7A F;  1ZHI A;  4EPC A;  4JJN K;  1M1F A;  3JB9 I;  3OMC A;  4HCZ A;  4OF1 A;  4NS5 A;  3G71 T;  1WNL A;  2DZ9 A;  5GAM e;  4XTU A;  2F5K A;  4PLL A;  3CCM A;  1Q81 C;  1UGP B;  3A8O B;  4Y91 A;  3L2V A;  2LVM A;  2WSC E;  5LJ5 h;  4NL3 A;  3OYD A;  2RHI A;  1UEB A;  1UGQ B;  2HD0 A;  4M7A B;  4E47 A;  2RHY A;  5HK3 A;  3JB9 J;  3HSB A;  4DQ2 A;  1JBM A;  2D0Q B;  2I2L A;  2RK2 A;  2R58 A;  3CD6 T;  1H3Z A;  4M7A D;  3ER0 A;  1YJN A;  3JB9 H;  2E5Q A;  3BDL A;  3G6E T;  4F7U F;  3OQ5 A;  3QZ9 B;  1BIA A;  1VQ5 T;  4M77 B;  2LCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...