2DIGA

Solusion structure of the todor domain of human lamin-b receptor
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
68
Chain Sequence
GSSGSSGMPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solusion structure of the Todor domain of human Lamin-B receptor
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Lamin-B receptor
total genus 3
structure length 68
sequence length 68
ec nomenclature ec 1.3.1.70: Delta(14)-sterol reductase.
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09465 LBR_tudor Lamin-B receptor of TUDOR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2digA00
4BACA 2RHZA 4OVAA 3OYLA 2HQEA 4C5IA 5IN1A 2JTFA 2FHDA 4E7HA 4EDUA 2R58A 2RHUA 5C0MA 3OQ5A 4QQDA 4QQGA 2M16A 2XDPA 3OA6A 3P8DA 2E6NA 4N4GA 2L3RA 2QQRA 3S6WA 4CRIA 4BE1A 3NTHA 1OZ3A 2RHIA 2DIGA 2RI2A 3EAEA 3L42A 5FRMA 3NTIA 2LDMA 2RJDA 3C4SA 3H6ZA 4IUVA 2D9TA 2L8DA 3CEYA 3OMGA 2RJEA 3QBYA 2CKKA 2EFIA 2K3YA 4C5GA 3OYJA 1MHNA 1WJRA 2YRVA 3UWNA 3S3OA 4ZTJA 2QQSA 3DB4A 3OYBA 2HQXA 3LGFA 5J26A 4UC4A 1XNIA 2RI3A 2GF7A 3L2VA 3DB3A 3MP6A 4IUTA 2L89A 2EQKA 3O8VA 2EQJA 2X35A 3Q1JA 2R5AA 3MO8A 4N4HA 4A4GA 4N4IA 3F70A 3PMIA 5J39A 4ZTFA 1G5VA 2BUDA 3P8HA 2G3RA 2GFAA 2JZ2A 4PLLA 4QVZA 2RHYA 4QW2A 3OYKA 3L2WA 2EQMA 4BD3A 4A4FA 2M0OA 3UT1A 4BDZA 1SSFA 3OYGA 2O4XB 4GY5A 2RO0A 3LYIA 2NLUA 2X4WA 3MEWA 3OB9A 5C6SA 4A4HA 3OYFA 3L2QA 1OZ2A 3LLRA 4Z02A 3OS0A 4NS5A 5CIUA 4C5EA 3S3MA 3FDRA 4IUUA 2M1HA 4IURA 4E7KA 3S3NA 2LCCA 3FLGA 4RG2A 1N27A 2E5QA 4PLIA 3L2UA 3LX7A 3E9GA 3MP1A 3OMCA 3NTKA 5FRNA 3E9FA 4BE2A 1WJQA 2LRQA 2X4XA 1OI1A 4IKFA 4Q5WA 2PQWA 2K3XA 2DAQA 4IUPA 4BDYA 2WACA 3DLMA 3OYHA 3L2RA 3PMTA 5FROA 3OYMA 2R5MA 3META 3PNWC 1KHCA 4II1A 4E7JA 2B8AA 4L59A 3BDLA 4B9WA 3OY9A 3QJ6A 4FL6A 2EQUA 2BIVA 4E7LA 4FU6A 3MP8A 2X4YA 3QKJA 2EKOA 3LGLA 1WGSA 3OYEA 2P0KA 3QIIA 5KE2A 4IUQA 2O4XA 5IAYA 3MEVA 2RJFA 5KE3A 5M9OA 2RI5A 2BKDN 4QQ6A 5D6YA 5KCOA 3OYAA 4E7IA 4HCZA 3ZEHA 3KUFA 3MEAA 2R57A 4PL6A 1RI0A 5D6XA 4BE0A 5KCHA 3LH0A 3ASKA 2GFUA 2MWPA 5D6WA 5KH6A 1H3ZA 2RHXA 3OYCA 3OS2A 4A4EA 3FEOA 2RJCA 3OS1A 2XK0A 3SD4A 4C5HA 3OYDA 1WJSA 3H8ZA 2F5KA 1OYXA 2DIQA 2LTOA 3PFSA 3FC3A 2IG0A 3ME9A 4LD6A 3M9QA 3OYNA 4B9XA 2LVMA 3GOXA 2MWOA 3OYIA 4X34A 3MEUA 2VYTA
chains in the Genus database with same CATH superfamily
3OS5A 2ENMA 2P0PA 1EZZB 1B7TA 3CC2Q 4EDUA 1IGUA 3E1SA 4QQGA 4BY6B 1K9MC 3A8OB 4N4GA 1WLPB 3V8KA 3CBOA 3CMAQ 2KSSA 1GCQC 3UWNA 3CMET 1YJ9T 3FJPA 1VQ9Q 2A28A 4XTZA 3V7RA 4LDVA 3G6ET 2X35A 1M3BA 1WNLA 2KEAA 4LDWA 1PCXA 7AT1B 5I21A 2DL7A 4OMPA 4PLLA 4RTZA 2LQNA 2V1RA 4C8QB 4L5GA 1BYMA 4DBFA 1FYNA 2NUPB 4A4HA 2DEQA 1G3TA 4M78E 2J6OA 2KI7A 2KRNA 3GPLA 2EGCA 1NPPA 2MCNA 3LWHA 1D0XA 3QDRB 3CCLQ 2QTXA 4Q5WA 1ZLMA 2XI9A 3HP9A 4ZN1A 5GMKi 3M56A 3OYHA 1SHFA 1TTHB 2CT3A 3UA7A 2P4RA 3OY9A 2K4YA 3C94A 2VVKA 2WSFE 1TUGB 3CMAT 3GIBA 1NLOC 1JO8A 5I11A 4M7AA 1TXQA 1WHHA 1KC8C 4M7DE 3HRTA 1M1KU 1M1KR 4C0DB 1YHQT 1PNJA 1A0NB 2RJCA 3TEEA 3OS1A 4KGXB 4PJJA 2ED0A 5LJ5e 3TU4K 2V8IA 3M5AA 2NWMA 3WXMB 2LVMA 3V7SA 3G7ZA 1K76A 2PNIA 1YI2Q 4FYVB 4LN2A 5DM7R 3VJPA 1YIJT 1UGSB 3QZ9B 2JJ9A 2X3WD 3M53A 1XQHA 2XDPA 4PJOD 3OA6A 1HYOA 1OZ3A 3JCMV 5HKCA 1VQOA 2E41A 3BE3A 1ZBJA 1QWEA 3QYGB 1Q82U 2OTLQ 3S3OA 2K7AA 4M77C 1B07A 3PT9A 2LCSA 3O5ZA 3CCST 1D09B 1HK9A 3TCJA 2XHCA 1N6AA 2A0FB 4J9FA 1UEBA 2JW4A 4BD3A 1QVFP 2RB6A 4FW1A 2ECZA 3I56Q 1ZHIA 4EPCA 1KD1U 3CCMA 4GY5A 3CBMA 4NOYA 1V76A 1VQ6A 3LWIA 1I07A 3CCVA 1Z9ZA 1NG2A 2DD5A 4DBQA 2DJZA 4AMCA 1WJQA 4JRKA 1MMDA 2A7YA 2DAQA 2QYZA 2LT1A 1K8AC 3L2RA 3PMTA 4FW2A 5GAN7 1G8XA 2HSEB 2AZSA 4AFQC 3MP8A 3LGLA 3JB9J 3QIIA 1D0ZA 5IAYA 5KYUA 1RAHB 4BI8B 2GTJA 2ZPHB 3JB9I 4RUGA 3RMQA 1QLYA 4M77E 1J3TA 2E64A 3ZBDA 4Z89A 1WHJA 1X6BA 1WYXA 2AZVA 2OTJQ 1WHMA 4RCBA 2HSPA 3EG0A 3UATA 4C92B 1VQ5T 3QUIA 4A4KA 3CXCS 4KRTA 4M78F 1U8RA 5I2SA 2VYTA 4KULA 2RHZA 1OU9A 1D1AA 1PD1A 2DETA 2PZ1A 2F2XA 1MNDA 1X2KA 2F2WA 1D1CA 3HFOA 3VYGA 5GAN2 3NTIA 2RJDA 3UDCA 5FU6C 2EFIA 1SHGA 2E10A 1QCNA 1QCFA 2K5IA 4A4GA 2EQIA 1JXMA 2E4HA 2YXYA 5IT9E 9ATCB 2G3RA 2E65A 3PVLA 1T3LA 2DO3A 2M0OA 4C92E 2L5QA 1KC8U 1BI1A 1KD1R 5FW9A 1HJDA 1MUZA 2CSQA 1VQLQ 3BFMA 1OZ2A 4VUBA 3JRZA 1X69A 4KH0B 4RG2A 3GNFB 2BE7D 5KYWA 2BZYA 2JNGA 1O9SA 2A08A 4XTVA 2J6FA 1ABOA 1FWZA 2CP0A 4OMOA 3I5RA 4M78C 2MYSA 3DLMA 4JPBW 5GAN6 2O01E 2B8AA 1JBMA 3BDLA 2KY9A 4DBHA 4J5YA 2YSQA 2XG8D 5KE2A 4DA4A 2ZZDA 2B86A 4BUGA 5KE3A 2MF2A 4J9BA 3PIPA 4AG2C 1YJWQ 2H8HA 5HK0A 2GBQA 2OJ2A 1WQ7A 1QVPA 1SEMA 2GQVA 2P84A 4M75C 4ESRA 3D7SB 2D8HA 4EIKA 4F7UG 1OYXA 2LTOA 1Y07A 2H3EB 3VUZA 4LXCA 2IG0A 3EG2A 3EGXB 3M9QA 3RBBB 4B9XA 4ZGJB 2RQWA 3CCVQ 2JXBA 2MWOA 1NZ9A 3CPFA 2VB6A 3VS5A 1PRMC 5GAMf 1TSFA 3M55A 3G6EQ 4E7HA 2R58A 1GFDA 2C0OA 5KYNA 2M16A 1ZSZA 2RQUA 2EVRA 1R77A 1SSHA 4JJBA 2LDMA 2HBPA 1WXUA 1VQ6T 1T0HA 4ZTJA 1WJRA 2YRVA 2DMOA 2XICA 2KT1A 3MP6A 2IPOB 1BI3A 2VV5A 2YUQA 4D6WA 4R56A 3H41A 2E12A 1GRIA 1M8VA 2K3BA 2E5KA 1AWWA 4M77F 5CCAA 1G3YA 1W2BA 3QXEB 4M77G 1ARKA 4MDWA 2KXCA 4IUUA 3S3NA 1VQ8A 1P92A 5D7UA 1M3CA 3OMCA 1S72A 3CQTA 4M77A 4IKFA 1RI9A 1KK7A 1K0XA 2DTIA 1M1KC 5GAOq 3JCMg 2OX7A 3OBYA 5KYYA 3MKDA 1VQOQ 3A8LB 5KYWB 3CD6Q 4J9GA 3QHSA 8AT1B 2AT1B 4PJNA 2QG9B 4FT2A 3EGDA 3OYYA 2ZAEA 5CK9A 1Q7YR 3OSSC 5EG2A 3I55Q 1AWOA 2L0AA 5GANg 2DKGA 4OP0A 2KRMA 2CREA 5GAOm 3MJXA 3CCUQ 5FWBA 4F7UF 1NPRA 1QVGS 1M90C 4LD6A 4HA8A 1IRXA 5GANd 3U23A 4OMFB 2K5FA 3NHNA 4E47A 3CCQQ 4ANJA 1QVGA 2HKQB 1X6GA 1K4US 2DL3A 2V8KA 3I35A 4X9DA 2E1HA 1TG0A 2DBKA 5HK3A 2RK1A 2KXDA 1FXXA 2FYKA 2QQRA 4CRIA 1BBZA 4QVCA 4F7UA 1N9RA 1UJ0A 1D0YA 1NBEB 1MMGA 4N0AC 3CCUT 1YN8A 1U06A 3GP8A 4CI0C 1WI7A 2ZCFB 5LJ5g 1VQMA 1I1JA 3H9NA 1KIKA 2OTJA 4C92A 3VS1A 1N9SA 3F70A 2V8JA 2BZ8A 2M51A 3JB9G 3SEMA 1KSWA 2M0YA 3OW2A 3V8JA 1GCQA 5GANe 3TVTA 1YCSB 2O4XB 2RO0A 3GNGA 2NLUA 3GBQA 2P4TA 3MCAB 4NS5A 2HDAA 3REBB 3INZA 1PRLC 4Y28E 2JTMA 2YUPA 3QWYA 3LX7A 4WCIA 5IXFA 5FRNA 4N0AA 1N5ZA 2PQWA 2CP6A 1WZOA 2Z0WA 3ZFJA 1IREB 1QKWA 4II1A 3A8HB 4PFZA 1N8RC 1Q7YC 2BIVA 4A63B 3VS0A 5FU6B 5CQYA 5KYYB 2K57A 1YHQA 2L3QA 3TREA 2D0NA 3N5BB 4J7FA 1M1GA 5KCOA 2KBTA 2QGGA 5L23A 8ATCB 2LQWA 1Y96B 2RHXA 3L1AA 1VQNT 3BY7A 3JB9D 3J7AF 4HKEA 3H8ZA 3VRYA 4C0GA 2HMAA 5GAOl 4C92C 4M7AC 2DF6A 3CPWA 3KBGA 2FZKB 1S72Q 2FRWA 2F2VA 3NPFA 5GANf 2XDBA 3JCMc 1NLPC 1UHCA 4LDXA 3OQ5A 2HAXA 3M0SA 4BE1A 1VQNA 2KGTA 4AFZC 3RNJA 2DIGA 2K2VA 1Q82C 4IUVA 2D9TA 2L8DA 2LQ8A 2QA4T 4PK4A 4Y91A 2RI3A 2NUTA 3M0QA 2VGNA 5AT1B 3I55A 2KK4A 4JRQA 1PKTA 3EGUA 3QPHA 1S72T 1OULA 1LOJA 2FZCB 5GMKl 4EMHA 2GFAA 4QVZA 3M57A 1CKAA 3G6EA 2LP5A 3FB9A 4FIBA 5C6SA 3OYFA 3CCQA 1QKXA 4M75E 3G1JA 2XIDA 1FMVA 1UFFA 1X43A 1VQ7A 1W1FA 2W10A 2PTKA 1LNXA 2E3IA 2LRQA 1OI1A 2CGHA 4P5NA 2OAUA 4OB3B 4D8KA 5IHKA 5I2MA 3PNWC 1KHCA 4E7JA 4RTVA 2FG0A 1VQMQ 1LCKA 2DYBA 2EAYA 4IIOA 5D6YA 3OYAA 2XKOC 4OMMA 2KRSA 3JCMe 1YITT 1OEBA 2DZCA 1YNZA 1AZEA 4HCCA 2F1LA 3OYDA 4C5HA 1YP5A 4OF1A 1HSQA 5FLXE 3OW2S 1UGRB 1VQKQ 3GOXA 1K73R 3OYIA 3WVDB 2DYIA 1Y96A 4F7UE 2QDLA 2KQWA 4AFSC 2RHUA 3JV3A 2AHJB 4XTUA 4A54A 2LMJA 3S6WA 2GCXA 1TUDA 2KYMA 1H8KA 1VQ4T 4LDYA 2RNAA 2RJEA 1VQ4Q 1MHNA 4XTXA 1T0JA 3X20B 4J83A 4UC4A 3SDZA 1BI2A 3M0TA 4QVDA 2EQKA 3CCRT 1AOJA 3THKA 2IVWA 2DA9A 1HD3A 2ZPFB 2RQTA 1G5VA 3FRNA 1WXBA 1VQ9T 2YT6A 1PC0A 1SSFA 5GANj 3CCVT 2ZGWA 1RACB 1QP3A 3MEWA 4RTUA 1Q81U 2GTOA 1YJNT 1NJIU 2H3JA 2HD0A 5CIUA 3JCMf 1SKUB 2CYZB 1GFCA 4IURA 2E5QA 2HEQA 5A2QE 3L2UA 1MMAA 3LH5A 4M75B 2EYWA 2KNBB 1QQJA 2WACA 1HXDA 1VQ9A 4FCYA 5A0GA 2O2OA 1VYVA 1E6HA 3X28B 4EMKC 3RUXA 2EQUA 3SWNB 4LDUA 4OB0B 1G83A 1NJIC 1YJ9A 1GBRA 1RAFB 3A1PA 3EFOB 2EGAA 4V2SA 3EH2A 3C95A 5KH6A 4A53A 1M3AA 4JLIA 5KYXB 3OBWA 3SD4A 4ME7A 5IXBA 3EHQA 2YUNA 3SFMA 1S1NA 4J8OA 4M75F 4J6WA 1YWOA 2DRMA 1EIFA 3QO3A 3SWNA 1RL2A 4E6RA 4ZGDB 1K9MR 4C92G 2CZ1B 2JS0A 2FHDA 2VXFA 4ORZA 1YI2T 1QWFA 1PSFA 2A36A 1M2VB 1EX4A 3RERA 2OTJT 5CQXA 4RTYA 3G4ST 1V1CA 1W70A 3PE0A 3JCMd 3C4SA 1OX9A 2K3YA 1KC8R 2MI6A 1YFNA 4AT1B 3JSCA 4O5VA 2LJ3A 4M77D 2HBWA 2EYQA 5HCKA 2BUDA 1C6VX 3HSBA 4M75A 3HTRA 2X4JA 1YI2A 4BDZA 2WSCE 2AK5A 2GNCA 1K8AU 1VQOT 5FU7B 2CS7A 1VQ7T 2K5LA 1DJ7B 1JB0E 3CC7A 2DERA 2YLCA 2DVJA 3FLGA 2JVVA 1K0SA 3CC2A 4AFUC 4R0KA 5GMKm 3H0FA 1O75A 2ZPGB 3A98A 1WIEA 2K3XA 3CMEQ 4F14A 3QZ5B 4KGZB 1MV0B 1JJ2A 2LX7A 2P0KA 4BB7A 2O4XA 2FO0A 2QGFB 5M9OA 4RTTA 4HCZA 4QT7A 3CC2T 3DKMA 3C12A 3OYCA 5GAMj 3VYHB 2DNUA 2V26A 2E70A 4M4ZA 3QWXX 4JZ4A 1ZQ1A 2L2PA 3JCMJ 3HRUA 2VKNA 5KYUB 1VYUA 2EW3A 3OYNA 1M9SA 1Z9QA 4M7DG 3G71Q 2ZPIB 4KGVB 2RMOA 3CCLA 1AD5A 1Y7XA 1GXIE 2HQEA 2JTFA 5C0MA 1KJWA 3QG1A 3URGA 1VA7A 2DLPA 1XTDA 2E6NA 2XMFA 3HHTB 4M77B 3L42A 3ER0A 3CEYA 1YHQQ 2L3SA 1UG1A 3OYBA 2DXTA 1VIEA 3A8GB 2IIMA 3CCEA 4LD9K 1OQKA 2R5AA 3RR6A 3CD6T 4PJLA 2RHYA 3X24B 3L2WA 2CSIA 2LNHB 1UGVA 4BI3A 2LJ0A 4RCCA 2BTTA 1AHJB 4J7IA 3JB9F 3CCJQ 1UE9A 3VUBA 2X9HA 1G2BA 4KH1B 1GBQA 3RKWA 2JUFA 3HKSA 3HPWA 1VUBA 4C0DC 4F04B 1JXOA 4PJOC 3CXCP 3H0HA 1D3BA 4HCBA 3BDUA 3OYMA 1WDXA 2R5MA 1WHGA 3G4SA 3J81E 4M7DC 1QVFA 3CPWP 1OPKA 4KBMB 1K8AR 4JUVA 2K6DA 2D0QB 5IH2A 4IUQA 4DOWA 3MEVA 5DLQE 1X6OA 5GAMd 4JLGA 4E2FB 5GMKh 5IHIA 2KVQG 5KCHA 5GAN5 2RQRA 1H3ZA 4M7AE 3OS2A 2EIFA 4RG8A 3REAB 1WXTA 2KE9A 4M7DA 2CH4A 1UJYA 2O31A 3P8BB 4M75D 2DTOA 1M2VA 2SEMA 3A5ZB 1N8RR 2LQKA 2SRCA 4EMKB 5AYFA 2K2MA 3EG1A 1B3QA 4FM4B 2Y4XA 4FYYB 3RESA 2JM9A 2JMAA 3QDFA 2RD1A 1EFNA 2J7IA 1YJ9Q 1SRMA 1VQMT 5GAOp 4FYWB 2VWFA 1NEGA 3TSWA 2QQAA 1I4K1 2QAZA 1M90U 4MZTA 2A37A 1GL5A 3LGFA 2GF7A 5A0LA 3DB3A 4J9IA 4IUTA 3J80E 3Q1JA 2KAFA 2EJ9A 4QKUA 1IB8A 4KT0E 3EFOA 1JEGA 4A4FA 1PM3A 4WTOB 2F69A 2KR3A 2X4WA 3OB9A 1JQQA 4PFPA 3G71A 1BIBA 5GAN4 4C8QG 1VQPA 2EYYA 1NEBA 2OI3A 2QK0A 1M30A 3RKYA 3VU3C 4WF2A 5GAMg 3MP1A 4F16A 4BE2A 5LJ5h 3CCQT 4OGCA 1JU5C 5GAOn 1JJ2P 4PJOG 2NYSA 1IZ6A 3CCJT 4HVWA 2JN0A 1M27C 1Q81R 3QKJA 2X4YA 3I5SA 2HL5C 2ABLA 1Y71A 3CCLT 3ZL7C 3FJ5A 4XQ3A 4XU2A 3EGXA 3JAME 3T9NA 2R57A 3C0CA 1RI0A 2EBPA 1H641 2RQVA 5D6WA 1ZUYA 4GLMA 4MMKA 5GAMe 1PG5B 2DPPB 3M4GA 3EFSA 3FC3A 3TQ7P 3CCMQ 4PNOA 3JCMX 1YCYA 1X2QA 4C5IA 5IN1A 4OB2B 4EMGA 1QCOA 3CD6A 2QQ9A 1E6GA 3PGGA 3M0PA 2L3RA 1UB4A 4Z88A 1MMNA 3EAEA 3VKIA 5HY6A 2DTHA 3CBPA 4DEXA 2W0ZA 3DB4A 3EG9A 1QMCA 1W2BP 3CCUA 2EQJA 3JCMP 4N4IA 4QW2A 4Y92A 3CCRA 4M7DD 5CKFA 1ZX6A 5LJ3j 2JMCA 3JCMb 3L2QA 1KQ2A 3LLRA 1PKSA 5CVIA 4ZN3A 4HT9A 3S3MA 1U5SA 3UPUA 1RUWA 4X1VA 1TWBA 1U1TA 5LL6S 3M4YA 1R0CB 2QEXT 1BU1A 1BB9A 2FL7A 2DX1A 4JS4A 1ZBXA 2ATCB 3M59A 4CC2A 1KHIA 4M7AB 4E7LA 5FU7C 4AG1C 3OYEA 4DOVA 5LJ3d 2FEIA 2KROA 3CCSQ 4XU1A 4E7IA 1AEYA 3A8MB 2CUDA 4M78G 1M4ZA 4X9CA 1YIJA 3CCEQ 2C06A 2EWNA 2DXBA 4PJMA 3UF4A 2HZYA 3L2ZA 5LJ5j 1WJSA 1D3BB 2PUOB 1RADB 1YITA 2PU9B 2BE9B 2DZ9A 4BI4A 1KD1C 1VQ8T 2LT4A 2JS2A 2DXUA 2DXCA 4C8QE 2CP7A 1T3SA 4KUDK 4PJOE 1KQSA 2J05A 2EJFA 2FPEA 1XOVA 3NTHA 1UDLA 3CCMT 1R0BG 2RHIA 5GAN8 2RI2A 3GF5A 3MHXA 5FRMA 2VC8A 2CZ0B 1LPLA 4J6YA 2D6FA 2EKHA 4MMLA 4JZ3A 3OMGA 1WHKA 3G4SQ 1I5LA 3JB9H 1H3HA 2EYXA 2ROTA 5J26A 2QQBA 1JJ2S 4OGEA 3L2VA 2CP2A 1IO6A 1TU0B 3AT1B 3PMIA 5CKDA 2AKKA 3G71T 1W2BS 5GAOr 2J06A 2MK5A 2YRCA 1Q81C 4CC3A 2FB7A 4JS5A 2HNIA 1Q95G 2Y4YA 1IGQA 1VQ5A 2XD0A 4C5EA 4ZGEB 1C0MA 4CC7A 2M1HA 4E7KA 2JTEA 2BZXA 2QASA 1FX7A 5L8RE 1G3WA 3I55T 3NTKA 2DFUA 3CXCA 1AWXA 2E3HA 4JJNK 2AIRB 1SG5A 4OMQA 4IUPA 1XJWB 3DLLA 1NYFA 4K11A 3QJ6A 4FL6A 1K73C 2LZ6B 1M2OA 2NUPA 4LNPA 2RJFA 4JRPA 2BKDN 2CH4W 4D8DA 3X25B 4XTYA 4M7AG 2XDDA 2MWPA 4J9HA 3CCRQ 2JT4A 4FSXA 4ATOA 3R6OA 5CO7A 4Z8AA 2RK2A 3I56T 3PFSA 1OX8A 4KUIA 2CDTA 1LVKA 1R8OB 2L3PA 3JCMQ 3CC4A 4X34A 2M9UA 1KQ1A 4C92D 1VQPQ 1X01A 2QEXQ 1UECA 2YLBA 2NUTB 3EH1A 1WPYA 1Q82R 4OMNA 3LW5E 2DRKA 1QVGP 3TSZA 1NJIR 2CUBA 3PTAA 5GAMh 2F5TX 2DL8A 4M78A 2PVDB 1Y0MA 1ZSGA 1V29B 2QQSA 2RH2A 2HQXA 3PIOA 1QVFS 1E7OA 1IHVA 1WA7A 3M0RA 2EPDA 2L89A 3EHRA 1U1SA 3QJYA 3ULRB 2EYZA 5KYXA 3M58A 3JCMW 1N8RU 3BW1A 1H92A 5CR2A 1PHTA 1SRLA 3OYKA 1WFWA 4YTLA 5IHNA 3M54A 5LJ3e 2DBMA 3LYIA 1MGQA 2I2LA 2DL5A 1WQWA 2LCCA 3QYHB 3KFVA 1NYGA 1RAIB 4MZPA 4OMLA 4LUDA 4NL3A 3E9FA 5GANh 1QW1A 2QA4Q 3SWNC 4BDYA 5J3BA 1BKBA 4OB1B 5FROA 1RAEB 3META 5LJ5f 4L59A 3H0IA 1G3SA 2KDSA 1KQSP 2DD4A 1WGSA 1FMWA 4XK8E 2RI5A 5GMKe 4QQ6A 4M7AD 2ROLA 4PJOA 4M7DF 4M7AF 1K1ZA 1PD0A 1NE8A 4HT8A 4A4EA 4J6XA 1LJOA 3HRSA 2VASA 2LC4A 3OSVA 2RM4A 3CPWS 3FIFA 1I0CA 4C8QA 2V1QA 4FSSA 1UGPB 4XTWA 2PVGB 5LJ5d 3MPUB 2DEUA 1Y57A 4PFOA 2DM1A 5LJ3f 1K9MU 5LJ3g 3E2UA 4M7DB 2ZPEB 4J9DA 4QQDA 1VQ8Q 4C8QF 4GLKA 3UA6A 4PJOF 1TS9A 3ZEHA 2RF0A 3OYJA 1PWTA 2ZPBB 1C1AA 4RKUE 1FMKA 1PSEA 2YRDA 4ELYC 4O6JA 3VS2A 3O8VA 3HL8A 1OU8A 4RTWA 3RIRA 4ZTFA 5CKEA 2JZ2A 2MIOA 2CP5A 1VQKA 2LX9A 3CC4Q 3OS0A 3E19A 2O88A 3SHWA 2VUBA 5CKBA 1YITQ 1VQNQ 1N27A 5CKHA 1ZSZC 1WX6A 5GMKj 4FT4A 3E9GA 4E7SA 5CAIA 4EMKA 4MZMA 1AZGB 1Q7YU 4CC4B 4C8QD 1VQPT 2X51A 2FPDA 1Q86C 3CMAA 3RKXA 1ACMB 1WHLA 3M0UA 1I81A 4FYXB 2WSEE 3EG3A 3EFRA 2ESWA 2YWWA 2LNVA 1VQ4A 4B9WA 1VQKT 2COWA 3IQLA 2MMPA 4RMOA 2EKOA 2DJQA 2KYBA 1YBYA 3CC7T 2JOYA 2HQHA 3QSUA 2OTLA 1UHFA 2DE0X 2FPFA 3MEAA 4ZNXA 4PL6A 5D6XA 2MPXC 1I5OB 4BE0A 5GAN3 2FRYA 1D1BA 4L6V5 4DQ2A 4ELZC 1BI0A 4R55A 2XU8A 5GJVB 3ME9A 2CZ6B 2P0QA 4B6MA 4IIMA 4J9EA 1K9AA 3MEUA 2DVEA 4BACA 4OVAA 5EC7A 2AKLA 1UGQB 5FWCA 1VIFA 2GGRA 3VS4A 2NUZA 4PKCC 1QP2A 2C0IA 1GCPA 1ABQA 4XU0A 3NGPA 1YJNA 3H6ZA 3QBYA 2CKKA 2D8JA 3I9QA 4C5GA 2ED1A 2QXFA 1BIAA 4XAXB 4RTXA 1YIJQ 1MV3A 1TH7A 4N4HA 3P8HA 4F17A 4PJOB 2DK3A 5A0DA 2D1XA 2RPNA 3UT1A 3OYGA 4BY6C 6AT1B 2M02A 3CCSA 3RMSA 3EG9B 4XU3A 3FDRA 4DEYA 4JJCA 3SB2A 1Q86R 2JM8A 2I0NA 2HKNA 2O9SA 4JRIA 1ZSZB 5LJ3h 2COYA 2E6ZA 2X4XA 4J9CA 1VYTA 2CZ7B 2MOXA 3KXTA 1KQSS 3VV0A 4GBQA 3NMZC 2EGEA 5ECAA 3R6NA 3VS3A 1YWPA 1I8FA 5DY9A 2J6KA 2PVOB 2Y90A 1B34B 3V8LA 2QI2A 3CCET 1UUEA 4NL2A 1Q86U 4C0ZA 3ASKA 2GFUA 3EGDB 2DL4A 3VS7A 3V7CA 1W6XA 1RAAB 1RAGB 1TUCA 3AHUA 1VQ5Q 1M90R 2F5KA 2OAWA 1X27A 1VQ6Q 1BK2A 4HXJA 1CSKA 2QA4A 1AVZC 2VXEA 3RDVA 1RABB 1KG1A 2VGMA 2G6FX 2MAMA 1ZUKA 1ZUUA 3I56A 2HL3A 3OYLA 1YJWT 1OV3A 4HCKA 2PUKB 2K9GA 2YDLA 1ZA2B 3X26B 1M5Q1 4HVUA 1RLPC 3P8DA 2FVUA 2RN8A 3VS6A 1B34A 1JRIA 1VQ7Q 1MNEA 1VOMA 4DBRA 1SF9A 4JDSA 1XNIA 1OOTA 5GJWB 4LE9A 4C8QC 3MO8A 3VRZA 2K79A 1TOVA 2YHTA 1UTIA 5J39A 1YJWA 1K73U 2QDYB 2O9VA 2EQMA 3OW2P 1VQLT 1M8MA 4Z02A 3NFCA 1ZA1B 2QTVA 1AT1B 2HCKA 2FZGB 4PLIA 2GQIA 4M78B 4C0FA 4C92F 2CP3A 2DILA 3PVQA 1BCMA 3GLXA 3HFNA 1YJNQ 4TVRA 4M75G 1SPKA 2A3LA 2OTLT 4JJDA 1CKBA 4MDXA 1BCOA 2RA2A 5I22A 2QEXA 4FU6A 4E7ZA 1W4SA 2KT8A 1F1BB 2X3XD 3JCMh 2CT4A 2KMTA 3KUFA 1M1FA 1NM7A 2EJGA 1KFZA 2LCLA 1RLQC 2LJ1A 3CC7Q 2YUOA 3LH0A 2COZA 1IXDA 3CC4T 3FEOA 1VQLA 2XK0A 5DLOA 3WVEB 3CCJA 2DIQA 4LUEA 4M78D 1U3OA 4F7UB 3CMEA 1IHWA 1OPLA 1X75C 2C0TA 4HVVA 1AWJA
chains in the Genus database with same CATH topology
1Y7XA 1X01A 1GXIE 3OS5A 2P0PA 2HQEA 2YLBA 2JTFA 2V8KA 4X9DA 4EDUA 1WPYA 2E1HA 5C0MA 3E1SA 3QG1A 3LW5E 4QQGA 2RK1A 3URGA 5HK3A 1FXXA 4BY6B 1XTDA 1K9MC 3A8OB 2E6NA 2FYKA 2QQRA 4N4GA 3V8KA 3CBOA 3HHTB 4CRIA 4F7UA 4QVCA 1N9RA 4M77B 3L42A 3ER0A 2KSSA 3PTAA 4N0AC 3CCUT 3CEYA 5GAMh 2F5TX 3GP8A 4M78A 2PVDB 4CI0C 3UWNA 1V29B 2QQSA 2RH2A 2ZCFB 2DXTA 2HQXA 5LJ5g 3OYBA 1VIEA 3PIOA 3CMET 1VQMA 3A8GB 1YJ9T 1QVFS 3FJPA 4XTZA 3V7RA 4LDVA 2L89A 2OTJA 4C92A 3G6ET 3CCEA 1U1SA 3QJYA 4LD9K 2X35A 2R5AA 1WNLA 3M58A 1N9SA 3F70A 2V8JA 4LDWA 3JCMW 5I21A 3BW1A 1N8RU 5CR2A 3CD6T 4PLLA 2RHYA 3X24B 3OYKA 3L2WA 3JB9G 3OW2A 4BI3A 4YTLA 4C8QB 4RCCA 4L5GA 3V8JA 3M54A 5LJ3e 1BYMA 5GANe 1AHJB 2O4XB 2RO0A 3GNGA 2NLUA 3LYIA 4A4HA 4J7IA 3JB9F 2P4TA 2DEQA 3MCAB 4NS5A 1MGQA 2I2LA 3INZA 3VUBA 1G3TA 4Y28E 4M78E 3RKWA 1WQWA 2LCCA 2JTMA 3QYHB 2JUFA 3HKSA 3GPLA 4MZPA 1NPPA 3LWHA 3HPWA 1VUBA 3LX7A 4NL3A 4C0DC 3QDRB 5FRNA 3E9FA 4N0AA 5GANh 4PJOC 2QTXA 4Q5WA 2XI9A 2PQWA 1QW1A 3HP9A 1D3BA 4ZN1A 5GMKi 4HCBA 3SWNC 4BDYA 3BDUA 3M56A 5J3BA 3OYHA 1BKBA 4OB1B 3ZFJA 5FROA 3OYMA 2R5MA 1IREB 3META 5LJ5f 4II1A 4L59A 3G4SA 3OY9A 1G3SA 2KDSA 2K4YA 3A8HB 3J81E 1N8RC 1QVFA 4M7DC 1Q7YC 2BIVA 3C94A 4KBMB 2DD4A 2WSFE 3CMAT 1WGSA 4JUVA 2D0QB 5FU6B 5CQYA 3GIBA 4IUQA 4DOWA 3MEVA 2K57A 5DLQE 1YHQA 4XK8E 1X6OA 2RI5A 3TREA 3N5BB 4QQ6A 4J7FA 5GMKe 5GAMd 1M1GA 5KCOA 4M7AA 4M7AD 4PJOA 4JLGA 1KC8C 4M7DE 3HRTA 1M1KU 5GMKh 5KCHA 2KVQG 5GAN5 4M7DF 4M7AF 1H3ZA 4C0DB 1Y96B 2RHXA 1NE8A 3L1AA 1YHQT 3OS2A 4M7AE 1VQNT 2EIFA 4RG8A 4A4EA 4J6XA 4HT8A 2RJCA 3BY7A 1LJOA 3TEEA 3OS1A 3JB9D 3J7AF 3HRSA 4M7DA 4HKEA 2LC4A 3H8ZA 5LJ5e 3P8BB 4M75D 3TU4K 2DTOA 2RM4A 3OSVA 2V8IA 4C0GA 3CPWS 3FIFA 4C8QA 3M5AA 3A5ZB 3WXMB 5GAOl 4C92C 2LVMA 3V7SA 1UGPB 3G7ZA 2LQKA 4XTWA 4M7AC 2PVGB 4EMKB 3CPWA 5AYFA 3KBGA 5LJ5d 4FM4B 2Y4XA 5LJ3f 5GANf 2XDBA 1K9MU 3JCMc 3RESA 5LJ3g 5DM7R 4M7DB 2ZPEB 3VJPA 1YIJT 4LDXA 1UGSB 3QZ9B 3OQ5A 2RD1A 4QQDA 3M53A 2HAXA 1XQHA 2XDPA 4PJOD 3OA6A 1VQMT 4BE1A 1VQNA 1OZ3A 3JCMV 4C8QF 5HKCA 5GAOp 2E41A 4GLKA 2DIGA 1VQOA 4PJOF 2K2VA 1Q82C 4IUVA 2D9TA 2L8DA 2LQ8A 3QYGB 2QQAA 3ZEHA 3OYJA 1I4K1 1Q82U 1M90U 3S3OA 2QA4T 4MZTA 2ZPBB 4M77C 3LGFA 4Y91A 3PT9A 4RKUE 1PSEA 2RI3A 2GF7A 2VGNA 5A0LA 3DB3A 4IUTA 4ELYC 3I55A 2KK4A 3J80E 4O6JA 3O8VA 3HL8A 4JRQA 3Q1JA 3CCST 3QPHA 1HK9A 2KAFA 1S72T 3RIRA 1LOJA 3TCJA 2XHCA 4ZTFA 1NJIU 5GMKl 1N6AA 2EJ9A 4EMHA 5CKEA 1UEBA 2GFAA 2JZ2A 3M57A 4KT0E 4QVZA 4BD3A 4A4FA 2RB6A 3G6EA 1VQKA 3FB9A 1ZHIA 4EPCA 1KD1U 2F69A 4FIBA 4GY5A 3CBMA 3CCMA 2X4WA 3OB9A 5C6SA 4NOYA 3OYFA 2LX9A 3G71A 1BIBA 3OS0A 3E19A 3CCQA 4M75E 1VQ6A 5GAN4 4C8QG 2VUBA 1VQPA 5CKBA 3LWIA 1N27A 2XIDA 5CKHA 3CCVA 3RKYA 3VU3C 5GMKj 4WF2A 5GAMg 4FT4A 3E9GA 2DD5A 3MP1A 1VQ7A 5CAIA 4BE2A 2DJZA 4EMKA 1LNXA 1WJQA 4MZMA 2LRQA 4JRKA 5LJ5h 3CCQT 1OI1A 1Q7YU 4C8QD 1VQPT 4OGCA 1Q86C 2CGHA 4P5NA 3CMAA 3RKXA 2A7YA 1I81A 2DAQA 2OAUA 5GAOn 2WSEE 2LT1A 4OB3B 3L2RA 1K8AC 3PMTA 3EFRA 5I2MA 4PJOG 1IZ6A 3PNWC 1KHCA 4E7JA 3CCJT 5GAN7 1VQ4A 2LNVA 4B9WA 1VQKT 2JN0A 4RMOA 2MMPA 3MP8A 2X4YA 3QKJA 2EKOA 3LGLA 3JB9J 3QIIA 1YBYA 5IAYA 2JOYA 3CC7T 1Y71A 3CCLT 3QSUA 2EAYA 2OTLA 5D6YA 4XQ3A 4XU2A 2XKOC 4BI8B 3JAME 3MEAA 3T9NA 3OYAA 2R57A 3JB9I 2ZPHB 4PL6A 1RI0A 5D6XA 3JCMe 4BE0A 1YITT 1H641 5GAN3 5D6WA 3RMQA 2DZCA 4MMKA 5GAMe 4M77E 2E64A 2DPPB 3ZBDA 4HCCA 4L6V5 3OYDA 4C5HA 3M4GA 4DQ2A 4OF1A 4ELZC 1BI0A 3EFSA 5FLXE 4R55A 2XU8A 4RCBA 3FC3A 3OW2S 1UGRB 3ME9A 4C92B 1VQ5T 2CZ6B 2P0QA 3GOXA 3QUIA 4A4KA 3OYIA 3CXCS 3WVDB 4M78F 1U8RA 3MEUA 2DVEA 5I2SA 2VYTA 4BACA 1Y96A 4PNOA 4KULA 3JCMX 2RHZA 4OVAA 1YCYA 4F7UE 1UGQB 4C5IA 5IN1A 4OB2B 1VIFA 2KQWA 4EMGA 2RHUA 3CD6A 4PKCC 1QP2A 2AHJB 2QQ9A 4XTUA 4A54A 3PGGA 3S6WA 2GCXA 2L3RA 1UB4A 3HFOA 3EAEA 1VQ4T 3VYGA 4XU0A 4LDYA 3NTIA 5GAN2 1YJNA 2RJDA 3VKIA 5HY6A 3UDCA 2DTHA 3H6ZA 3QBYA 5FU6C 2RJEA 2CKKA 2EFIA 3CBPA 4C5GA 1MHNA 2QXFA 4XTXA 3DB4A 3X20B 1BIAA 4XAXB 4J83A 4UC4A 3SDZA 1BI2A 2E10A 4QVDA 2EQKA 3CCRT 3CCUA 2EQJA 2IVWA 1TH7A 2K5IA 4A4GA 4N4HA 2ZPFB 3JCMP 4N4IA 5IT9E 1G5VA 3P8HA 2G3RA 2E65A 3FRNA 4QW2A 1VQ9T 4PJOB 2DK3A 2DO3A 4C92E 2M0OA 5A0DA 2L5QA 1KC8U 3UT1A 3CCRA 1BI1A 1SSFA 3OYGA 4BY6C 5CKFA 3CCVT 5GANj 5LJ3j 2ZGWA 4M7DD 3CCSA 3RMSA 1QP3A 3MEWA 1Q81U 3JCMb 3L2QA 3BFMA 1YJNT 1OZ2A 3LLRA 2H3JA 4XU3A 5CVIA 2HD0A 4VUBA 5CIUA 4ZN3A 4HT9A 3JCMf 2CYZB 3S3MA 3JRZA 3FDRA 3SB2A 4IURA 3UPUA 4RG2A 2E5QA 3GNFB 5A2QE 3L2UA 2JNGA 1O9SA 1U1TA 4JRIA 5LL6S 4M75B 4XTVA 3M4YA 4E47A 2E6ZA 5LJ3h 2QEXT 2X4XA 2FL7A 1FWZA 2CZ7B 4M78C 2WACA 3KXTA 1HXDA 4JS4A 3DLMA 1VQ9A 1ZBXA 5GAN6 5A0GA 1KQSS 3M59A 2O01E 2B8AA 1JBMA 3BDLA 3VV0A 3X28B 2KY9A 4EMKC 3RUXA 2EQUA 1KHIA 3SWNB 4M7AB 4E7LA 4J5YA 4LDUA 5FU7C 4OB0B 1I8FA 5DY9A 3OYEA 1NJIC 2XG8D 2PVOB 5KE2A 4DA4A 2Y90A 1B34B 2ZZDA 4DOVA 4BUGA 3PIPA 5LJ3d 2MF2A 3V8LA 5KE3A 1YJ9A 5HK0A 4XU1A 4E7IA 2QI2A 3A8MB 3CCET 4NL2A 4M78G 1Q86U 4C0ZA 4V2SA 1WQ7A 1M4ZA 1QVPA 3C95A 2GQVA 4X9CA 1YIJA 4M75C 2C06A 3ASKA 2GFUA 2EWNA 5KH6A 3V7CA 2DXBA 4A53A 4F7UG 3AHUA 4JLIA 3OBWA 3L2ZA 3SD4A 5LJ5j 1WJSA 2F5KA 1D3BB 4ME7A 1OYXA 2LTOA 1Y07A 2PUOB 3VUZA 1YITA 2IG0A 2PU9B 2QA4A 2VXEA 3SFMA 3M9QA 2DZ9A 4B9XA 4BI4A 4ZGJB 4J8OA 2MWOA 4M75F 1NZ9A 3CPFA 1KD1C 1VQ8T 4J6WA 1KG1A 1EIFA 2LT4A 3QO3A 2VGMA 3SWNA 2DXUA 1RL2A 2MAMA 5GAMf 3M55A 2DXCA 4ZGDB 3I56A 4C8QE 3OYLA 1YJWT 4C92G 4KUDK 2CZ1B 4PJOE 2FHDA 4E7HA 2VXFA 2R58A 1KQSA 2PUKB 2EJFA 2M16A 1YI2T 1PSFA 3X26B 1M5Q1 1XOVA 2FVUA 3P8DA 3NTHA 3RERA 3CCMT 5GAN8 2RHIA 5CQXA 2OTJT 2RI2A 3GF5A 3MHXA 3G4ST 5FRMA 2VC8A 1B34A 2CZ0B 1JRIA 2HBPA 2LDMA 4J6YA 3C4SA 3JCMd 4MMLA 2D6FA 3OMGA 1VQ6T 2K3YA 4ZTJA 1I5LA 3JB9H 1WJRA 2YRVA 5J26A 2QQBA 1XNIA 4JDSA 1JJ2S 2MI6A 2XICA 3MP6A 4OGEA 3L2VA 3JSCA 1BI3A 2VV5A 4O5VA 4C8QC 4D6WA 4R56A 3MO8A 2E12A 2YHTA 1YJWA 4M77D 3PMIA 5J39A 2EYQA 5CKDA 1M8VA 2BUDA 3G71T 1K73U 2QDYB 1W2BS 3HSBA 5GAOr 1Q81C 2EQMA 4M75A 2X4JA 1YI2A 4JS5A 2FB7A 4M77F 1VQLT 4BDZA 2WSCE 5CCAA 2HNIA 1G3YA 2Y4YA 1W2BA 1K8AU 1VQOT 3QXEB 5FU7B 4M77G 2CS7A 1VQ7T 1KQ2A 4Z02A 3NFCA 4MDWA 2K5LA 1VQ5A 2XD0A 4C5EA 4ZGEB 1DJ7B 1JB0E 3CC7A 2YLCA 4IUUA 2M1HA 4E7KA 3S3NA 1VQ8A 1P92A 3FLGA 2JVVA 4PLIA 4M78B 1FX7A 5L8RE 3CC2A 4C0FA 1G3WA 3OMCA 3I55T 3NTKA 5GMKm 3CXCA 1S72A 1O75A 4C92F 4JJNK 4M77A 2ZPGB 4IKFA 2K3XA 2DTIA 3GLXA 4IUPA 5GAOq 3HFNA 1M1KC 3QZ5B 4TVRA 4M75G 3JCMg 3DLLA 2A3LA 2OTLT 3OBYA 4MDXA 3QJ6A 2RA2A 4FL6A 1K73C 2QEXA 1JJ2A 3A8LB 4FU6A 1W4SA 2P0KA 4BB7A 2O4XA 3QHSA 3JCMh 2RJFA 5M9OA 4JRPA 2BKDN 4FT2A 3OYYA 3X25B 5CK9A 4HCZA 2KMTA 3KUFA 1M1FA 3OSSC 4XTYA 3CC2T 3DKMA 2XDDA 4M7AG 2EJGA 2LCLA 5EG2A 3LH0A 5GANg 2MWPA 3C12A 4FSXA 3OYCA 4ATOA 5GAMj 3VYHB 2E70A 3CC4T 2DKGA 3FEOA 3R6OA 4OP0A 1VQLA 2XK0A 5DLOA 5CO7A 1ZQ1A 3WVEB 5GAOm 2RK2A 3I56T 3CCJA 2DIQA 3JCMJ 3PFSA 3HRUA 4KUIA 4M78D 1NPRA 4F7UF 1QVGS 1M90C 4F7UB 4LD6A 3OYNA 1M9SA 4HA8A 1R8OB 3CMEA 4M7DG 3JCMQ 2ZPIB 3CC4A 4X34A 4OMFB 1X75C 2K5FA 2M9UA 5GANd 1KQ1A 4C92D 1QVGA 3CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAC A;  2RHZ A;  4OVA A;  3OYL A;  2HQE A;  4C5I A;  5IN1 A;  2JTF A;  2FHD A;  4E7H A;  4EDU A;  2R58 A;  2RHU A;  5C0M A;  3OQ5 A;  4QQD A;  4QQG A;  2M16 A;  2XDP A;  3OA6 A;  3P8D A;  2E6N A;  4N4G A;  2L3R A;  2QQR A;  3S6W A;  4CRI A;  4BE1 A;  3NTH A;  1OZ3 A;  2RHI A;  2DIG A;  2RI2 A;  3EAE A;  3L42 A;  5FRM A;  3NTI A;  2LDM A;  2RJD A;  3C4S A;  3H6Z A;  4IUV A;  2D9T A;  2L8D A;  3CEY A;  3OMG A;  2RJE A;  3QBY A;  2CKK A;  2EFI A;  2K3Y A;  4C5G A;  3OYJ A;  1MHN A;  1WJR A;  2YRV A;  3UWN A;  3S3O A;  4ZTJ A;  2QQS A;  3DB4 A;  3OYB A;  2HQX A;  3LGF A;  5J26 A;  4UC4 A;  1XNI A;  2RI3 A;  2GF7 A;  3L2V A;  3DB3 A;  3MP6 A;  4IUT A;  2L89 A;  2EQK A;  3O8V A;  2EQJ A;  2X35 A;  3Q1J A;  2R5A A;  3MO8 A;  4N4H A;  4A4G A;  4N4I A;  3F70 A;  3PMI A;  5J39 A;  4ZTF A;  1G5V A;  2BUD A;  3P8H A;  2G3R A;  2GFA A;  2JZ2 A;  4PLL A;  4QVZ A;  2RHY A;  4QW2 A;  3OYK A;  3L2W A;  2EQM A;  4BD3 A;  4A4F A;  2M0O A;  3UT1 A;  4BDZ A;  1SSF A;  3OYG A;  2O4X B;  4GY5 A;  2RO0 A;  3LYI A;  2NLU A;  2X4W A;  3MEW A;  3OB9 A;  5C6S A;  4A4H A;  3OYF A;  3L2Q A;  1OZ2 A;  3LLR A;  4Z02 A;  3OS0 A;  4NS5 A;  5CIU A;  4C5E A;  3S3M A;  3FDR A;  4IUU A;  2M1H A;  4IUR A;  4E7K A;  3S3N A;  2LCC A;  3FLG A;  4RG2 A;  1N27 A;  2E5Q A;  4PLI A;  3L2U A;  3LX7 A;  3E9G A;  3MP1 A;  3OMC A;  3NTK A;  5FRN A;  3E9F A;  4BE2 A;  1WJQ A;  2LRQ A;  2X4X A;  1OI1 A;  4IKF A;  4Q5W A;  2PQW A;  2K3X A;  2DAQ A;  4IUP A;  4BDY A;  2WAC A;  3DLM A;  3OYH A;  3L2R A;  3PMT A;  5FRO A;  3OYM A;  2R5M A;  3MET A;  3PNW C;  1KHC A;  4II1 A;  4E7J A;  2B8A A;  4L59 A;  3BDL A;  4B9W A;  3OY9 A;  3QJ6 A;  4FL6 A;  2EQU A;  2BIV A;  4E7L A;  4FU6 A;  3MP8 A;  2X4Y A;  3QKJ A;  2EKO A;  3LGL A;  1WGS A;  3OYE A;  2P0K A;  3QII A;  5KE2 A;  4IUQ A;  2O4X A;  5IAY A;  3MEV A;  2RJF A;  5KE3 A;  5M9O A;  2RI5 A;  2BKD N;  4QQ6 A;  5D6Y A;  5KCO A;  3OYA A;  4E7I A;  4HCZ A;  3ZEH A;  3KUF A;  3MEA A;  2R57 A;  4PL6 A;  1RI0 A;  5D6X A;  4BE0 A;  5KCH A;  3LH0 A;  3ASK A;  2GFU A;  2MWP A;  5D6W A;  5KH6 A;  1H3Z A;  2RHX A;  3OYC A;  3OS2 A;  4A4E A;  3FEO A;  2RJC A;  3OS1 A;  2XK0 A;  3SD4 A;  4C5H A;  3OYD A;  1WJS A;  3H8Z A;  2F5K A;  1OYX A;  2DIQ A;  2LTO A;  3PFS A;  3FC3 A;  2IG0 A;  3ME9 A;  4LD6 A;  3M9Q A;  3OYN A;  4B9X A;  2LVM A;  3GOX A;  2MWO A;  3OYI A;  4X34 A;  3MEU A;  2VYT A; 
#chains in the Genus database with same CATH topology
 3OS5 A;  2ENM A;  2P0P A;  1EZZ B;  1B7T A;  3CC2 Q;  4EDU A;  1IGU A;  3E1S A;  4QQG A;  4BY6 B;  1K9M C;  3A8O B;  4N4G A;  1WLP B;  3V8K A;  3CBO A;  3CMA Q;  2KSS A;  1GCQ C;  3UWN A;  3CME T;  1YJ9 T;  3FJP A;  1VQ9 Q;  2A28 A;  4XTZ A;  3V7R A;  4LDV A;  3G6E T;  2X35 A;  1M3B A;  1WNL A;  2KEA A;  4LDW A;  1PCX A;  7AT1 B;  5I21 A;  2DL7 A;  4OMP A;  4PLL A;  4RTZ A;  2LQN A;  2V1R A;  4C8Q B;  4L5G A;  1BYM A;  4DBF A;  1FYN A;  2NUP B;  4A4H A;  2DEQ A;  1G3T A;  4M78 E;  2J6O A;  2KI7 A;  2KRN A;  3GPL A;  2EGC A;  1NPP A;  2MCN A;  3LWH A;  1D0X A;  3QDR B;  3CCL Q;  2QTX A;  4Q5W A;  1ZLM A;  2XI9 A;  3HP9 A;  4ZN1 A;  5GMK i;  3M56 A;  3OYH A;  1SHF A;  1TTH B;  2CT3 A;  3UA7 A;  2P4R A;  3OY9 A;  2K4Y A;  3C94 A;  2VVK A;  2WSF E;  1TUG B;  3CMA T;  3GIB A;  1NLO C;  1JO8 A;  5I11 A;  4M7A A;  1TXQ A;  1WHH A;  1KC8 C;  4M7D E;  3HRT A;  1M1K U;  1M1K R;  4C0D B;  1YHQ T;  1PNJ A;  1A0N B;  2RJC A;  3TEE A;  3OS1 A;  4KGX B;  4PJJ A;  2ED0 A;  5LJ5 e;  3TU4 K;  2V8I A;  3M5A A;  2NWM A;  3WXM B;  2LVM A;  3V7S A;  3G7Z A;  1K76 A;  2PNI A;  1YI2 Q;  4FYV B;  4LN2 A;  5DM7 R;  3VJP A;  1YIJ T;  1UGS B;  3QZ9 B;  2JJ9 A;  2X3W D;  3M53 A;  1XQH A;  2XDP A;  4PJO D;  3OA6 A;  1HYO A;  1OZ3 A;  3JCM V;  5HKC A;  1VQO A;  2E41 A;  3BE3 A;  1ZBJ A;  1QWE A;  3QYG B;  1Q82 U;  2OTL Q;  3S3O A;  2K7A A;  4M77 C;  1B07 A;  3PT9 A;  2LCS A;  3O5Z A;  3CCS T;  1D09 B;  1HK9 A;  3TCJ A;  2XHC A;  1N6A A;  2A0F B;  4J9F A;  1UEB A;  2JW4 A;  4BD3 A;  1QVF P;  2RB6 A;  4FW1 A;  2ECZ A;  3I56 Q;  1ZHI A;  4EPC A;  1KD1 U;  3CCM A;  4GY5 A;  3CBM A;  4NOY A;  1V76 A;  1VQ6 A;  3LWI A;  1I07 A;  3CCV A;  1Z9Z A;  1NG2 A;  2DD5 A;  4DBQ A;  2DJZ A;  4AMC A;  1WJQ A;  4JRK A;  1MMD A;  2A7Y A;  2DAQ A;  2QYZ A;  2LT1 A;  1K8A C;  3L2R A;  3PMT A;  4FW2 A;  5GAN 7;  1G8X A;  2HSE B;  2AZS A;  4AFQ C;  3MP8 A;  3LGL A;  3JB9 J;  3QII A;  1D0Z A;  5IAY A;  5KYU A;  1RAH B;  4BI8 B;  2GTJ A;  2ZPH B;  3JB9 I;  4RUG A;  3RMQ A;  1QLY A;  4M77 E;  1J3T A;  2E64 A;  3ZBD A;  4Z89 A;  1WHJ A;  1X6B A;  1WYX A;  2AZV A;  2OTJ Q;  1WHM A;  4RCB A;  2HSP A;  3EG0 A;  3UAT A;  4C92 B;  1VQ5 T;  3QUI A;  4A4K A;  3CXC S;  4KRT A;  4M78 F;  1U8R A;  5I2S A;  2VYT A;  4KUL A;  2RHZ A;  1OU9 A;  1D1A A;  1PD1 A;  2DET A;  2PZ1 A;  2F2X A;  1MND A;  1X2K A;  2F2W A;  1D1C A;  3HFO A;  3VYG A;  5GAN 2;  3NTI A;  2RJD A;  3UDC A;  5FU6 C;  2EFI A;  1SHG A;  2E10 A;  1QCN A;  1QCF A;  2K5I A;  4A4G A;  2EQI A;  1JXM A;  2E4H A;  2YXY A;  5IT9 E;  9ATC B;  2G3R A;  2E65 A;  3PVL A;  1T3L A;  2DO3 A;  2M0O A;  4C92 E;  2L5Q A;  1KC8 U;  1BI1 A;  1KD1 R;  5FW9 A;  1HJD A;  1MUZ A;  2CSQ A;  1VQL Q;  3BFM A;  1OZ2 A;  4VUB A;  3JRZ A;  1X69 A;  4KH0 B;  4RG2 A;  3GNF B;  2BE7 D;  5KYW A;  2BZY A;  2JNG A;  1O9S A;  2A08 A;  4XTV A;  2J6F A;  1ABO A;  1FWZ A;  2CP0 A;  4OMO A;  3I5R A;  4M78 C;  2MYS A;  3DLM A;  4JPB W;  5GAN 6;  2O01 E;  2B8A A;  1JBM A;  3BDL A;  2KY9 A;  4DBH A;  4J5Y A;  2YSQ A;  2XG8 D;  5KE2 A;  4DA4 A;  2ZZD A;  2B86 A;  4BUG A;  5KE3 A;  2MF2 A;  4J9B A;  3PIP A;  4AG2 C;  1YJW Q;  2H8H A;  5HK0 A;  2GBQ A;  2OJ2 A;  1WQ7 A;  1QVP A;  1SEM A;  2GQV A;  2P84 A;  4M75 C;  4ESR A;  3D7S B;  2D8H A;  4EIK A;  4F7U G;  1OYX A;  2LTO A;  1Y07 A;  2H3E B;  3VUZ A;  4LXC A;  2IG0 A;  3EG2 A;  3EGX B;  3M9Q A;  3RBB B;  4B9X A;  4ZGJ B;  2RQW A;  3CCV Q;  2JXB A;  2MWO A;  1NZ9 A;  3CPF A;  2VB6 A;  3VS5 A;  1PRM C;  5GAM f;  1TSF A;  3M55 A;  3G6E Q;  4E7H A;  2R58 A;  1GFD A;  2C0O A;  5KYN A;  2M16 A;  1ZSZ A;  2RQU A;  2EVR A;  1R77 A;  1SSH A;  4JJB A;  2LDM A;  2HBP A;  1WXU A;  1VQ6 T;  1T0H A;  4ZTJ A;  1WJR A;  2YRV A;  2DMO A;  2XIC A;  2KT1 A;  3MP6 A;  2IPO B;  1BI3 A;  2VV5 A;  2YUQ A;  4D6W A;  4R56 A;  3H41 A;  2E12 A;  1GRI A;  1M8V A;  2K3B A;  2E5K A;  1AWW A;  4M77 F;  5CCA A;  1G3Y A;  1W2B A;  3QXE B;  4M77 G;  1ARK A;  4MDW A;  2KXC A;  4IUU A;  3S3N A;  1VQ8 A;  1P92 A;  5D7U A;  1M3C A;  3OMC A;  1S72 A;  3CQT A;  4M77 A;  4IKF A;  1RI9 A;  1KK7 A;  1K0X A;  2DTI A;  1M1K C;  5GAO q;  3JCM g;  2OX7 A;  3OBY A;  5KYY A;  3MKD A;  1VQO Q;  3A8L B;  5KYW B;  3CD6 Q;  4J9G A;  3QHS A;  8AT1 B;  2AT1 B;  4PJN A;  2QG9 B;  4FT2 A;  3EGD A;  3OYY A;  2ZAE A;  5CK9 A;  1Q7Y R;  3OSS C;  5EG2 A;  3I55 Q;  1AWO A;  2L0A A;  5GAN g;  2DKG A;  4OP0 A;  2KRM A;  2CRE A;  5GAO m;  3MJX A;  3CCU Q;  5FWB A;  4F7U F;  1NPR A;  1QVG S;  1M90 C;  4LD6 A;  4HA8 A;  1IRX A;  5GAN d;  3U23 A;  4OMF B;  2K5F A;  3NHN A;  4E47 A;  3CCQ Q;  4ANJ A;  1QVG A;  2HKQ B;  1X6G A;  1K4U S;  2DL3 A;  2V8K A;  3I35 A;  4X9D A;  2E1H A;  1TG0 A;  2DBK A;  5HK3 A;  2RK1 A;  2KXD A;  1FXX A;  2FYK A;  2QQR A;  4CRI A;  1BBZ A;  4QVC A;  4F7U A;  1N9R A;  1UJ0 A;  1D0Y A;  1NBE B;  1MMG A;  4N0A C;  3CCU T;  1YN8 A;  1U06 A;  3GP8 A;  4CI0 C;  1WI7 A;  2ZCF B;  5LJ5 g;  1VQM A;  1I1J A;  3H9N A;  1KIK A;  2OTJ A;  4C92 A;  3VS1 A;  1N9S A;  3F70 A;  2V8J A;  2BZ8 A;  2M51 A;  3JB9 G;  3SEM A;  1KSW A;  2M0Y A;  3OW2 A;  3V8J A;  1GCQ A;  5GAN e;  3TVT A;  1YCS B;  2O4X B;  2RO0 A;  3GNG A;  2NLU A;  3GBQ A;  2P4T A;  3MCA B;  4NS5 A;  2HDA A;  3REB B;  3INZ A;  1PRL C;  4Y28 E;  2JTM A;  2YUP A;  3QWY A;  3LX7 A;  4WCI A;  5IXF A;  5FRN A;  4N0A A;  1N5Z A;  2PQW A;  2CP6 A;  1WZO A;  2Z0W A;  3ZFJ A;  1IRE B;  1QKW A;  4II1 A;  3A8H B;  4PFZ A;  1N8R C;  1Q7Y C;  2BIV A;  4A63 B;  3VS0 A;  5FU6 B;  5CQY A;  5KYY B;  2K57 A;  1YHQ A;  2L3Q A;  3TRE A;  2D0N A;  3N5B B;  4J7F A;  1M1G A;  5KCO A;  2KBT A;  2QGG A;  5L23 A;  8ATC B;  2LQW A;  1Y96 B;  2RHX A;  3L1A A;  1VQN T;  3BY7 A;  3JB9 D;  3J7A F;  4HKE A;  3H8Z A;  3VRY A;  4C0G A;  2HMA A;  5GAO l;  4C92 C;  4M7A C;  2DF6 A;  3CPW A;  3KBG A;  2FZK B;  1S72 Q;  2FRW A;  2F2V A;  3NPF A;  5GAN f;  2XDB A;  3JCM c;  1NLP C;  1UHC A;  4LDX A;  3OQ5 A;  2HAX A;  3M0S A;  4BE1 A;  1VQN A;  2KGT A;  4AFZ C;  3RNJ A;  2DIG A;  2K2V A;  1Q82 C;  4IUV A;  2D9T A;  2L8D A;  2LQ8 A;  2QA4 T;  4PK4 A;  4Y91 A;  2RI3 A;  2NUT A;  3M0Q A;  2VGN A;  5AT1 B;  3I55 A;  2KK4 A;  4JRQ A;  1PKT A;  3EGU A;  3QPH A;  1S72 T;  1OUL A;  1LOJ A;  2FZC B;  5GMK l;  4EMH A;  2GFA A;  4QVZ A;  3M57 A;  1CKA A;  3G6E A;  2LP5 A;  3FB9 A;  4FIB A;  5C6S A;  3OYF A;  3CCQ A;  1QKX A;  4M75 E;  3G1J A;  2XID A;  1FMV A;  1UFF A;  1X43 A;  1VQ7 A;  1W1F A;  2W10 A;  2PTK A;  1LNX A;  2E3I A;  2LRQ A;  1OI1 A;  2CGH A;  4P5N A;  2OAU A;  4OB3 B;  4D8K A;  5IHK A;  5I2M A;  3PNW C;  1KHC A;  4E7J A;  4RTV A;  2FG0 A;  1VQM Q;  1LCK A;  2DYB A;  2EAY A;  4IIO A;  5D6Y A;  3OYA A;  2XKO C;  4OMM A;  2KRS A;  3JCM e;  1YIT T;  1OEB A;  2DZC A;  1YNZ A;  1AZE A;  4HCC A;  2F1L A;  3OYD A;  4C5H A;  1YP5 A;  4OF1 A;  1HSQ A;  5FLX E;  3OW2 S;  1UGR B;  1VQK Q;  3GOX A;  1K73 R;  3OYI A;  3WVD B;  2DYI A;  1Y96 A;  4F7U E;  2QDL A;  2KQW A;  4AFS C;  2RHU A;  3JV3 A;  2AHJ B;  4XTU A;  4A54 A;  2LMJ A;  3S6W A;  2GCX A;  1TUD A;  2KYM A;  1H8K A;  1VQ4 T;  4LDY A;  2RNA A;  2RJE A;  1VQ4 Q;  1MHN A;  4XTX A;  1T0J A;  3X20 B;  4J83 A;  4UC4 A;  3SDZ A;  1BI2 A;  3M0T A;  4QVD A;  2EQK A;  3CCR T;  1AOJ A;  3THK A;  2IVW A;  2DA9 A;  1HD3 A;  2ZPF B;  2RQT A;  1G5V A;  3FRN A;  1WXB A;  1VQ9 T;  2YT6 A;  1PC0 A;  1SSF A;  5GAN j;  3CCV T;  2ZGW A;  1RAC B;  1QP3 A;  3MEW A;  4RTU A;  1Q81 U;  2GTO A;  1YJN T;  1NJI U;  2H3J A;  2HD0 A;  5CIU A;  3JCM f;  1SKU B;  2CYZ B;  1GFC A;  4IUR A;  2E5Q A;  2HEQ A;  5A2Q E;  3L2U A;  1MMA A;  3LH5 A;  4M75 B;  2EYW A;  2KNB B;  1QQJ A;  2WAC A;  1HXD A;  1VQ9 A;  4FCY A;  5A0G A;  2O2O A;  1VYV A;  1E6H A;  3X28 B;  4EMK C;  3RUX A;  2EQU A;  3SWN B;  4LDU A;  4OB0 B;  1G83 A;  1NJI C;  1YJ9 A;  1GBR A;  1RAF B;  3A1P A;  3EFO B;  2EGA A;  4V2S A;  3EH2 A;  3C95 A;  5KH6 A;  4A53 A;  1M3A A;  4JLI A;  5KYX B;  3OBW A;  3SD4 A;  4ME7 A;  5IXB A;  3EHQ A;  2YUN A;  3SFM A;  1S1N A;  4J8O A;  4M75 F;  4J6W A;  1YWO A;  2DRM A;  1EIF A;  3QO3 A;  3SWN A;  1RL2 A;  4E6R A;  4ZGD B;  1K9M R;  4C92 G;  2CZ1 B;  2JS0 A;  2FHD A;  2VXF A;  4ORZ A;  1YI2 T;  1QWF A;  1PSF A;  2A36 A;  1M2V B;  1EX4 A;  3RER A;  2OTJ T;  5CQX A;  4RTY A;  3G4S T;  1V1C A;  1W70 A;  3PE0 A;  3JCM d;  3C4S A;  1OX9 A;  2K3Y A;  1KC8 R;  2MI6 A;  1YFN A;  4AT1 B;  3JSC A;  4O5V A;  2LJ3 A;  4M77 D;  2HBW A;  2EYQ A;  5HCK A;  2BUD A;  1C6V X;  3HSB A;  4M75 A;  3HTR A;  2X4J A;  1YI2 A;  4BDZ A;  2WSC E;  2AK5 A;  2GNC A;  1K8A U;  1VQO T;  5FU7 B;  2CS7 A;  1VQ7 T;  2K5L A;  1DJ7 B;  1JB0 E;  3CC7 A;  2DER A;  2YLC A;  2DVJ A;  3FLG A;  2JVV A;  1K0S A;  3CC2 A;  4AFU C;  4R0K A;  5GMK m;  3H0F A;  1O75 A;  2ZPG B;  3A98 A;  1WIE A;  2K3X A;  3CME Q;  4F14 A;  3QZ5 B;  4KGZ B;  1MV0 B;  1JJ2 A;  2LX7 A;  2P0K A;  4BB7 A;  2O4X A;  2FO0 A;  2QGF B;  5M9O A;  4RTT A;  4HCZ A;  4QT7 A;  3CC2 T;  3DKM A;  3C12 A;  3OYC A;  5GAM j;  3VYH B;  2DNU A;  2V26 A;  2E70 A;  4M4Z A;  3QWX X;  4JZ4 A;  1ZQ1 A;  2L2P A;  3JCM J;  3HRU A;  2VKN A;  5KYU B;  1VYU A;  2EW3 A;  3OYN A;  1M9S A;  1Z9Q A;  4M7D G;  3G71 Q;  2ZPI B;  4KGV B;  2RMO A;  3CCL A;  1AD5 A;  1Y7X A;  1GXI E;  2HQE A;  2JTF A;  5C0M A;  1KJW A;  3QG1 A;  3URG A;  1VA7 A;  2DLP A;  1XTD A;  2E6N A;  2XMF A;  3HHT B;  4M77 B;  3L42 A;  3ER0 A;  3CEY A;  1YHQ Q;  2L3S A;  1UG1 A;  3OYB A;  2DXT A;  1VIE A;  3A8G B;  2IIM A;  3CCE A;  4LD9 K;  1OQK A;  2R5A A;  3RR6 A;  3CD6 T;  4PJL A;  2RHY A;  3X24 B;  3L2W A;  2CSI A;  2LNH B;  1UGV A;  4BI3 A;  2LJ0 A;  4RCC A;  2BTT A;  1AHJ B;  4J7I A;  3JB9 F;  3CCJ Q;  1UE9 A;  3VUB A;  2X9H A;  1G2B A;  4KH1 B;  1GBQ A;  3RKW A;  2JUF A;  3HKS A;  3HPW A;  1VUB A;  4C0D C;  4F04 B;  1JXO A;  4PJO C;  3CXC P;  3H0H A;  1D3B A;  4HCB A;  3BDU A;  3OYM A;  1WDX A;  2R5M A;  1WHG A;  3G4S A;  3J81 E;  4M7D C;  1QVF A;  3CPW P;  1OPK A;  4KBM B;  1K8A R;  4JUV A;  2K6D A;  2D0Q B;  5IH2 A;  4IUQ A;  4DOW A;  3MEV A;  5DLQ E;  1X6O A;  5GAM d;  4JLG A;  4E2F B;  5GMK h;  5IHI A;  2KVQ G;  5KCH A;  5GAN 5;  2RQR A;  1H3Z A;  4M7A E;  3OS2 A;  2EIF A;  4RG8 A;  3REA B;  1WXT A;  2KE9 A;  4M7D A;  2CH4 A;  1UJY A;  2O31 A;  3P8B B;  4M75 D;  2DTO A;  1M2V A;  2SEM A;  3A5Z B;  1N8R R;  2LQK A;  2SRC A;  4EMK B;  5AYF A;  2K2M A;  3EG1 A;  1B3Q A;  4FM4 B;  2Y4X A;  4FYY B;  3RES A;  2JM9 A;  2JMA A;  3QDF A;  2RD1 A;  1EFN A;  2J7I A;  1YJ9 Q;  1SRM A;  1VQM T;  5GAO p;  4FYW B;  2VWF A;  1NEG A;  3TSW A;  2QQA A;  1I4K 1;  2QAZ A;  1M90 U;  4MZT A;  2A37 A;  1GL5 A;  3LGF A;  2GF7 A;  5A0L A;  3DB3 A;  4J9I A;  4IUT A;  3J80 E;  3Q1J A;  2KAF A;  2EJ9 A;  4QKU A;  1IB8 A;  4KT0 E;  3EFO A;  1JEG A;  4A4F A;  1PM3 A;  4WTO B;  2F69 A;  2KR3 A;  2X4W A;  3OB9 A;  1JQQ A;  4PFP A;  3G71 A;  1BIB A;  5GAN 4;  4C8Q G;  1VQP A;  2EYY A;  1NEB A;  2OI3 A;  2QK0 A;  1M30 A;  3RKY A;  3VU3 C;  4WF2 A;  5GAM g;  3MP1 A;  4F16 A;  4BE2 A;  5LJ5 h;  3CCQ T;  4OGC A;  1JU5 C;  5GAO n;  1JJ2 P;  4PJO G;  2NYS A;  1IZ6 A;  3CCJ T;  4HVW A;  2JN0 A;  1M27 C;  1Q81 R;  3QKJ A;  2X4Y A;  3I5S A;  2HL5 C;  2ABL A;  1Y71 A;  3CCL T;  3ZL7 C;  3FJ5 A;  4XQ3 A;  4XU2 A;  3EGX A;  3JAM E;  3T9N A;  2R57 A;  3C0C A;  1RI0 A;  2EBP A;  1H64 1;  2RQV A;  5D6W A;  1ZUY A;  4GLM A;  4MMK A;  5GAM e;  1PG5 B;  2DPP B;  3M4G A;  3EFS A;  3FC3 A;  3TQ7 P;  3CCM Q;  4PNO A;  3JCM X;  1YCY A;  1X2Q A;  4C5I A;  5IN1 A;  4OB2 B;  4EMG A;  1QCO A;  3CD6 A;  2QQ9 A;  1E6G A;  3PGG A;  3M0P A;  2L3R A;  1UB4 A;  4Z88 A;  1MMN A;  3EAE A;  3VKI A;  5HY6 A;  2DTH A;  3CBP A;  4DEX A;  2W0Z A;  3DB4 A;  3EG9 A;  1QMC A;  1W2B P;  3CCU A;  2EQJ A;  3JCM P;  4N4I A;  4QW2 A;  4Y92 A;  3CCR A;  4M7D D;  5CKF A;  1ZX6 A;  5LJ3 j;  2JMC A;  3JCM b;  3L2Q A;  1KQ2 A;  3LLR A;  1PKS A;  5CVI A;  4ZN3 A;  4HT9 A;  3S3M A;  1U5S A;  3UPU A;  1RUW A;  4X1V A;  1TWB A;  1U1T A;  5LL6 S;  3M4Y A;  1R0C B;  2QEX T;  1BU1 A;  1BB9 A;  2FL7 A;  2DX1 A;  4JS4 A;  1ZBX A;  2ATC B;  3M59 A;  4CC2 A;  1KHI A;  4M7A B;  4E7L A;  5FU7 C;  4AG1 C;  3OYE A;  4DOV A;  5LJ3 d;  2FEI A;  2KRO A;  3CCS Q;  4XU1 A;  4E7I A;  1AEY A;  3A8M B;  2CUD A;  4M78 G;  1M4Z A;  4X9C A;  1YIJ A;  3CCE Q;  2C06 A;  2EWN A;  2DXB A;  4PJM A;  3UF4 A;  2HZY A;  3L2Z A;  5LJ5 j;  1WJS A;  1D3B B;  2PUO B;  1RAD B;  1YIT A;  2PU9 B;  2BE9 B;  2DZ9 A;  4BI4 A;  1KD1 C;  1VQ8 T;  2LT4 A;  2JS2 A;  2DXU A;  2DXC A;  4C8Q E;  2CP7 A;  1T3S A;  4KUD K;  4PJO E;  1KQS A;  2J05 A;  2EJF A;  2FPE A;  1XOV A;  3NTH A;  1UDL A;  3CCM T;  1R0B G;  2RHI A;  5GAN 8;  2RI2 A;  3GF5 A;  3MHX A;  5FRM A;  2VC8 A;  2CZ0 B;  1LPL A;  4J6Y A;  2D6F A;  2EKH A;  4MML A;  4JZ3 A;  3OMG A;  1WHK A;  3G4S Q;  1I5L A;  3JB9 H;  1H3H A;  2EYX A;  2ROT A;  5J26 A;  2QQB A;  1JJ2 S;  4OGE A;  3L2V A;  2CP2 A;  1IO6 A;  1TU0 B;  3AT1 B;  3PMI A;  5CKD A;  2AKK A;  3G71 T;  1W2B S;  5GAO r;  2J06 A;  2MK5 A;  2YRC A;  1Q81 C;  4CC3 A;  2FB7 A;  4JS5 A;  2HNI A;  1Q95 G;  2Y4Y A;  1IGQ A;  1VQ5 A;  2XD0 A;  4C5E A;  4ZGE B;  1C0M A;  4CC7 A;  2M1H A;  4E7K A;  2JTE A;  2BZX A;  2QAS A;  1FX7 A;  5L8R E;  1G3W A;  3I55 T;  3NTK A;  2DFU A;  3CXC A;  1AWX A;  2E3H A;  4JJN K;  2AIR B;  1SG5 A;  4OMQ A;  4IUP A;  1XJW B;  3DLL A;  1NYF A;  4K11 A;  3QJ6 A;  4FL6 A;  1K73 C;  2LZ6 B;  1M2O A;  2NUP A;  4LNP A;  2RJF A;  4JRP A;  2BKD N;  2CH4 W;  4D8D A;  3X25 B;  4XTY A;  4M7A G;  2XDD A;  2MWP A;  4J9H A;  3CCR Q;  2JT4 A;  4FSX A;  4ATO A;  3R6O A;  5CO7 A;  4Z8A A;  2RK2 A;  3I56 T;  3PFS A;  1OX8 A;  4KUI A;  2CDT A;  1LVK A;  1R8O B;  2L3P A;  3JCM Q;  3CC4 A;  4X34 A;  2M9U A;  1KQ1 A;  4C92 D;  1VQP Q;  1X01 A;  2QEX Q;  1UEC A;  2YLB A;  2NUT B;  3EH1 A;  1WPY A;  1Q82 R;  4OMN A;  3LW5 E;  2DRK A;  1QVG P;  3TSZ A;  1NJI R;  2CUB A;  3PTA A;  5GAM h;  2F5T X;  2DL8 A;  4M78 A;  2PVD B;  1Y0M A;  1ZSG A;  1V29 B;  2QQS A;  2RH2 A;  2HQX A;  3PIO A;  1QVF S;  1E7O A;  1IHV A;  1WA7 A;  3M0R A;  2EPD A;  2L89 A;  3EHR A;  1U1S A;  3QJY A;  3ULR B;  2EYZ A;  5KYX A;  3M58 A;  3JCM W;  1N8R U;  3BW1 A;  1H92 A;  5CR2 A;  1PHT A;  1SRL A;  3OYK A;  1WFW A;  4YTL A;  5IHN A;  3M54 A;  5LJ3 e;  2DBM A;  3LYI A;  1MGQ A;  2I2L A;  2DL5 A;  1WQW A;  2LCC A;  3QYH B;  3KFV A;  1NYG A;  1RAI B;  4MZP A;  4OML A;  4LUD A;  4NL3 A;  3E9F A;  5GAN h;  1QW1 A;  2QA4 Q;  3SWN C;  4BDY A;  5J3B A;  1BKB A;  4OB1 B;  5FRO A;  1RAE B;  3MET A;  5LJ5 f;  4L59 A;  3H0I A;  1G3S A;  2KDS A;  1KQS P;  2DD4 A;  1WGS A;  1FMW A;  4XK8 E;  2RI5 A;  5GMK e;  4QQ6 A;  4M7A D;  2ROL A;  4PJO A;  4M7D F;  4M7A F;  1K1Z A;  1PD0 A;  1NE8 A;  4HT8 A;  4A4E A;  4J6X A;  1LJO A;  3HRS A;  2VAS A;  2LC4 A;  3OSV A;  2RM4 A;  3CPW S;  3FIF A;  1I0C A;  4C8Q A;  2V1Q A;  4FSS A;  1UGP B;  4XTW A;  2PVG B;  5LJ5 d;  3MPU B;  2DEU A;  1Y57 A;  4PFO A;  2DM1 A;  5LJ3 f;  1K9M U;  5LJ3 g;  3E2U A;  4M7D B;  2ZPE B;  4J9D A;  4QQD A;  1VQ8 Q;  4C8Q F;  4GLK A;  3UA6 A;  4PJO F;  1TS9 A;  3ZEH A;  2RF0 A;  3OYJ A;  1PWT A;  2ZPB B;  1C1A A;  4RKU E;  1FMK A;  1PSE A;  2YRD A;  4ELY C;  4O6J A;  3VS2 A;  3O8V A;  3HL8 A;  1OU8 A;  4RTW A;  3RIR A;  4ZTF A;  5CKE A;  2JZ2 A;  2MIO A;  2CP5 A;  1VQK A;  2LX9 A;  3CC4 Q;  3OS0 A;  3E19 A;  2O88 A;  3SHW A;  2VUB A;  5CKB A;  1YIT Q;  1VQN Q;  1N27 A;  5CKH A;  1ZSZ C;  1WX6 A;  5GMK j;  4FT4 A;  3E9G A;  4E7S A;  5CAI A;  4EMK A;  4MZM A;  1AZG B;  1Q7Y U;  4CC4 B;  4C8Q D;  1VQP T;  2X51 A;  2FPD A;  1Q86 C;  3CMA A;  3RKX A;  1ACM B;  1WHL A;  3M0U A;  1I81 A;  4FYX B;  2WSE E;  3EG3 A;  3EFR A;  2ESW A;  2YWW A;  2LNV A;  1VQ4 A;  4B9W A;  1VQK T;  2COW A;  3IQL A;  2MMP A;  4RMO A;  2EKO A;  2DJQ A;  2KYB A;  1YBY A;  3CC7 T;  2JOY A;  2HQH A;  3QSU A;  2OTL A;  1UHF A;  2DE0 X;  2FPF A;  3MEA A;  4ZNX A;  4PL6 A;  5D6X A;  2MPX C;  1I5O B;  4BE0 A;  5GAN 3;  2FRY A;  1D1B A;  4L6V 5;  4DQ2 A;  4ELZ C;  1BI0 A;  4R55 A;  2XU8 A;  5GJV B;  3ME9 A;  2CZ6 B;  2P0Q A;  4B6M A;  4IIM A;  4J9E A;  1K9A A;  3MEU A;  2DVE A;  4BAC A;  4OVA A;  5EC7 A;  2AKL A;  1UGQ B;  5FWC A;  1VIF A;  2GGR A;  3VS4 A;  2NUZ A;  4PKC C;  1QP2 A;  2C0I A;  1GCP A;  1ABQ A;  4XU0 A;  3NGP A;  1YJN A;  3H6Z A;  3QBY A;  2CKK A;  2D8J A;  3I9Q A;  4C5G A;  2ED1 A;  2QXF A;  1BIA A;  4XAX B;  4RTX A;  1YIJ Q;  1MV3 A;  1TH7 A;  4N4H A;  3P8H A;  4F17 A;  4PJO B;  2DK3 A;  5A0D A;  2D1X A;  2RPN A;  3UT1 A;  3OYG A;  4BY6 C;  6AT1 B;  2M02 A;  3CCS A;  3RMS A;  3EG9 B;  4XU3 A;  3FDR A;  4DEY A;  4JJC A;  3SB2 A;  1Q86 R;  2JM8 A;  2I0N A;  2HKN A;  2O9S A;  4JRI A;  1ZSZ B;  5LJ3 h;  2COY A;  2E6Z A;  2X4X A;  4J9C A;  1VYT A;  2CZ7 B;  2MOX A;  3KXT A;  1KQS S;  3VV0 A;  4GBQ A;  3NMZ C;  2EGE A;  5ECA A;  3R6N A;  3VS3 A;  1YWP A;  1I8F A;  5DY9 A;  2J6K A;  2PVO B;  2Y90 A;  1B34 B;  3V8L A;  2QI2 A;  3CCE T;  1UUE A;  4NL2 A;  1Q86 U;  4C0Z A;  3ASK A;  2GFU A;  3EGD B;  2DL4 A;  3VS7 A;  3V7C A;  1W6X A;  1RAA B;  1RAG B;  1TUC A;  3AHU A;  1VQ5 Q;  1M90 R;  2F5K A;  2OAW A;  1X27 A;  1VQ6 Q;  1BK2 A;  4HXJ A;  1CSK A;  2QA4 A;  1AVZ C;  2VXE A;  3RDV A;  1RAB B;  1KG1 A;  2VGM A;  2G6F X;  2MAM A;  1ZUK A;  1ZUU A;  3I56 A;  2HL3 A;  3OYL A;  1YJW T;  1OV3 A;  4HCK A;  2PUK B;  2K9G A;  2YDL A;  1ZA2 B;  3X26 B;  1M5Q 1;  4HVU A;  1RLP C;  3P8D A;  2FVU A;  2RN8 A;  3VS6 A;  1B34 A;  1JRI A;  1VQ7 Q;  1MNE A;  1VOM A;  4DBR A;  1SF9 A;  4JDS A;  1XNI A;  1OOT A;  5GJW B;  4LE9 A;  4C8Q C;  3MO8 A;  3VRZ A;  2K79 A;  1TOV A;  2YHT A;  1UTI A;  5J39 A;  1YJW A;  1K73 U;  2QDY B;  2O9V A;  2EQM A;  3OW2 P;  1VQL T;  1M8M A;  4Z02 A;  3NFC A;  1ZA1 B;  2QTV A;  1AT1 B;  2HCK A;  2FZG B;  4PLI A;  2GQI A;  4M78 B;  4C0F A;  4C92 F;  2CP3 A;  2DIL A;  3PVQ A;  1BCM A;  3GLX A;  3HFN A;  1YJN Q;  4TVR A;  4M75 G;  1SPK A;  2A3L A;  2OTL T;  4JJD A;  1CKB A;  4MDX A;  1BCO A;  2RA2 A;  5I22 A;  2QEX A;  4FU6 A;  4E7Z A;  1W4S A;  2KT8 A;  1F1B B;  2X3X D;  3JCM h;  2CT4 A;  2KMT A;  3KUF A;  1M1F A;  1NM7 A;  2EJG A;  1KFZ A;  2LCL A;  1RLQ C;  2LJ1 A;  3CC7 Q;  2YUO A;  3LH0 A;  2COZ A;  1IXD A;  3CC4 T;  3FEO A;  1VQL A;  2XK0 A;  5DLO A;  3WVE B;  3CCJ A;  2DIQ A;  4LUE A;  4M78 D;  1U3O A;  4F7U B;  3CME A;  1IHW A;  1OPL A;  1X75 C;  2C0T A;  4HVV A;  1AWJ A; 
#chains in the Genus database with same CATH homology
 1Y7X A;  1X01 A;  1GXI E;  3OS5 A;  2P0P A;  2HQE A;  2YLB A;  2JTF A;  2V8K A;  4X9D A;  4EDU A;  1WPY A;  2E1H A;  5C0M A;  3E1S A;  3QG1 A;  3LW5 E;  4QQG A;  2RK1 A;  3URG A;  5HK3 A;  1FXX A;  4BY6 B;  1XTD A;  1K9M C;  3A8O B;  2E6N A;  2FYK A;  2QQR A;  4N4G A;  3V8K A;  3CBO A;  3HHT B;  4CRI A;  4F7U A;  4QVC A;  1N9R A;  4M77 B;  3L42 A;  3ER0 A;  2KSS A;  3PTA A;  4N0A C;  3CCU T;  3CEY A;  5GAM h;  2F5T X;  3GP8 A;  4M78 A;  2PVD B;  4CI0 C;  3UWN A;  1V29 B;  2QQS A;  2RH2 A;  2ZCF B;  2DXT A;  2HQX A;  5LJ5 g;  3OYB A;  1VIE A;  3PIO A;  3CME T;  1VQM A;  3A8G B;  1YJ9 T;  1QVF S;  3FJP A;  4XTZ A;  3V7R A;  4LDV A;  2L89 A;  2OTJ A;  4C92 A;  3G6E T;  3CCE A;  1U1S A;  3QJY A;  4LD9 K;  2X35 A;  2R5A A;  1WNL A;  3M58 A;  1N9S A;  3F70 A;  2V8J A;  4LDW A;  3JCM W;  5I21 A;  3BW1 A;  1N8R U;  5CR2 A;  3CD6 T;  4PLL A;  2RHY A;  3X24 B;  3OYK A;  3L2W A;  3JB9 G;  3OW2 A;  4BI3 A;  4YTL A;  4C8Q B;  4RCC A;  4L5G A;  3V8J A;  3M54 A;  5LJ3 e;  1BYM A;  5GAN e;  1AHJ B;  2O4X B;  2RO0 A;  3GNG A;  2NLU A;  3LYI A;  4A4H A;  4J7I A;  3JB9 F;  2P4T A;  2DEQ A;  3MCA B;  4NS5 A;  1MGQ A;  2I2L A;  3INZ A;  3VUB A;  1G3T A;  4Y28 E;  4M78 E;  3RKW A;  1WQW A;  2LCC A;  2JTM A;  3QYH B;  2JUF A;  3HKS A;  3GPL A;  4MZP A;  1NPP A;  3LWH A;  3HPW A;  1VUB A;  3LX7 A;  4NL3 A;  4C0D C;  3QDR B;  5FRN A;  3E9F A;  4N0A A;  5GAN h;  4PJO C;  2QTX A;  4Q5W A;  2XI9 A;  2PQW A;  1QW1 A;  3HP9 A;  1D3B A;  4ZN1 A;  5GMK i;  4HCB A;  3SWN C;  4BDY A;  3BDU A;  3M56 A;  5J3B A;  3OYH A;  1BKB A;  4OB1 B;  3ZFJ A;  5FRO A;  3OYM A;  2R5M A;  1IRE B;  3MET A;  5LJ5 f;  4II1 A;  4L59 A;  3G4S A;  3OY9 A;  1G3S A;  2KDS A;  2K4Y A;  3A8H B;  3J81 E;  1N8R C;  1QVF A;  4M7D C;  1Q7Y C;  2BIV A;  3C94 A;  4KBM B;  2DD4 A;  2WSF E;  3CMA T;  1WGS A;  4JUV A;  2D0Q B;  5FU6 B;  5CQY A;  3GIB A;  4IUQ A;  4DOW A;  3MEV A;  2K57 A;  5DLQ E;  1YHQ A;  4XK8 E;  1X6O A;  2RI5 A;  3TRE A;  3N5B B;  4QQ6 A;  4J7F A;  5GMK e;  5GAM d;  1M1G A;  5KCO A;  4M7A A;  4M7A D;  4PJO A;  4JLG A;  1KC8 C;  4M7D E;  3HRT A;  1M1K U;  5GMK h;  5KCH A;  2KVQ G;  5GAN 5;  4M7D F;  4M7A F;  1H3Z A;  4C0D B;  1Y96 B;  2RHX A;  1NE8 A;  3L1A A;  1YHQ T;  3OS2 A;  4M7A E;  1VQN T;  2EIF A;  4RG8 A;  4A4E A;  4J6X A;  4HT8 A;  2RJC A;  3BY7 A;  1LJO A;  3TEE A;  3OS1 A;  3JB9 D;  3J7A F;  3HRS A;  4M7D A;  4HKE A;  2LC4 A;  3H8Z A;  5LJ5 e;  3P8B B;  4M75 D;  3TU4 K;  2DTO A;  2RM4 A;  3OSV A;  2V8I A;  4C0G A;  3CPW S;  3FIF A;  4C8Q A;  3M5A A;  3A5Z B;  3WXM B;  5GAO l;  4C92 C;  2LVM A;  3V7S A;  1UGP B;  3G7Z A;  2LQK A;  4XTW A;  4M7A C;  2PVG B;  4EMK B;  3CPW A;  5AYF A;  3KBG A;  5LJ5 d;  4FM4 B;  2Y4X A;  5LJ3 f;  5GAN f;  2XDB A;  1K9M U;  3JCM c;  3RES A;  5LJ3 g;  5DM7 R;  4M7D B;  2ZPE B;  3VJP A;  1YIJ T;  4LDX A;  1UGS B;  3QZ9 B;  3OQ5 A;  2RD1 A;  4QQD A;  3M53 A;  2HAX A;  1XQH A;  2XDP A;  4PJO D;  3OA6 A;  1VQM T;  4BE1 A;  1VQN A;  1OZ3 A;  3JCM V;  4C8Q F;  5HKC A;  5GAO p;  2E41 A;  4GLK A;  2DIG A;  1VQO A;  4PJO F;  2K2V A;  1Q82 C;  4IUV A;  2D9T A;  2L8D A;  2LQ8 A;  3QYG B;  2QQA A;  3ZEH A;  3OYJ A;  1I4K 1;  1Q82 U;  1M90 U;  3S3O A;  2QA4 T;  4MZT A;  2ZPB B;  4M77 C;  3LGF A;  4Y91 A;  3PT9 A;  4RKU E;  1PSE A;  2RI3 A;  2GF7 A;  2VGN A;  5A0L A;  3DB3 A;  4IUT A;  4ELY C;  3I55 A;  2KK4 A;  3J80 E;  4O6J A;  3O8V A;  3HL8 A;  4JRQ A;  3Q1J A;  3CCS T;  3QPH A;  1HK9 A;  2KAF A;  1S72 T;  3RIR A;  1LOJ A;  3TCJ A;  2XHC A;  4ZTF A;  1NJI U;  5GMK l;  1N6A A;  2EJ9 A;  4EMH A;  5CKE A;  1UEB A;  2GFA A;  2JZ2 A;  3M57 A;  4KT0 E;  4QVZ A;  4BD3 A;  4A4F A;  2RB6 A;  3G6E A;  1VQK A;  3FB9 A;  1ZHI A;  4EPC A;  1KD1 U;  2F69 A;  4FIB A;  4GY5 A;  3CBM A;  3CCM A;  2X4W A;  3OB9 A;  5C6S A;  4NOY A;  3OYF A;  2LX9 A;  3G71 A;  1BIB A;  3OS0 A;  3E19 A;  3CCQ A;  4M75 E;  1VQ6 A;  5GAN 4;  4C8Q G;  2VUB A;  1VQP A;  5CKB A;  3LWI A;  1N27 A;  2XID A;  5CKH A;  3CCV A;  3RKY A;  3VU3 C;  5GMK j;  4WF2 A;  5GAM g;  4FT4 A;  3E9G A;  2DD5 A;  3MP1 A;  1VQ7 A;  5CAI A;  4BE2 A;  2DJZ A;  4EMK A;  1LNX A;  1WJQ A;  4MZM A;  2LRQ A;  4JRK A;  5LJ5 h;  3CCQ T;  1OI1 A;  1Q7Y U;  4C8Q D;  1VQP T;  4OGC A;  1Q86 C;  2CGH A;  4P5N A;  3CMA A;  3RKX A;  2A7Y A;  1I81 A;  2DAQ A;  2OAU A;  5GAO n;  2WSE E;  2LT1 A;  4OB3 B;  3L2R A;  1K8A C;  3PMT A;  3EFR A;  5I2M A;  4PJO G;  1IZ6 A;  3PNW C;  1KHC A;  4E7J A;  3CCJ T;  5GAN 7;  1VQ4 A;  2LNV A;  4B9W A;  1VQK T;  2JN0 A;  4RMO A;  2MMP A;  3MP8 A;  2X4Y A;  3QKJ A;  2EKO A;  3LGL A;  3JB9 J;  3QII A;  1YBY A;  5IAY A;  2JOY A;  3CC7 T;  1Y71 A;  3CCL T;  3QSU A;  2EAY A;  2OTL A;  5D6Y A;  4XQ3 A;  4XU2 A;  2XKO C;  4BI8 B;  3JAM E;  3MEA A;  3T9N A;  3OYA A;  2R57 A;  3JB9 I;  2ZPH B;  4PL6 A;  1RI0 A;  5D6X A;  3JCM e;  4BE0 A;  1YIT T;  1H64 1;  5GAN 3;  5D6W A;  3RMQ A;  2DZC A;  4MMK A;  5GAM e;  4M77 E;  2E64 A;  2DPP B;  3ZBD A;  4HCC A;  4L6V 5;  3OYD A;  4C5H A;  3M4G A;  4DQ2 A;  4OF1 A;  4ELZ C;  1BI0 A;  3EFS A;  5FLX E;  4R55 A;  2XU8 A;  4RCB A;  3FC3 A;  3OW2 S;  1UGR B;  3ME9 A;  4C92 B;  1VQ5 T;  2CZ6 B;  2P0Q A;  3GOX A;  3QUI A;  4A4K A;  3OYI A;  3CXC S;  3WVD B;  4M78 F;  1U8R A;  3MEU A;  2DVE A;  5I2S A;  2VYT A;  4BAC A;  1Y96 A;  4PNO A;  4KUL A;  3JCM X;  2RHZ A;  4OVA A;  1YCY A;  4F7U E;  1UGQ B;  4C5I A;  5IN1 A;  4OB2 B;  1VIF A;  2KQW A;  4EMG A;  2RHU A;  3CD6 A;  4PKC C;  1QP2 A;  2AHJ B;  2QQ9 A;  4XTU A;  4A54 A;  3PGG A;  3S6W A;  2GCX A;  2L3R A;  1UB4 A;  3HFO A;  3EAE A;  1VQ4 T;  3VYG A;  4XU0 A;  4LDY A;  3NTI A;  5GAN 2;  1YJN A;  2RJD A;  3VKI A;  5HY6 A;  3UDC A;  2DTH A;  3H6Z A;  3QBY A;  5FU6 C;  2RJE A;  2CKK A;  2EFI A;  3CBP A;  4C5G A;  1MHN A;  2QXF A;  4XTX A;  3DB4 A;  3X20 B;  1BIA A;  4XAX B;  4J83 A;  4UC4 A;  3SDZ A;  1BI2 A;  2E10 A;  4QVD A;  2EQK A;  3CCR T;  3CCU A;  2EQJ A;  2IVW A;  1TH7 A;  2K5I A;  4A4G A;  4N4H A;  2ZPF B;  3JCM P;  4N4I A;  5IT9 E;  1G5V A;  3P8H A;  2G3R A;  2E65 A;  3FRN A;  4QW2 A;  1VQ9 T;  4PJO B;  2DK3 A;  2DO3 A;  4C92 E;  2M0O A;  5A0D A;  2L5Q A;  1KC8 U;  3UT1 A;  3CCR A;  1BI1 A;  1SSF A;  3OYG A;  4BY6 C;  5CKF A;  3CCV T;  5GAN j;  5LJ3 j;  2ZGW A;  4M7D D;  3CCS A;  3RMS A;  1QP3 A;  3MEW A;  1Q81 U;  3JCM b;  3L2Q A;  3BFM A;  1YJN T;  1OZ2 A;  3LLR A;  2H3J A;  4XU3 A;  5CVI A;  2HD0 A;  4VUB A;  5CIU A;  4ZN3 A;  4HT9 A;  3JCM f;  2CYZ B;  3S3M A;  3JRZ A;  3FDR A;  3SB2 A;  4IUR A;  3UPU A;  4RG2 A;  2E5Q A;  3GNF B;  5A2Q E;  3L2U A;  2JNG A;  1O9S A;  1U1T A;  4JRI A;  5LL6 S;  4M75 B;  4XTV A;  3M4Y A;  4E47 A;  2E6Z A;  5LJ3 h;  2QEX T;  2X4X A;  2FL7 A;  1FWZ A;  2CZ7 B;  4M78 C;  2WAC A;  3KXT A;  1HXD A;  4JS4 A;  3DLM A;  1VQ9 A;  1ZBX A;  5GAN 6;  5A0G A;  1KQS S;  3M59 A;  2O01 E;  2B8A A;  1JBM A;  3BDL A;  3VV0 A;  3X28 B;  2KY9 A;  4EMK C;  3RUX A;  2EQU A;  1KHI A;  3SWN B;  4M7A B;  4E7L A;  4J5Y A;  4LDU A;  5FU7 C;  4OB0 B;  1I8F A;  5DY9 A;  3OYE A;  1NJI C;  2XG8 D;  2PVO B;  5KE2 A;  4DA4 A;  2Y90 A;  1B34 B;  2ZZD A;  4DOV A;  4BUG A;  3PIP A;  5LJ3 d;  2MF2 A;  3V8L A;  5KE3 A;  1YJ9 A;  5HK0 A;  4XU1 A;  4E7I A;  2QI2 A;  3A8M B;  3CCE T;  4NL2 A;  4M78 G;  1Q86 U;  4C0Z A;  4V2S A;  1WQ7 A;  1M4Z A;  1QVP A;  3C95 A;  2GQV A;  4X9C A;  1YIJ A;  4M75 C;  2C06 A;  3ASK A;  2GFU A;  2EWN A;  5KH6 A;  3V7C A;  2DXB A;  4A53 A;  4F7U G;  3AHU A;  4JLI A;  3OBW A;  3L2Z A;  3SD4 A;  5LJ5 j;  1WJS A;  2F5K A;  1D3B B;  4ME7 A;  1OYX A;  2LTO A;  1Y07 A;  2PUO B;  3VUZ A;  1YIT A;  2IG0 A;  2PU9 B;  2QA4 A;  2VXE A;  3SFM A;  3M9Q A;  2DZ9 A;  4B9X A;  4BI4 A;  4ZGJ B;  4J8O A;  2MWO A;  4M75 F;  1NZ9 A;  3CPF A;  1KD1 C;  1VQ8 T;  4J6W A;  1KG1 A;  1EIF A;  2LT4 A;  3QO3 A;  2VGM A;  3SWN A;  2DXU A;  1RL2 A;  2MAM A;  5GAM f;  3M55 A;  2DXC A;  4ZGD B;  3I56 A;  4C8Q E;  3OYL A;  1YJW T;  4C92 G;  4KUD K;  2CZ1 B;  4PJO E;  2FHD A;  4E7H A;  2VXF A;  2R58 A;  1KQS A;  2PUK B;  2EJF A;  2M16 A;  1YI2 T;  1PSF A;  3X26 B;  1M5Q 1;  1XOV A;  2FVU A;  3P8D A;  3NTH A;  3RER A;  3CCM T;  5GAN 8;  2RHI A;  5CQX A;  2OTJ T;  2RI2 A;  3GF5 A;  3MHX A;  3G4S T;  5FRM A;  2VC8 A;  1B34 A;  2CZ0 B;  1JRI A;  2HBP A;  2LDM A;  4J6Y A;  3C4S A;  3JCM d;  4MML A;  2D6F A;  3OMG A;  1VQ6 T;  2K3Y A;  4ZTJ A;  1I5L A;  3JB9 H;  1WJR A;  2YRV A;  5J26 A;  2QQB A;  1XNI A;  4JDS A;  1JJ2 S;  2MI6 A;  2XIC A;  3MP6 A;  4OGE A;  3L2V A;  3JSC A;  1BI3 A;  2VV5 A;  4O5V A;  4C8Q C;  4D6W A;  4R56 A;  3MO8 A;  2E12 A;  2YHT A;  1YJW A;  4M77 D;  3PMI A;  5J39 A;  2EYQ A;  5CKD A;  1M8V A;  2BUD A;  3G71 T;  1K73 U;  2QDY B;  1W2B S;  3HSB A;  5GAO r;  1Q81 C;  2EQM A;  4M75 A;  2X4J A;  1YI2 A;  4JS5 A;  2FB7 A;  4M77 F;  1VQL T;  4BDZ A;  2WSC E;  5CCA A;  2HNI A;  1G3Y A;  2Y4Y A;  1W2B A;  1K8A U;  1VQO T;  3QXE B;  5FU7 B;  4M77 G;  2CS7 A;  1VQ7 T;  1KQ2 A;  4Z02 A;  3NFC A;  4MDW A;  2K5L A;  1VQ5 A;  2XD0 A;  4C5E A;  4ZGE B;  1DJ7 B;  1JB0 E;  3CC7 A;  2YLC A;  4IUU A;  2M1H A;  4E7K A;  3S3N A;  1VQ8 A;  1P92 A;  3FLG A;  2JVV A;  4PLI A;  4M78 B;  1FX7 A;  5L8R E;  3CC2 A;  4C0F A;  1G3W A;  3OMC A;  3I55 T;  3NTK A;  5GMK m;  3CXC A;  1S72 A;  1O75 A;  4C92 F;  4JJN K;  4M77 A;  2ZPG B;  4IKF A;  2K3X A;  2DTI A;  3GLX A;  4IUP A;  5GAO q;  3HFN A;  1M1K C;  3QZ5 B;  4TVR A;  4M75 G;  3JCM g;  3DLL A;  2A3L A;  2OTL T;  3OBY A;  4MDX A;  3QJ6 A;  2RA2 A;  4FL6 A;  1K73 C;  2QEX A;  1JJ2 A;  3A8L B;  4FU6 A;  1W4S A;  2P0K A;  4BB7 A;  2O4X A;  3QHS A;  3JCM h;  2RJF A;  5M9O A;  4JRP A;  2BKD N;  4FT2 A;  3OYY A;  3X25 B;  5CK9 A;  4HCZ A;  2KMT A;  3KUF A;  1M1F A;  3OSS C;  4XTY A;  3CC2 T;  3DKM A;  2XDD A;  4M7A G;  2EJG A;  2LCL A;  5EG2 A;  3LH0 A;  5GAN g;  2MWP A;  3C12 A;  4FSX A;  3OYC A;  4ATO A;  5GAM j;  3VYH B;  2E70 A;  3CC4 T;  2DKG A;  3FEO A;  3R6O A;  4OP0 A;  1VQL A;  2XK0 A;  5DLO A;  5CO7 A;  1ZQ1 A;  3WVE B;  5GAO m;  2RK2 A;  3I56 T;  3CCJ A;  2DIQ A;  3JCM J;  3PFS A;  3HRU A;  4KUI A;  4M78 D;  1NPR A;  4F7U F;  1QVG S;  1M90 C;  4F7U B;  4LD6 A;  3OYN A;  1M9S A;  4HA8 A;  1R8O B;  3CME A;  4M7D G;  3JCM Q;  2ZPI B;  3CC4 A;  4X34 A;  4OMF B;  1X75 C;  2K5F A;  2M9U A;  5GAN d;  1KQ1 A;  4C92 D;  1QVG A;  3CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...